WO2021178510A1 - Compositions and methods for the treatment of ornithine transcarbamylase deficiency - Google Patents
Compositions and methods for the treatment of ornithine transcarbamylase deficiency Download PDFInfo
- Publication number
- WO2021178510A1 WO2021178510A1 PCT/US2021/020634 US2021020634W WO2021178510A1 WO 2021178510 A1 WO2021178510 A1 WO 2021178510A1 US 2021020634 W US2021020634 W US 2021020634W WO 2021178510 A1 WO2021178510 A1 WO 2021178510A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- mrna
- composition
- lipid
- otc
- mol
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CC(C)(CCC(C(*)C1*)OC1[n]1c(N=C(N)NC2=O)c2[n+](C)c1)IC(C)(C)ICC(C(C1*)I*)OC1[n]1c2ncnc(N)c2nc1 Chemical compound CC(C)(CCC(C(*)C1*)OC1[n]1c(N=C(N)NC2=O)c2[n+](C)c1)IC(C)(C)ICC(C(C1*)I*)OC1[n]1c2ncnc(N)c2nc1 0.000 description 4
- XSWXHOQMWXTMEH-QOCHGBHMSA-N CCCCCCCC(CCCCCCC)OC(CCCN(CCCC(OC/C=C\CCCCCC)=O)C(SCCN(C)C)=O)=O Chemical compound CCCCCCCC(CCCCCCC)OC(CCCN(CCCC(OC/C=C\CCCCCC)=O)C(SCCN(C)C)=O)=O XSWXHOQMWXTMEH-QOCHGBHMSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/215—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids
- A61K31/22—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids of acyclic acids, e.g. pravastatin
- A61K31/221—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids of acyclic acids, e.g. pravastatin with compounds having an amino group, e.g. acetylcholine, acetylcarnitine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
- A61K48/0025—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid
- A61K48/0033—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid the non-active part being non-polymeric
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/10—Dispersions; Emulsions
- A61K9/127—Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
- A61K9/1271—Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers
- A61K9/1272—Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers comprising non-phosphatidyl surfactants as bilayer-forming substances, e.g. cationic lipids or non-phosphatidyl liposomes coated or grafted with polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/10—Dispersions; Emulsions
- A61K9/127—Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
- A61K9/1271—Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1003—Transferases (2.) transferring one-carbon groups (2.1)
- C12N9/1018—Carboxy- and carbamoyl transferases (2.1.3)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y201/00—Transferases transferring one-carbon groups (2.1)
- C12Y201/03—Carboxy- and carbamoyltransferases (2.1.3)
- C12Y201/03003—Ornithine carbamoyltransferase (2.1.3.3)
Definitions
- the present disclosure relates to the use of mRNA as a therapeutic in the treatment of disease. More specifically, the present disclosure relates to lipid nanoparticle compositions and methods for treating the urea cycle disorder ornithine transcarbamylase (OTC) deficiency.
- OTC urea cycle disorder ornithine transcarbamylase
- Ornithine transcarbamylase is one of six enzymes in the urea cycle that play a role in the breakdown of proteins and removal of ammonia from the body. This metabolic process primarily occurs in hepatocytes with OTC being found in the mitochondria. OTC is specifically responsible for converting carbamoyl phosphate and ornithine into citrulline. Native OTC mRNA encodes a mitochondrial signaling peptide (MSP) that is necessary to redirect the nascent pre-protein from the cytosol into the mitochondria. OTC protein exists as a precursor in the cytosol with the MSP redirecting the pre-peptide into the mitochondria, where it undergoes cleavage of the MSP and delivery of the functional protein into the mitochondrial matrix.
- MSP mitochondrial signaling peptide
- Deficiency of the OTC enzyme results in excessive accumulation of nitrogen, in the form of ammonia (hyperammonemia), in the blood.
- ammonia which is a neurotoxin
- Excess ammonia travels to the central nervous system through the blood, resulting in the symptoms and physical findings associated with OTC deficiency. These symptoms can include vomiting, refusal to eat, progressive lethargy, and coma. If left untreated a hyperammonemic episode may progress to coma and life-threatening complications.
- OTC deficiency The severity and age of onset of OTC deficiency vary from person to person, even within the same family. A severe form of the disorder affects some infants, typically males, shortly after birth (neonatal period). A milder form of the disorder affects some children later in infancy. Both males and females may develop symptoms of OTC deficiency during childhood.
- the treatment of OTC deficiency is aimed at preventing excessive ammonia from being formed or from removing excessive ammonia during a hyperammonemic episode through the use of ammonia scavengers. Long-term therapy for OTC deficiency combines dietary restrictions and the stimulation of alternative methods of converting and excreting nitrogen from the body (alternative pathways therapy).
- Hemodialysis In cases where there is no improvement or in cases where hyperammonemic coma develops, the removal of wastes by filtering an affected individual’s blood through a machine (hemodialysis) may be necessary. Hemodialysis is also used to treat infants, children, and adults who are first diagnosed with OTC deficiency during hyperammonemic coma.
- liver transplantation may be an appropriate treatment option, which has been shown as a potential cure to the hyperammonemia in OTC deficiency.
- this operation is risky and may result in post-operative complications.
- patients will need to follow a medication regimen throughout their lives for immunosuppression therapy.
- nucleic acids In contrast to the current available treatments, the use of nucleic acids as therapeutic agents is an emerging field of medicine that presents both great challenges and great potential in the treatment of disease.
- delivery of a messenger RNA (mRNA) encoding a desired enzyme has the potential to provide the necessary enzymatic activity in a targeted cell of a subject.
- mRNA-based therapies face several obstacles including achieving an adequate in vivo half-life of the mRNA, achieving an adequate translation efficiency of the mRNA such that an effective amount of enzyme is produced, minimizing adverse reactions to the mRNA (e.g., immunogenicity), and effectively delivering the mRNA to a target cell type.
- lipid formulation such as a liposome or a lipid nanoparticle. While the use of lipid formulations has had some success, it has been found that several of the lipids used in these formulations show low in vivo degradability and low potency.
- the present disclosure includes compositions and methods for the treatment of ornithine transcarbamylase (OTC) deficiency.
- the compositions of the present disclosure include a specially designed messenger RNA (mRNA) which shows enhanced in vivo stability and translation efficiency.
- mRNA messenger RNA
- the OTC protein translated from the specially designed mRNA shows enhanced uptake into hepatocytic mitochondria.
- the specially designed mRNA is further combined with a lipid formulation that includes a cationic lipid that offers a high potency (e.g., bioavailability) for delivery of the mRNA to hepatocytes as well as a high level of biodegradability, thus improving both the therapeutic effect of the composition and its safety profile.
- a composition comprising an mRNA encoding an enzyme having ornithine transcarbamylase (OTC) activity; and a lipid formulation comprising an ionizable cationic lipid.
- the ionizable cationic lipid is a compound of Formula (I) or any of its configurations described herein.
- the lipid formulation of the present disclosure further comprises a helper lipid (e.g., a neutral lipid or a noncationic lipid), a cholesterol, and/or a PEG- lipid.
- a method of treating OTC deficiency comprising administering a composition described herein to a subject in need thereof.
- FIGS. 1A-1B show scatter plots illustrating ornithine transcarbamylase (OTC) protein expression in hepatocyte cell lines Hepal,6 (mouse) and Hep3B (human) at 24 hours (FIG. 1 A) and 48 hours (FIG. IB) using In-Cell Western (ICW) assays.
- OTC ornithine transcarbamylase
- FIG. 2 shows a scatter plot that illustrates the correlation of protein stability with compounds screened in Hepal,6 cells at 24 hours in a first round of screening.
- FIG. 3 shows a scatter plot that illustrates the correlation of protein stability with compounds screened in Hep3B cells at 24 hours in a first round of screening.
- FIG. 4 shows a scatter plot illustrating the correlation of protein stability of compounds screened in human primary hepatocytes at 24 hours and 48 hours in a second round of screening (newly designed compounds based on the first round).
- FIG. 5 shows a scatter plot illustrating the correlation of protein stability of compounds screened in human primary hepatocytes at 24 hours and 48 hours in a second round of screening (newly designed compounds based on the first round).
- FIG. 6 shows a scatter plot illustrating the correlation of protein stability of compounds screened in human primary hepatocytes at 24 hours and 48 hours in a third round of screening (newly designed compounds based on rounds 1 and 2).
- FIG. 7 shows a scatter plot illustrating the correlation of protein stability of compounds screened in human primary hepatocytes at 24 hours and 48 hours in a third round of screening (newly designed compounds based on rounds 1 and 2).
- FIG. 8 is a plot illustrating OTC protein expression levels in human primary hepatocytes transfected with selected OTC mRNAs.
- Construct 1799.7 is an mRNA having the sequence of SEQ ID NO: 175 in which 100% of the uridines in SEQ ID NO: 175 are 5- methoxyuridine (5MeOU).
- FIGS. 9A-9B show bar graphs depicting time course OTC expression levels in Spf/ash mice dosed with lipid-formulated human OTC (hOTC) mRNA at 10 mg/kg. Expression levels were measured by Multiple Reaction Monitoring (MRM) using heavy peptides specific for hOTC (FIG. 9A) or endogenous mouse OTC (FIG. 9B).
- MRM Multiple Reaction Monitoring
- FIG. 10 is a bar graph depicting OTC expression levels in Spf/ash mice dosed at 3 mg/kg with OTC-mRNAs using two different uridine chemistries wherein 100% of the uridines are N'-rn ethyl pseudouridine (N1MPU) and 100% of the uridines are 5-methoxyuridine (5MeOU).
- N1MPU N'-rn ethyl pseudouridine
- 5MeOU 5-methoxyuridine
- FIG. 11 is a graph depicting OTC expression levels in Balb/c mice dosed with OTC mRNAs at three different doses and using two different uridine chemistries (N1MPU and 5MeOU).
- FIG. 12 is a graph depicting urinary orotate levels measured in Spf/ash mice dosed with OTC mRNA 1799.7 at three different doses: 0.3 mg/kg, 1 mg/kg and 3 mg/kg.
- Construct 1799.7 is an mRNA having the sequence of SEQ ID NO: 175 wherein 100% of the uridines in SEQ ID NO: 175 are 5MeOU.
- FIG. 13 is a scatter plot comparing human OTC expression levels and urinary orotate at 96 hours in Spf/ash mice dosed with OTC mRNAs at 1 mg/kg and 3 mg/kg using two different uridine chemistries (N1MPU and 5MeOU).
- FIG. 14 is a western blot illustrating the protein expression levels of OTC mRNAs in Spf/ash mice dosed at 1 mg/kg and 3 mg/kg with selected OTC mRNAs.
- FIG. 15 shows results of a western blot illustrating the protein expression levels in mitochondrial vs. cytosolic fractions of Spf/ash mice treated with selected OTC mRNAs.
- FIG. 16 is a plot illustrating the time course of expression of urinary orotate levels in Spf/ash mice treated with selected OTC mRNA.
- FIG. 17 is a plot illustrating the survival of OTC-deficient mice (Spf/ash) on a high protein diet during treatment with three different doses of OTC mRNA 1799.7.
- FIG. 18 is a plot illustrating hOTC expression levels in male Balb/c mice dosed with OTC mRNAs (Construct 2262) having different modifications.
- FIG. 19 is a graph that shows the levels of human OTC protein expression in wild-type mice for several different OTC mRNA lipid formulations at doses of 0.3 mg/kg, 1.0 mg/kg, and 3.0 mg/kg.
- the dotted line labeled as mOTC represents the baseline level of expression for mouse OTC in wildtype mice.
- FIG. 20 is a graph that shows human OTC (hOTC) expression in tissue samples of wild-type mice for four different OTC mRNA lipid formulations at doses of 1.0 mg/kg and 3.0 mg/kg.
- FIG. 21 is a graph that shows the survival of Spf/ash (OTC hypomorph) mice, after inducing hyperammonemia and being fed on a high protein diet (HPD), for a lipid formulation comprising Lipid # 3 as described herein.
- FIG. 22 is a graph that shows the survival of Spf/ash (OTC hypomorph) mice, after inducing hyperammonemia and being fed on a high protein diet (HPD), for a lipid formulation comprising Lipid # 2 as described herein.
- HPD high protein diet
- FIG. 23 is a graph that shows the survival of Spf/ash (OTC hypomorph) mice, after inducing hyperammonemia and being fed on a high protein diet (HPD), for a lipid formulation comprising Lipid # 7 as described herein.
- FIG. 24 is a graph that shows the survival rate of wild-type mice in a lipid tolerability study using OTC mRNA formulations having different ionizable cationic lipids described herein.
- FIG. 25 is a graph that shows lipid clearance over time for tissue samples from mice dosed with an OTC mRNA lipid formulation comprising Lipid # 7 described herein.
- FIG. 26 is a graph that shows lipid clearance over time for tissue samples from mice dosed with an OTC mRNA lipid formulation comprising Lipid # 3 described herein.
- composition comprising an mRNA encoding an enzyme having ornithine transcarbamylase (OTC) activity; and a lipid formulation comprising an ionizable cationic lipid selected from
- the mRNA encodes an OTC enzyme having at least 95% identity to a sequence of SEQ ID NO: 3 or SEQ ID NO: 4. In some embodiments, the mRNA encodes an OTC enzyme consisting of a sequence of SEQ ID NO: 3. In some embodiments, the mRNA encodes an OTC enzyme consisting of a sequence of SEQ ID NO: 4. In some embodiments, the mRNA comprises a coding region having a sequence selected from the group consisting of SEQ ID NOs: 254-258. In some embodiments, the mRNA comprises a coding region having a sequence of SEQ ID NO: 254. In some embodiments, the mRNA comprises a coding region having a sequence of SEQ ID NO: 255.
- the mRNA comprises a coding region having a sequence of SEQ ID NO: 256. In some embodiments, the mRNA comprises a coding region having a sequence of SEQ ID NO: 257. In some embodiments, the mRNA comprises a coding region having a sequence of SEQ ID NO: 258.
- the mRNA further comprises a 5’ untranslated region (5’ UTR) comprising a sequence of SEQ ID NO: 6.
- the mRNA further comprises a Kozak sequence having a sequence of SEQ ID NO: 23 or SEQ ID NO: 24.
- the mRNA further comprises a 3’ untranslated region (3’ UTR) comprising a sequence selected from SEQ ID NOs: 16-22.
- the mRNA further comprises a 3’ poly-adenosine (poly- A) tail comprising about 60 to about 125 consecutive adenine nucleotides.
- the mRNA further comprises a 5’ cap.
- the 5’ cap is m 7 GpppGm having the structure of Formula Cap (IV) disclosed herein, wherein R 1 and R 2 are each OH, R 3 is OC3 ⁇ 4, each L is a phosphate linked by phosphodiester bonds, mRNA is the mRNA encoding an enzyme having OTC activity linked at its 5’ end, and n is 1.
- the 5’ cap is m 7 GpppAmpG having the structure of Formula Cap (XI) disclosed herein, wherein R 1 , R 2 , and R 4 are each OH, n is 1, each L is a phosphate linked by phosphodiester bonds, and mRNA is the mRNA encoding an enzyme having OTC activity linked at its 5’ end.
- Formula Cap (XI) disclosed herein, wherein R 1 , R 2 , and R 4 are each OH, n is 1, each L is a phosphate linked by phosphodiester bonds, and mRNA is the mRNA encoding an enzyme having OTC activity linked at its 5’ end.
- the mRNA comprises a sequence selected from SEQ ID NOs: 1, 73, 119, and 251-253. In some embodiments, the mRNA comprises the sequence of SEQ ID NO: 1. In some embodiments, the mRNA comprises the sequence of SEQ ID NO: 73. In some embodiments, the mRNA comprises the sequence of SEQ ID NO: 119. In some embodiments, the mRNA comprises the sequence of SEQ ID NO: 251. In some embodiments, the sequence of SEQ ID NO: 252. In some embodiments, the mRNA comprises the sequence of SEQ ID NO: 253.
- any one or more of the sequences described herein may be expressly excluded.
- about 1 to about 100% of the uridine nucleotides of the mRNA are 5-methoxy uridine or N '-methyl pseudouridine. In some embodiments, 100% of the uridine nucleotides of the mRNA are 5-methoxy uridine. In some embodiments, 100% of the uridine nucleotides of the mRNA are N 1 - ethyl pseudouridine.
- the ionizable cationic lipid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- the ionizable cationic lipid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- the ionizable cationic lipid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- the lipid formulation comprises lipid nanoparticles.
- the lipid nanoparticles have an average particle size of less than about 100 nm. In some embodiments, the lipid nanoparticles have an average particles size of about 55 nm to about 85 nm. In some embodiments, the lipid nanoparticles encapsulate at least about 50% of the mRNA. In some embodiments, the lipid nanoparticles encapsulate at least about 85% of the mRNA.
- the lipid formulation further comprises a helper lipid selected from dioleoylphosphatidyl ethanolamine (DOPE), dimyristoylphosphatidyl choline (DMPC), distearoylphosphatidyl choline (DSPC), dimyristoylphosphatidyl glycerol (DMPG), dipalmitoyl phosphatidylcholine (DPPC), and phosphatidylcholine (PC).
- DOPE dioleoylphosphatidyl ethanolamine
- DMPC dimyristoylphosphatidyl choline
- DSPC distearoylphosphatidyl choline
- DMPG dimyristoylphosphatidyl glycerol
- DPPC dipalmitoyl phosphatidylcholine
- PC phosphatidylcholine
- the helper lipid is distearoylphosphatidylcholine (DSPC).
- the lipid formulation further comprises cholesterol.
- the lipid formulation further comprises a polyethylene glycol (PEG)-lipid conjugate.
- PEG polyethylene glycol
- the PEG-lipid conjugate is PEG-DMG.
- the PEG-DMG is PEG2000-DMG.
- any one or more of the recited lipids may be expressly excluded.
- the lipid portion of the lipid formulation comprises about 48 mol% to about 66 mol% of the ionizable cationic lipid, about 2 mol% to about 12 mol% DSPC, about 25 mol% to about 42 mol% cholesterol, and about 0.5 mol% to about 3 mol% PEG2000-DMG. In some embodiments, the lipid portion of the lipid formulation comprises about 55 mol% to about 61 mol% of the ionizable cationic lipid, about 5 mol% to about 9 mol% DSPC, about 29 mol% to about 38 mol% cholesterol, and about 1 mol% to about 2 mol% PEG2000-DMG.
- the lipid portion of the lipid formulation comprises about 56 mol% to about 58 mol% of the ionizable cationic lipid, about 6 mol%to about 8 mol% DSPC, about 31 mol% to about 34 mol% cholesterol, and about 1.25 mol% to about 1.75 mol% PEG2000-DMG.
- concentration may be any value or subrange within the recited ranges, including endpoints.
- the ratio may be any value or subrange within the recited ranges, including endpoints.
- the composition has a total lipid:mRNA weight ratio of about 50:1 to about 10:1. In some embodiments, the composition has a total lipid:mRNA weight ratio of about 40:1 to about 20:1. In some embodiments, the composition has a total lipid:mRNA weight ratio of about 35:1 to about 25:1. In some embodiments, the composition has a total lipid:mRNA weight ratio of about 28:1 to about 32:1. In some embodiments, the composition has a total lipid:mRNA weight ratio of about 29: 1 to about 31:1.
- the composition comprises a HEPES buffer at a pH of about 7.4. In some embodiments, the HEPES buffer is at a concentration of about 7 mg/mL to about 15 mg/mL. In some embodiments, the composition further comprises about 2.0 mg/mL to about 4.0 mg/mL of NaCl. In some embodiments, the composition further comprises one or more cryoprotectants. In some embodiments, the one or more cryoprotectants are selected from sucrose, glycerol, or a combination of sucrose and glycerol. In some embodiments, the composition comprises a combination of sucrose at a concentration of about 70 mg/mL to about 110 mg/mL and glycerol at a concentration of about 50 mg/mL to about 70 mg/mL.
- a method of producing an ornithine transcarbamylase (OTC) enzyme in a cell comprising contacting the cell with any of the compositions described herein.
- the cell is a hepatocyte.
- a method of treating ornithine transcarbamylase (OTC) deficiency comprising administering a therapeutically effective amount of any of the compositions described herein to a subject in need thereof.
- the subject is an adult.
- the subject is a child.
- an enzyme having OTC activity is produced in hepatocytes of the subject.
- the administering comprises intravenous administration.
- the composition is administered to the subject at least once per month.
- the composition is administered to the subject at least twice per month.
- the composition is administered to the subject in a dose of from about 0.2 mg of the mRNA per kg of the subject to about 10 mg of the mRNA per kg of the subject.
- the amount may be any value or subrange within the recited ranges, including endpoints.
- a method of expressing an ornithine transcarbamylase (OTC) enzyme in a mammal comprising administering any of the compositions of the present disclosure to the mammal.
- OTC ornithine transcarbamylase
- the present disclosure provides for the use of any of the compositions described herein in the treatment of ornithine transcarbamylase (OTC) deficiency.
- OTC ornithine transcarbamylase
- compositions and methods of the present disclosure include an mRNA that encodes an enzyme having ornithine transcarbamylase (OTC) activity.
- OTC ornithine transcarbamylase
- the mRNA can include several features that enhance its in vivo half-life and translation efficiency.
- the present disclosure provides for DNA scaffolds for producing an mRNA encoding an enzyme having OTC activity via transcription.
- the DNA scaffold can be any suitable form of DNA including a plasmid DNA.
- the polynucleotides contemplated by the present disclosure are further described in detail below.
- the OTC proteins encoded by the mRNA described herein are wildtype human OTC (hOTC).
- the OTC proteins encoded by the mRNA described herein are produced from a heterologous mRNA construct comprising an open reading frame (ORF) also referred to herein as a “coding sequence” (CDS) encoding for an OTC protein.
- ORF open reading frame
- CDS coding sequence
- the coding sequence is codon-optimized.
- a human OTC protein encoded by an mRNA described herein comprises a modified human OTC protein of SEQ ID NO: 4 shown in Table 1.
- SEQ ID NO: 4 has been modified from wild-type OTC of SEQ ID NO: 3 (Table 1) to remove one or more predicted ubiquitination sites resulting in a protein that is less susceptible to ubiquitination and degradation by ubiquitin ligases.
- the removal of predicted ubiquitination sites preferably comprises replacing N-terminus residues that have been found to support ubiquitination such as asparagine, arginine, leucine, lysine or phenylalanine with N-terminus residues that have been found to be stabilizing against ubiquitination such as alanine, glycine, methionine, serine, threonine, valine and proline.
- Stabilization of the modified OTC protein of SEQ ID NO: 4 in this manner is particularly advantageous for preserving the stability of the modified OTC protein during its transport from the cytosol to the mitochondria wherein it exerts its enzymatic activity.
- an OTC protein encoded by an mRNA described herein comprises a protein sequence that is at least about 70%, about 75%, about 80%, about 85%, about 90%, about 95% about 96%, about 97%, about 98%, about 99%, or about 100% identical to human wild type OTC protein of SEQ ID NO: 3 as shown in Table 1, while retaining the OTC protein activity of catalyzing the synthesis of citrulline (in the liver and small intestine) from carbamoyl phosphate and ornithine.
- the OTC protein comprises a signal peptide which is translated and responsible for translocation to the mitochondria.
- This signal peptide is represented by the first 32 amino acids as underlined in SEQ ID NO: 3 and SEQ ID NO: 4 (corresponding nucleotide sequence is underlined in SEQ ID NO: 1 and SEQ ID NO: 2).
- the signal sequence of SEQ ID NO: 4 has also been modified as compared to SEQ ID NO: 3; specifically, an amino acid, valine is inserted at position 3 of SEQ ID NO: 4.
- This modification provides better mitochondrial localization of the modified OTC of SEQ ID NO: 4 as compared to wild type human OTC of SEQ ID NO: 3.
- the open reading frame (ORF) or coding sequence (CDS) of an mRNA sequence described herein encodes an amino acid sequence that is substantially identical to the modified OTC protein of SEQ ID NO: 4.
- the open reading frame (ORF) or coding sequence (CDS) of an mRNA sequence described herein encodes an amino acid sequence that is substantially identical to wild type human OTC protein of SEQ ID NO: 3.
- an OTC protein encoded by an mRNA described herein comprises a protein sequence that is at least about 70%, about 75%, about 80%, about 85%, about 90%, about 95% about 96%, about 97%, about 98%, about 99%, or about 100% identical to a modified human OTC protein of SEQ ID NO: 3 shown in Table 1 while retaining the OTC protein activity of catalyzing the synthesis of citrulline (in the liver and small intestine) from carbamoyl phosphate and ornithine.
- the ORF or CDS of an mRNA described herein encodes an amino acid sequence that is substantially identical to modified human OTC protein of SEQ ID NO: 4.
- the ORF or CDS of an mRNA described herein encoding a human OTC protein comprises a codon optimized polynucleotide sequence at least about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to the mRNA coding sequence of SEQ ID NO: 1 of Table 1.
- an mRNA described herein further comprises a sequence immediately downstream (i.e., in the 3’ direction from) of the CDS that creates a triple stop codon.
- the triple stop codon may be incorporated to enhance the efficiency of translation.
- the translatable oligomer may comprise the sequence AUAAGUGAA (SEQ ID NO: 25) immediately downstream of an OTC CDS of an mRNA sequence described herein.
- a polynucleotide sequence encoding a protein can be altered relative to the wild type for the same sequence to select the best combination of codons that code for the amino acids of the protein.
- all or a portion of the mRNA for example, the coding region or open reading frame (ORF) can be optimized with respect to the codons in that region. Codon optimized sequences can increase protein expression levels (Gustafsson et al., Codon bias and heterologous protein expression. 2004, Trends Biotechnol 22: 346-53) of the encoded proteins while providing other advantages.
- CAI codon adaptation index
- the Low-U method targets only U-containing codons that can be replaced with a synonymous codon with fewer U moieties. If there are a few choices for the replacement, the more frequently used codon will be selected. The remaining codons in the sequence are not changed by the Low-U method.
- This method may be used in conjunction with the disclosed mRNAs to design coding sequences that are to be synthesized with, for example, 5- methoxyuridine or N'-rnethyl pseudouridine. Methods of codon optimization in combination with the use of a modified nucleotide monomer are described in U.S. 2018/0327471, the contents of which are herein incorporated by reference.
- nucleotide sequence of any region of the mRNA or DNA template may be codon optimized. Codon optimization methods are known in the art and may be useful in efforts to achieve one or more of several goals. These goals include to match codon frequencies in target and host organisms to ensure proper folding, to bias GC nucleotide pair content to increase mRNA stability or reduce secondary structures, to minimize tandem repeat codons or base runs that may impair gene construction or expression, to customize transcriptional and translational control regions, to insert or remove protein trafficking sequences, to remove/add post translation modification sites in encoded protein (e.g.
- glycosylation sites to add, remove or shuffle protein domains, to insert or delete restriction sites, to modify ribosome binding sites and mRNA degradation sites, to adjust translational rates to allow the various domains of the protein to fold properly, or to reduce or eliminate problematic secondary structures within the mRNA.
- Suitable codon optimization tools, algorithms and services are known in the art.
- the nucleotide sequence of any region of the mRNA or DNA templates described herein may be codon optimized.
- the primary cDNA template may include reducing the occurrence or frequency of appearance of certain nucleotides in the template strand.
- the occurrence of a nucleotide in a template may be reduced to a level below 25% of said nucleotides in the template.
- the occurrence of a nucleotide in a template may be reduced to a level below 20% of said nucleotides in the template.
- the occurrence of a nucleotide in a template may be reduced to a level below 16% of said nucleotides in the template.
- the occurrence of a nucleotide in a template may be reduced to a level below 15%, and preferably may be reduced to a level below 12% of said nucleotides in the template.
- the nucleotide reduced is uridine.
- the present disclosure provides nucleic acids with altered uracil content wherein at least one codon in the wild-type sequence has been replaced with an alternative codon to generate a uracil-altered sequence.
- Altered uracil sequences can have at least one of the following properties:
- an increase or decrease in global uracil content i.e., the percentage of uracil of the total nucleotide content in the nucleic acid of a section of the nucleic acid, e.g., the open reading frame
- a change in uracil clustering e.g., number of clusters, location of clusters, or distance between clusters
- the percentage of uracil nucleobases in the nucleic acid sequence is reduced with respect to the percentage of uracil nucleobases in the wild-type nucleic acid sequence.
- 30% of nucleobases may be uracil in the wild-type sequence but the nucleobases that are uracil are preferably lower than 15%, preferably lower than 12% and preferably lower than 10% of the nucleobases in the nucleic acid sequences of the disclosure.
- the percentage uracil content can be determined by dividing the number of uracil in a sequence by the total number of nucleotides and multiplying by 100.
- the percentage of uracil nucleobases in a subsequence of the nucleic acid sequence is reduced with respect to the percentage of uracil nucleobases in the corresponding subsequence of the wild-type sequence.
- the wild-type sequence may have a 5 '-end region (e.g., 30 codons) with a local uracil content of 30%, and the uracil content in that same region could be reduced to preferably 15% or lower, preferably 12% or lower and preferably 10% or lower in the nucleic acid sequences of the disclosure.
- These subsequences can also be part of the wild-type sequences of the heterologous 5’ and 3’ UTR sequences of the present disclosure.
- codons in the nucleic acid sequence of the disclosure reduce or modify, for example, the number, size, location, or distribution of uracil clusters that could have deleterious effects on protein translation.
- lower uracil content is desirable in certain aspects, the uracil content, and in particular the local uracil content, of some subsequences of the wild-type sequence can be greater than the wild-type sequence and still maintain beneficial features (e.g., increased expression).
- the uracil-modified sequence induces a lower Toll-Like Receptor (TLR) response when compared to the wild-type sequence.
- TLR Toll-Like Receptor
- ds Double-stranded
- ss Single-stranded
- RNA oligonucleotides for example RNA with phosphorothioate internucleotide linkages, are ligands of human TLR8.
- DNA containing unmethylated CpG motifs characteristic of bacterial and viral DNA, activate TLR9.
- TLR response is defined as the recognition of single- stranded RNA by a TLR7 receptor, and preferably encompasses the degradation of the RNA and/or physiological responses caused by the recognition of the single-stranded RNA by the receptor.
- Methods to determine and quantify the binding of an RNA to a TLR7 are known in the art.
- methods to determine whether an RNA has triggered a TLR7-mediated physiological response are well known in the art.
- a TLR response can be mediated by TLR3, TLR8, or TLR9 instead of TLR7. Suppression of TLR7-mediated response can be accomplished via nucleoside modification.
- Human rRNA for example, has ten times more pseudouracil ('R) and 25 times more 2'-0-methylated nucleosides than bacterial rRNA.
- Bacterial mRNA contains no nucleoside modifications, whereas mammalian mRNAs have modified nucleosides such as 5-methylcytidine (m 5 C), N 6 - methyladenosine (m 6 A), inosine and many 2'-0-methylated nucleosides in addition to N 7 - methylguanosine (m 7 G).
- the uracil content of polynucleotides disclosed herein and preferably polynucleotides encoding the modified OTC protein of SEQ ID NO: 4 is less than about 50%, 49%, 48%, 47%, 46%, 45%, 44%, 43%, 42%, 41%, 40%, 39%, 38%, 37%, 36%, 35%, 34%, 33%, 32%, 31%, 30%, 29%, 28%, 27%, 26%, 25%, 24%, 23%, 22%, 21%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% or 1% of the total nucleobases in the sequence in the reference sequence.
- the uracil content of polynucleotides disclosed herein and preferably polynucleotides encoding the modified OTC protein of SEQ ID NO: 4 is between about 5% and about 25%. In some embodiments, the uracil content of polynucleotides disclosed herein and preferably polynucleotides encoding the modified OTC protein of SEQ ID NO: 4 is between about 15% and about 25%.
- an mRNA described herein comprises one or more chemically modified nucleotides.
- nucleic acid monomers include non-natural, modified, and chemically-modified nucleotides, including any such nucleotides known in the art.
- Nucleotides can be artificially modified at either the base portion or the sugar portion.
- most polynucleotides comprise nucleotides that are “unmodified” or “natural” nucleotides, which include the purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine (C) and uracil (U).
- mRNA polynucleotides comprising chemically modified nucleotides have been shown to improve mRNA expression, expression rates, half-life and/or expressed protein concentrations. mRNA polynucleotides comprising chemically modified nucleotides have also been useful in optimizing protein localization thereby avoiding deleterious bio-responses such as immune responses and/or degradation pathways.
- modified or chemically-modified nucleotides include 5- hydroxycytidines, 5-alkylcytidines, 5-hydroxyalkylcytidines, 5-carboxycytidines, 5- formylcytidines, 5-alkoxycytidines, 5-alkynylcytidines, 5-halocytidines, 2-thiocytidines, N4- alkylcytidines, N 4 -aminocytidines, N 4 -acetylcytidines, and N 4 ,N 4 -dialkylcytidines.
- modified or chemically-modified nucleotides include 5- hydroxycytidine, 5-methylcytidine, 5-hydroxymethylcytidine, 5-carboxycytidine, 5- formylcytidine, 5-methoxycytidine, 5-propynylcytidine, 5-bromocytidine, 5-iodocytidine, 2- thiocytidine; N 4 -methylcytidine, N 4 -aminocytidine, N 4 -acetylcytidine, and N 4 ,N 4 - dimethylcytidine.
- modified or chemically-modified nucleotides include 5- hydroxyuridines, 5-alkyluridines, 5-hydroxyalkyluridines, 5-carboxyuridines, 5- carboxyalkylesteruridines, 5-formyluridines, 5-alkoxyuridines, 5-alkynyluridines, 5-halouridines, 2-thiouridines, and 6-alkyluridines.
- modified or chemically-modified nucleotides include 5- hydroxyuridine, 5-methyluridine, 5-hydroxymethyluridine, 5-carboxyuridine, 5- carboxymethylesteruridine, 5-formyluridine, 5-methoxyuridine (also referred to herein as “5MeOU”), 5-propynyluridine, 5-bromouridine, 5-fluorouridine, 5-iodouridine, 2-thiouridine, and 6-methyluridine.
- modified or chemically-modified nucleotides include 5- methoxycarbonylmethyl-2-thiouridine, 5-methylaminomethyl -2-thiouridine, 5- carbamoylmethyluridine, 5-carbamoylmethyl-2’-0-methyluridine, 1 -methyl-3 -(3 -amino-3 - carboxypropy)pseudouridine, 5-methylaminomethyl-2-selenouridine, 5-carboxymethyluridine, 5- methyldihydrouridine, 5-taurinomethyluridine, 5-taurinomethyl-2-thiouridine, 5- (isopentenylaminomethyl)uridine, 2 , -0-methylpseudouridine, 2-thio-2O-methyluridine, and 3,2’-0-dimethyluridine.
- modified or chemically-modified nucleotides include N 6 - methyladenosine, 2-aminoadenosine, 3-methyladenosine, 8-azaadenosine, 7-deazaadenosine, 8- oxoadenosine, 8-bromoadenosine, 2-methylthio-N 6 -methyladenosine, N 6 -isopentenyladenosine, 2-methylthio-N 6 -isopentenyladenosine, N 6 -(cis-hydroxyisopentenyl)adenosine, 2-methylthio-N 6 - (cis-hydroxyisopentenyl)adenosine, N 6 -glycinylcarbamoyladenosine, N 6 -threonylcarbamoyl- adenosine, N 6 -methyl -N 6 -threonylcarbamoyl-adenosine, N 6
- modified or chemically-modified nucleotides include N 1 - alkylguanosines, N 2 -alkylguanosines, thienoguanosines, 7-deazaguanosines, 8-oxoguanosines, 8- bromoguanosines, 06-alkylguanosines, xanthosines, inosines, and N ⁇ alkylinosines.
- modified or chemically-modified nucleotides include N 1 - methylguanosine, N 2 -methylguanosine, thienoguanosine, 7-deazaguanosine, 8-oxoguanosine, 8- bromoguanosine, 06-methylguanosine, xanthosine, inosine, and N'-methylinosine.
- Examples of modified or chemically-modified nucleotides include pseudouridines.
- Examples of pseudouridines include N ⁇ alkylpseudouridines, N 1 - cycloalkylpseudouridines, N'-hydroxypseudouri dines, N'-hydroxyalkylpseudouridines, N 1 - phenylpseudouridines, N'-phenylalkyl pseudouridines, N'-ami noalkyl pseudouridines, N 3 - alkylpseudouridines, N -alkyl pseudouridines, N 6 -alkoxypseudouridines, N 6 - hydroxypseudouridines, N 6 -hydroxyalkylpseudouridines, N 6 -morpholinopseudouridines, N 6 - phenylpseudouridines, and N 6 -halopseud
- pseudouridines examples include N 1 - alkyl-N 6 -alkylpseudouridines, N'-alkyl-N -alkoxypseudouri dines, N'-alkyl-N 6 - hydroxypseudouridines, N 1 -alkyl-N 6 -hydroxyalkylpseudouridines, N'-alkyl-N 6 - morpholinopseudouridines, N'-alkyl-N -phenylpseudouri dines, and N'-alkyl-N 6 - halopseudouridines.
- the alkyl, cycloalkyl, and phenyl substituents may be unsubstituted, or further substituted with alkyl, halo, haloalkyl, amino, or nitro substituents.
- pseudouridines examples include N'-methyl pseudouridine (also referred to herein as “N1MPU”), N'-ethyl pseudouridine, N'-propyl pseudouridine, N 1 - cyclopropylpseudouridine, N'-phenyl pseudouridine, Nl-aminomethylpseudouridine, N 3 - methylpseudouridine, N'-hydroxypseudouri dine, and N 1 -hydroxymethyl pseudouridine.
- N1MPU N'-methyl pseudouridine
- N1MPU N'-ethyl pseudouridine
- N'-propyl pseudouridine N 1 - cyclopropylpseudouridine
- N'-phenyl pseudouridine Nl-aminomethylpseudouridine
- N 3 - methylpseudouridine N'-hydroxypseudouri dine
- N 1 -hydroxymethyl pseudouridine examples
- nucleic acid monomers include modified and chemically- modified nucleotides, including any such nucleotides known in the art.
- modified and chemically-modified nucleotide monomers include any such nucleotides known in the art, for example, 2'-0-methyl ribonucleotides, 2'-0-methyl purine nucleotides, 2'-deoxy-2'-fluoro ribonucleotides, 2'-deoxy-2'-fluoro pyrimidine nucleotides, 2'-deoxy ribonucleotides, 2'-deoxy purine nucleotides, universal base nucleotides, 5-C-methyl- nucleotides, and inverted deoxyabasic monomer residues.
- modified and chemically-modified nucleotide monomers include 3 '-end stabilized nucleotides, 3 '-glyceryl nucleotides, 3 '-inverted abasic nucleotides, and 3'- inverted thymidine.
- modified and chemically-modified nucleotide monomers include locked nucleic acid nucleotides (LNA), 2'-0,4'-C-methylene-(D-ribofuranosyl) nucleotides, 2'- methoxyethoxy (MOE) nucleotides, 2'-methyl-thio-ethyl, 2'-deoxy-2'-fluoro nucleotides, and 2'- O-methyl nucleotides.
- the modified monomer is a locked nucleic acid nucleotide (LNA).
- modified and chemically-modified nucleotide monomers include 2 ',4 '-constrained 2'-0-methoxyethyl (cMOE) and 2'-0-Ethyl (cEt) modified DNAs.
- modified and chemically-modified nucleotide monomers include 2'-amino nucleotides, 2'-0-amino nucleotides, 2'-C-allyl nucleotides, and 2'-0-allyl nucleotides.
- modified and chemically-modified nucleotide monomers include N 6 -methyladenosine nucleotides.
- modified and chemically-modified nucleotide monomers include nucleotide monomers with modified bases 5-(3-amino)propyluridine, 5-(2- mercapto)ethyluridine, 5-bromouridine; 8-bromoguanosine, or 7-deazaadenosine.
- modified and chemically-modified nucleotide monomers include 2’-0-aminopropyl substituted nucleotides.
- modified and chemically-modified nucleotide monomers include replacing the 2'-OH group of a nucleotide with a 2'-R, a 2'-OR, a 2'-halogen, a 2'-SR, or a 2'- amino, where R can be H, alkyl, alkenyl, or alkynyl.
- Example of base modifications described above can be combined with additional modifications of nucleoside or nucleotide structure, including sugar modifications and linkage modifications. Certain modified or chemically-modified nucleotide monomers may be found in nature.
- Preferred nucleotide modifications include N 1 -methyl pseudouridine and 5- methoxyuridine.
- an untranslated region refers to either of two sections, one on each side of a coding sequence on a strand of mRNA. If it is found on the 5' side, it is called the 5' UTR (or leader sequence), or if it is found on the 3' side, it is called the 3' UTR (or trailer sequence).
- 5' UTR or leader sequence
- 3' UTR or trailer sequence
- an mRNA described herein further comprises a 5' untranslated region (UTR) sequence. The 5' UTR is upstream from the coding sequence.
- the 5' UTR Within the 5' UTR is a sequence that is recognized by the ribosome which allows the ribosome to bind and initiate translation.
- the 3' UTR is typically found immediately following the translation stop codon of the coding region.
- the 3' UTR can play an important role in translation termination as well as post-transcriptional modification.
- the 5’ and/or 3’ UTR may affect an mRNA’s stability or efficiency of translation.
- the 5’ UTR may be derived from an mRNA molecule known in the art as relatively stable (e.g., histone, tubulin, globin, glyceraldehyde 1 -phosphate dehydrogenase (GAPDH), actin, or citric acid cycle enzymes) to increase the stability of the translatable oligomer.
- a 5' UTR sequence may include a partial sequence of a cytomegalovirus (CMV) immediate-early 1 (IE1) gene.
- CMV cytomegalovirus
- IE1 immediate-early 1
- the 5’ UTR comprises a sequence selected from the 5’ UTRs of human IL-6, alanine aminotransferase 1, human apolipoprotein E, human fibrinogen alpha chain, human transthyretin, human haptoglobin, human alpha- 1 -anti chymotrypsin, human antithrombin, human alpha- 1 -antitrypsin, human albumin, human beta globin, human complement C3, human complement C5, SynK (thylakoid potassium channel protein derived from the cyanobacteria, Synechocystis sp .), mouse beta globin, mouse albumin, and a tobacco etch virus, or fragments of any of the foregoing.
- SynK thylakoid potassium channel protein derived from the cyanobacteria, Synechocystis sp .
- mouse beta globin mouse albumin
- a tobacco etch virus or fragments of any of the foregoing.
- the 5’ UTR is derived from a tobacco etch virus (TEV).
- TEV tobacco etch virus
- an mRNA described herein comprises a 5’ UTR sequence that is derived from a gene expressed by Arabidopsis thaliana.
- the 5’ UTR sequence of a gene expressed by Arabidopsis thaliana is AT1G58420. Examples of 5 UTRs and 3’ UTRs are described in PCT/US2018/035419, the contents of which are herein incorporated by reference.
- Preferred 5’ UTR sequences comprise SEQ ID NOs: 5-10, 125-127 and 227-247: as shown in Table 2.
- the 5’UTR sequence comprises SEQ ID NO: 6 (AT1G58420).
- an mRNA described herein comprises a 3’UTR.
- the 3’ UTR comprises a sequence selected from the 3’ UTRs of alanine aminotransferase 1, human apolipoprotein E, human fibrinogen alpha chain, human haptoglobin, human antithrombin, human alpha globin, human beta globin, human complement C3, human growth factor, human hepcidin, MALAT-1, mouse beta globin, mouse albumin, and Xenopus beta globin, or fragments of any of the foregoing.
- the 3’ UTR is derived from Xenopus beta globin.
- Exemplary 3’ UTR sequences include SEQ ID NOs: 16-22 as shown in Table 3.
- the translatable oligomer encoding OTC may comprise a sequence immediately downstream of a coding region (i.e., ORF) that creates a triple stop codon.
- a triple stop codon is a sequence of three consecutive stop codons. The triple stop codon can ensure total insulation of an expression cassette and may be incorporated to enhance the efficiency of translation.
- the mRNA may comprise a triple combination of any of the sequences UAG, UGA, or UAA immediately downstream of a ORF described herein. The triple combination can be three of the same codons, three different codons, or any other permutation of the three stop codons.
- an mRNA described herein comprises a translation enhancer sequence. These translation enhancer sequences enhance the translation efficiency of an mRNA described herein and thereby provide increased production of the protein encoded by the mRNA.
- the translation enhancer region may be located in the 5’ or 3’ UTR of an mRNA sequence.
- translation enhancer regions include naturally-occurring enhancer regions from the TEV 5’ UTR and the Xenopus beta-globin 3’ UTR.
- Exemplary 5’ UTR enhancer sequences include but are not limited to those derived from mRNAs encoding human heat shock proteins (HSP) including HSP70-P2, HSP70-M1 HSP72- M2, HSP 17.9 and HSP70-P1.
- HSP human heat shock proteins
- Preferred translation enhancer sequences used in accordance with the embodiments of the present disclosure are represented by SEQ ID Nos: 11-15 as shown in Table 4.
- an mRNA described herein comprises a Kozak sequence.
- a Kozak sequence is a short consensus sequence centered around the translational initiation site of eukaryotic mRNAs that allows for efficient initiation of translation of the mRNA. See, for example, Kozak, Marilyn (1988) Mol. and Cell Biol, 8:2737- 2744; Kozak, Marilyn (1991) J. Biol. Chem, 266: 19867-19870; Kozak, Marilyn (1990) Proc Natl. Acad. Sci. USA, 87:8301-8305; and Kozak, Marilyn (1989) J. Cell Biol, 108:229-241.
- an mRNA described herein comprises a Kozak sequence having the sequence GCCACC (SEQ ID NO: 23).
- an mRNA described herein comprises a partial Kozak sequence “p” having the sequence GCCA (SEQ ID NO: 24).
- Cap structure on the 5'-end of mRNAs which is present in all eukaryotic organisms (and some viruses) is important for stabilizing mRNAs in vivo.
- Naturally occurring Cap structures comprise a ribo-guanosine residue that is methylated at position N7 of the guanine base. This 7-methyl guanosine (m 7 G) is linked via a 5'- to 5 '-triphosphate chain at the 5'- end of the mRNA molecule.
- m 7 Gppp fragment on the 5 '-end is essential for mRNA maturation as it protects the mRNAs from degradation by exonucleases, facilitates transport of mRNAs from the nucleus to the cytoplasm and plays a key role in assembly of the translation initiation complex (Cell 9:645-653, (1976); Nature 266:235, (1977); Federation of Experimental Biologists Society Letter 96:1-11, (1978); Cell 40:223-24, (1985); Prog. Nuc. Acid Res. 35:173-207, (1988); Ann. Rev. Biochem. 68:913-963, (1999); and J Biol.
- Another element of eukaryotic mRNA is the presence of 2'-0-methyl nucleoside residues at transcript position 1 (Cap 1), and in some cases, at transcript positions 1 and 2 (Cap 2).
- the 2'-0-methylation of mRNA provides higher efficacy of mRNA translation in vivo (Proc. Natl. Acad. Sci. USA, 77:3952-3956 (1980)) and further improves nuclease stability of the 5 '-capped mRNA.
- the mRNA with Cap 1 (and Cap 2) is a distinctive mark that allows cells to recognize the bona fide mRNA 5' end, and in some instances, to discriminate against transcripts emanating from infectious genetic elements (Nucleic Acid Research 43 : 482-492 (2015)).
- 5' cap structures and methods for preparing mRNAs comprising the same are given in WO2015/051169 A2, WO/2015/061491, US 2018/0273576, and US Patent Nos. 8,093,367, 8,304,529, and U.S. 10,487,105.
- the 5’ cap is m 7 GpppAmpG, which is known in the art.
- the 5’ cap is m 7 GpppG or m 7 GpppGm, which are known in the art. Structural formulas for embodiments of 5’ cap structures are provided below.
- an mRNA described herein comprises a 5’ cap having the structure of Formula (Cap I).
- B 1 is a natural or modified nucleobase
- R 1 and R 2 are each independently selected from a halogen, OH, and OC3 ⁇ 4
- each L is independently selected from the group consisting of phosphate, phophorothioate, and boranophosphate wherein each L is linked by diester bonds
- n is 0 or 1
- mRNA represents an mRNA of the present disclosure linked at its 5’ end.
- B 1 is G, m 7 G, or A.
- n is 0.
- n is 1.
- B 1 is A or m 6 A and R 1 is OCH3; wherein G is guanine, m 7 G is 7- methylguanine, A is adenine, and m 6 A is N -methyladenine.
- an mRNA described herein comprises a 5’ cap having the structure of Formula (Cap P).
- B 1 and B 2 are each independently a natural or modified nucleobase
- R 1 , R 2 , and R 3 are each independently selected from a halogen, OH, and OCH 3
- each L is independently selected from the group consisting of phosphate, phophorothioate, and boranophosphate wherein each L is linked by diester bonds
- mRNA represents an mRNA of the present disclosure linked at its 5’ end; and n is 0 or 1.
- B 1 is G, m 7 G, or A.
- n is 0.
- n is 1.
- B 1 is A or m 6 A and R 1 is OCH 3 ; wherein G is guanine, m 7 G is 7-methyl guanine, A is adenine, and m 6 A is N 6 -methyladenine.
- an mRNA described herein comprises a 5’ cap having the structure of Formula (Cap PI).
- B 1 , B 2 , and B 3 are each independently a natural or modified nucleobase
- R 1 , R 2 , R 3 , and R 4 are each independently selected from a halogen, OH, and OCH 3
- each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds
- mRNA represents an mRNA of the present disclosure linked at its 5’ end
- n is 0 or 1.
- at least one of R 1 , R 2 , R 3 , and R 4 is OH.
- B 1 is G, m 7 G, or A. In some embodiments, B 1 is A or m 6 A and R 1 is OCH 3 ; wherein G is guanine, m 7 G is 7-methylguanine, A is adenine, and m 6 A is N 6 - methyladenine. In some embodiments, n is 1.
- an mRNA described herein comprises a m 7 GpppG 5’ cap analog having the structure of Formula (Cap IV).
- R 1 , R 2 , and R 3 are each independently selected from a halogen, OH, and OCH 3; each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds;
- mRNA represents an mRNA of the present disclosure linked at its 5’ end; n is 0 or 1.
- at least one of R 1 , R 2 , and R 3 is OH.
- the 5’ cap is m 7 GpppG wherein R 1 , R 2 , and R 3 are each OH, n is 1, and each L is a phosphate. In some embodiments, n is 1. In some embodiments, the 5’ cap is m7GpppGm, wherein R 1 and R 2 are each OH, R 3 is OCH 3 , each L is a phosphate, mRNA is the mRNA encoding an enzyme having OTC activity linked at its 5’ end, and n is 1.
- an mRNA described herein comprises a m 7 Gpppm 7 G 5’ cap analog having the structure of Formula (Cap V).
- R 1 , R 2 , and R 3 are each independently selected from a halogen, OH, and OCH 3; each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds;
- mRNA represents an mRNA of the present disclosure linked at its 5’ end; and n is 0 or 1.
- at least one of R 1 , R 2 , and R 3 is OH.
- n is 1.
- an mRNA described herein comprises a m 7 Gpppm 7 GpN, 5’ cap analog, wherein N is a natural or modified nucleotide, the 5’ cap analog having the structure of Formula (Cap VI).
- B 3 is a natural or modified nucleobase
- R 1 , R 2 , R 3 , and R 4 are each independently selected from a halogen, OH, and OCH3
- each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds
- mRNA represents an mRNA of the present disclosure linked at its 5’ end
- n is 0 or 3.
- R 1 , R 2 , R 3 , and R 4 is OH.
- B 1 is G, m 7 G, or A.
- B 1 is A or m 6 A and R 1 is OCH3; wherein G is guanine, m 7 G is 7-methyl guanine, A is adenine, and m 6 A is N 6 -methyladenine.
- n is 1.
- an mRNA described herein comprises a m 7 Gpppm 7 GpG 5’ cap analog having the structure of Formula (Cap VII).
- R 1 , R 2 , R 3 , andR 4 are each independently selected from a halogen, OH, and OCH 3; each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds;
- mRNA represents an mRNA of the present disclosure linked at its 5’ end; and n is 0 or 1.
- at least one of R 1 , R 2 , R 3 , andR 4 is OH.
- n is 1.
- an mRNA described herein comprises a m 7 Gpppm 7 Gpm 7 G 5’ cap analog having the structure of Formula (Cap VIII).
- R 1 , R 2 , R 3 , andR 4 are each independently selected from a halogen, OH, and OCH 3; each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds;
- mRNA represents an mRNA of the present disclosure linked at its 5’ end;
- n is 0 or 1.
- at least one of R 1 , R 2 , R 3 , andR 4 is OH.
- n is 1.
- an mRNA described herein comprises a m 7 GpppA 5’ cap analog having the structure of Formula (Cap IX).
- R 1 , R 2 , and R 3 are each independently selected from a halogen, OH, and OCH 3; each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds;
- mRNA represents an mRNA of the present disclosure linked at its 5’ end; and n is 0 or 1.
- at least one of R 1 , R 2 , and R 3 is OH.
- n is 1.
- an mRNA described herein comprises a nfGpppApN 5’ cap analog, wherein N is a natural or modified nucleotide, and the 5’ cap has the structure of Formula (Cap X).
- B 3 is a natural or modified nucleobase
- R 1 , R 2 , R 3 , and R 4 are each independently selected from a halogen, OH, and OCH 3
- each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds
- mRNA represents an mRNA of the present disclosure linked at its 5’ end
- n is 0 or 1.
- R 1 , R 2 , R 3 , andR 4 is OH.
- B 3 is G, m 7 G, A or m 6 A; wherein G is guanine, m 7 G is 7-methyl guanine, A is adenine, and m 6 A is N 6 -methyladenine.
- n is 1.
- an mRNA described herein comprises a nfGpppAmpG 5’ cap analog having the structure of Formula (Cap XI).
- R 1 , R 2 , and R 4 are each independently selected from a halogen, OH, and OCH 3; each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds;
- mRNA represents an mRNA of the present disclosure linked at its 5’ end; and n is 0 or 1.
- at least one of R 1 , R 2 , and R 4 is OH.
- the compound of Formula Cap XI is m 7 GpppAmpG, wherein R 1 , R 2 , and R 4 are each OH, n is 1, and each L is a phosphate linkage. In some embodiments, n is 1.
- an mRNA described herein comprises a m 7 GpppApm 7 G 5’ cap analog having the structure of Formula (Cap CP).
- R 1 , R 2 , R 3 , andR 4 are each independently selected from a halogen, OH, and OCH 3; each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds;
- mRNA represents an mRNA of the present disclosure linked at its 5’ end; and n is 0 or 1.
- at least one of R 1 , R 2 , R 3 , andR 4 is OH.
- n is 1.
- an mRNA described herein comprises a m 7 GpppAmpm 7 G 5’ cap analog having the structure of Formula (Cap CIP).
- R 1 , R 2 , and R 4 are each independently selected from a halogen, OH, and OCH 3; each L is independently selected from the group consisting of phosphate, phosphorothioate, and boranophosphate wherein each L is linked by diester bonds; mRNA represents an mRNA of the present disclosure linked at its 5’ end; and n is 0 or 1. In some embodiments, at least one of R 1 , R 2 , andR 4 is OH. In some embodiments, n is 1.
- Polyadenylation is the addition of a poly(A) tail, a chain of adenine nucleotides usually about 100-120 monomers in length, to an mRNA.
- polyadenylation is part of the process that produces mature mRNA for translation and begins as the transcription of a gene terminates.
- the 3 '-most segment of a newly made pre-mRNA is first cleaved off by a set of proteins; these proteins then synthesize the poly(A) tail at the 3' end.
- the poly(A) tail is important for the nuclear export, translation, and stability of mRNA. The tail is shortened over time, and, when it is short enough, the mRNA is enzymatically degraded.
- mRNAs with short poly(A) tails are stored for later activation by re-polyadenylation in the cytosol.
- an mRNA described herein comprises a 3’ tail region, which can serve to protect the mRNA from exonuclease degradation.
- the tail region may be a 3’poly(A) and/or 3’poly(C) region.
- the tail region is a 3’ poly(A) tail.
- a “3’ poly(A) tail” is a polymer of sequential adenine nucleotides that can range in size from, for example: 10 to 250 sequential adenine nucleotides; 60-125 sequential adenine nucleotides, 90- 125 sequential adenine nucleotides, 95-125 sequential adenine nucleotides, 95-121 sequential adenine nucleotides, 100 to 121 sequential adenine nucleotides, 110-121 sequential adenine nucleotides; 112-121 sequential adenine nucleotides; 114-121 adenine sequential nucleotides; or 115 to 121 sequential adenine nucleotides.
- a 3’ poly(A) tail as described herein comprise 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, or 125 sequential adenine nucleotides.
- 3’ Poly(A) tails can be added using a variety of methods known in the art, e.g., using poly(A) polymerase to add tails to synthetic or in vitro transcribed RNA.
- Other methods include the use of a transcription vector to encode poly(A) tails or the use of a ligase (e.g., via splint ligation using a T4 RNA ligase and/or T4 DNA ligase), wherein poly(A) may be ligated to the 3' end of a sense RNA.
- a combination of any of the above methods is utilized.
- Preferred mRNA sequences include all of the mRNA sequences listed in Table 5.
- mRNA sequences of the present disclosure include all of the mRNA sequences listed in Table 5 in which 0% to 100%, preferably 1% to 100%, preferably 25% to 100%, preferably 50% to 100% and preferably 75% to 100% of the uracil nucleotides of the mRNA sequences are modified.
- 1% to 100% of the uracil nucleotides are N 1 - methylpseudouridine or 5-methoxyuridine.
- 100% of the uracil nucleotides are N 1 - methylpseudouridine.
- an mRNA sequence of the present disclosure comprises a 5’ cap, a 5’UTR derived from a gene expressed by Arabidopsis thaliana , an optional translation enhancer sequence, an optional Kozak sequence or partial Kozak sequence, a codon optimized coding sequence (CDS/ORF) coding for an OTC protein, a 3’ UTR and a poly(A) tail.
- the codon optimized CDS encodes a protein of SEQ ID NO: 3 or SEQ ID NO: 4.
- the 5’ UTR that is derived from a gene expressed by Arabidopsis thaliana is selected from the 5’ UTRs found in Table 2. In some embodiments, the 5’ UTR that is derived from a gene expressed by Arabidopsis thaliana is selected from the group consisting of: SEQ ID NO: 6, SEQ ID NOs: 125-127 and SEQ ID NOs: 227-247. In some embodiments the 5’ UTR sequence is AT1G58420 having at least 90% identity to the sequence of SEQ ID NO: 6. In some embodiments the 5’ UTR sequence is AT1G58420 having the sequence of SEQ ID NO: 6.
- the uracil content of the codon optimized sequence has been reduced with respect to the percentages of uracil content of SEQ ID NO: 1.
- 0% to 100% of the uracil nucleotides of the mRNA sequences are modified.
- 0% to 100% of the uracil nucleotides are N 1 -methyl pseudouridine or 5- methoxyuridine.
- 100% of the uracil nucleotides are N 1 - methylpseudouridine.
- 100% of the uracil nucleotides are 5- methoxyuridine.
- Preferred mRNA constructs comprise codon optimized coding sequences and a 5’ UTR from a gene expressed by Arabidopsis thaliana and are selected from: SEQ ID NOs: 62, 67, 68, 69, 73, 113-119, and 121-127.
- a preferred mRNA construct of the disclosure comprises mRNA construct 1921 (SEQ ID NO: 119) having an optimized ORF encoding the modified human OTC protein of SEQ ID NO: 4 and comprising a 3’ Poly A tail of 121 nucleotides.
- Another preferred mRNA construct comprises construct 2260 (SEQ ID NO: 251) encoding the modified human OTC protein of SEQ ID NO: 4 and comprising a 3’ Poly(A) tail of 100 nucleotides.
- Another preferred mRNA construct comprises construct 2262 (SEQ ID NO: 252) encoding the modified human OTC protein of SEQ ID NO: 4 and comprising a 3’ Poly(A) tail of 100 nucleotides.
- a preferred mRNA sequence of the disclosure includes the mRNA construct 1799 (SEQ ID NO:73) having a codon optimized ORF encoding wild type human OTC of SEQ ID NO: 3 and having a 3’ Poly(A) tail of 121 nucleotides.
- Another preferred mRNA construct of the disclosure includes the mRNA construct 2016 (SEQ ID NO: 253) having a codon optimized ORF encoding wild type human OTC of SEQ ID NO: 3 and comprising a 3’ Poly(A) tail of 100 nucleotides.
- 100% of the uridine nucleotides of mRNA constructs 1799, 2016, 1921, 2260 and 2262 are N ⁇ methylpseudouridine. In some embodiments 100% of the uracil nucleotides of mRNA constructs 1799, 2016, 1921, 2260 and 2262, are 5- methoxyuridine.
- the mRNA for use in accordance with this disclosure can exhibit increased translation efficiency.
- translation efficiency refers to a measure of the production of a protein or polypeptide by translation of an mRNA in accordance with the disclosure.
- an mRNA of the disclosure can exhibit at least 2-fold, 3-fold, 5-fold, or 10- fold increased translation efficiency in vivo as compared to mRNA encoding SEQ ID NO: 3 or SEQ ID NO: 4 that is not codon optimized in accordance with the disclosure and/or that does not comprise the preferred UTRs of the disclosure.
- an mRNA of the disclosure can provide at least a 2-fold, 3-fold, 5-fold, or 10-fold increased polypeptide or protein level in vivo as compared to mRNA encoding SEQ ID NO: 3 or SEQ ID NO: 4 that is not codon optimized and/or does not comprise the preferred UTRs of the disclosure.
- an mRNA of the disclosure can provide increased levels of a polypeptide or protein in vivo as compared to mRNA encoding SEQ ID NO: 3 or SEQ ID NO: 4 that is not codon optimized in accordance with the disclosure and/or that does not comprise the preferred UTRs of the disclosure.
- the level of a polypeptide or protein can be increased by about 10%, or about 20%, or about 30%, or about 40%, or about 50%, or more.
- the mRNA of the disclosure can provide increased functional half-life in the cytoplasm of mammalian cells over mRNA encoding SEQ ID NO: 3 or SEQ ID NO: 4 that is not codon optimized in accordance with the disclosure and/or that does not comprise the preferred UTRs of the disclosure.
- the inventive translatable molecules can have increased half-life of activity as compared to mRNA encoding SEQ ID NO: 3 or SEQ ID NO: 4 that is not codon optimized in accordance with the disclosure and/or that does not comprise the preferred UTRs of the disclosure.
- the mRNA of the disclosure can reduce cellular innate immune response as compared to mRNA encoding SEQ ID NO: 3 or SEQ ID NO: 4 that is not codon optimized in accordance with the disclosure and/or that does not comprise the preferred UTRs of the disclosure.
- the mRNA of the disclosure can reduce the dose levels required for efficacious therapy as compared to mRNA encoding SEQ ID NO: 3 or SEQ ID NO: 4 that is not codon optimized in accordance with the disclosure and/or that does not comprise the preferred UTRs of the disclosure.
- the mRNA agents of the present disclosure may be obtained by any suitable means. Methods for the manufacture of mRNA are known in the art and would be readily apparent to a person of ordinary skill.
- An mRNA for use in accordance with the present disclosure may be prepared according to any available technique including, but not limited to chemical synthesis, in vitro transcription (IVT) or enzymatic or chemical cleavage of a longer precursor, etc.
- mRNA is produced from a primary complementary DNA (cDNA) construct.
- the cDNA constructs can be produced on an RNA template by the action of a reverse transcriptase (e.g., RNA-dependent DNA-polym erase).
- the process of design and synthesis of the primary cDNA constructs described herein generally includes the steps of gene construction, mRNA production (either with or without modifications) and purification.
- a target polynucleotide sequence encoding an OTC protein is first selected for incorporation into a vector which will be amplified to produce a cDNA template.
- the target polynucleotide sequence and/or any flanking sequences may be codon optimized.
- the cDNA template is then used to produce mRNA through in vitro transcription (IVT). After production, the mRNA may undergo purification and clean-up processes. The steps of which are provided in more detail below.
- the step of gene construction may include, but is not limited to gene synthesis, vector amplification, plasmid purification, plasmid linearization and clean-up, and cDNA template synthesis and clean-up.
- a human OTC protein e.g. SEQ ID NO: 3 or SEQ ID NO: 4
- a primary construct is designed.
- a first region of linked nucleosides encoding the polypeptide of interest may be constructed using an open reading frame (ORF) of a selected nucleic acid (DNA or RNA) transcript.
- the ORF may comprise the wild type ORF, an isoform, variant or a fragment thereof.
- an “open reading frame” or “ORF” is meant to refer to a nucleic acid sequence (DNA or RNA) which is capable of encoding a polypeptide of interest. ORFs often begin with the start codon, ATG and end with a nonsense or termination codon or signal.
- the cDNA templates may be transcribed to produce an mRNA sequence described herein using an in vitro transcription (IVT) system.
- the system typically comprises a transcription buffer, nucleotide triphosphates (NTPs), an RNase inhibitor and a polymerase.
- the NTPs may be selected from, but are not limited to, those described herein including natural and unnatural (modified) NTPs.
- the polymerase may be selected from, but is not limited to, T7 RNA polymerase, T3 RNA polymerase and mutant polymerases such as, but not limited to, polymerases able to incorporate modified nucleic acids.
- the primary cDNA template or transcribed mRNA sequence may also undergo capping and/or tailing reactions.
- a capping reaction may be performed by methods known in the art to add a 5' cap to the 5' end of the primary construct. Methods for capping include, but are not limited to, using a Vaccinia Capping enzyme (New England Biolabs, Ipswich, Mass.) or capping at initiation of in vitro transcription, by for example, including a capping agent as part of the IVT reaction. (Nuc. Acids Symp. (2009) 53:129).
- a poly(A) tailing reaction may be performed by methods known in the art, such as, but not limited to, 2' O-methyltransferase and by methods as described herein. If the primary construct generated from cDNA does not include a poly-T, it may be beneficial to perform the poly(A)-tailing reaction before the primary construct is cleaned.
- Codon optimized cDNA constructs encoding an ornithine transcarbamylase (OTC) protein are particularly suitable for generating mRNA sequences described herein.
- such cDNA constructs may be used as the basis to transcribe, in vitro , a polyribonucleotide encoding an ornithine transcarbamylase (OTC) protein.
- Table 6 provides a listing of exemplary cDNA ORF templates used for in vitro transcription of the mRNA sequences listed in Table 5.
- *SEQ ID NO: 3 is the amino acid sequence for wild type human OTC. **SEQ ID NO: 4 is the amino acid sequence for modified human OTC. *** The entire plasmid sequence is not included.
- Preferred cDNA template sequences include the DNA sequence of SEQ ID NO: 175 (pl779) having an optimized coding sequence encoding wild type human OTC of SEQ ID NO: 3.
- Preferred cDNA template sequences also include cDNA sequence of SEQ ID NO: 221 (pl921), having an optimized coding sequence encoding a modified OTC protein of SEQ ID NO: 4.
- the present disclosure also provides expression vectors comprising a nucleotide sequence encoding an ornithine transcarbamylase (OTC) protein that is preferably operably linked to at least one regulatory sequence. Regulatory sequences are art-recognized and are selected to direct expression of the encoded polypeptide.
- OTC ornithine transcarbamylase
- regulatory sequence includes promoters, enhancers, and other expression control elements.
- the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed.
- the present disclosure also provides polynucleotides (e.g. DNA, RNA, cDNA, mRNA, etc.) encoding a human OTC protein that may be operably linked to one or more regulatory nucleotide sequences in an expression construct, such as a vector or plasmid.
- an expression construct such as a vector or plasmid.
- such constructs are DNA constructs.
- Regulatory nucleotide sequences will generally be appropriate for a host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art for a variety of host cells.
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences.
- constitutive or inducible promoters as known in the art are contemplated by the embodiments of the present disclosure.
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
- the present disclosure also provides a host cell transfected with an mRNA or DNA described herein which encodes an ornithine transcarbamylase (OTC) polypeptide described herein.
- the human OTC polypeptide has the sequence of SEQ ID NO: 4.
- the host cell may be any prokaryotic or eukaryotic cell.
- an ornithine transcarbamylase (OTC) polypeptide may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art.
- the present disclosure also provides a host cell comprising a vector comprising a polynucleotide which encodes an mRNA sequence of any one of SEQ ID NOs: 26- 229.
- the present disclosure also provides methods of producing a human wild type OTC protein of SEQ ID NO: 3 or a modified human OTC protein SEQ ID NO: 4.
- the OTC protein is SEQ ID NO: 4 and is encoded by mRNA of SEQ ID NO 119.
- a host cell transfected with an expression vector encoding an OTC protein can be cultured under appropriate conditions to allow expression of the polypeptide to occur.
- the polypeptide may be secreted and isolated from a mixture of cells and medium containing the polypeptides.
- the polypeptides may be retained in the cytoplasm or in a membrane fraction and the cells harvested, lysed and the protein isolated.
- a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
- the expressed OTC proteins described herein can be isolated from cell culture medium, host cells, or both using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, and immunoaffmity purification with antibodies specific for particular epitopes of the (OTC polypeptide).
- nucleic acid material e.g., mRNA
- RES reticuloendothelial system
- RNAs or DNAs are anionic hydrophilic polymers that are not favorable for uptake by cells, which are also anionic at the surface. The success of nucleic acid- based therapies thus depends largely on the development of vehicles or vectors that can efficiently and effectively deliver genetic material to target cells and obtain sufficient levels of expression in vivo with minimal toxicity.
- nucleic acid delivery vectors upon internalization into a target cell, nucleic acid delivery vectors are challenged by intracellular barriers, including endosome entrapment, lysosomal degradation, nucleic acid unpacking from vectors, translocation across the nuclear membrane (for DNA), release at the cytoplasm (for RNA), and so on.
- Successful nucleic acid-based therapy thus depends upon the ability of the vector to deliver the nucleic acids to the target sites inside of the cells in order to obtain sufficient levels of a desired activity such as expression of a gene.
- lipid-based formulations have been increasingly recognized as one of the most promising delivery systems for RNA and other nucleic acid compounds due to their biocompatibility and their ease of large-scale production.
- AAV viral delivery vector
- lipid-based formulations have been increasingly recognized as one of the most promising delivery systems for RNA and other nucleic acid compounds due to their biocompatibility and their ease of large-scale production.
- One of the most significant advances in lipid-based nucleic acid therapies happened in August 2018 when Patisiran (ALN-TTR02) was the first siRNA therapeutic approved by the Food and Drug Administration (FDA) and by the European Commission (EC).
- ALN-TTR02 is an siRNA formulation based upon the so-called Stable Nucleic Acid Lipid Particle (SNALP) transfecting technology.
- SNALP Stable Nucleic Acid Lipid Particle
- lipid-formulated delivery vehicles for nucleic acid therapeutics include, according to various embodiments, polymer based carriers, such as polyethyleneimine (PEI), lipid nanoparticles and liposomes, nanoliposomes, ceramide- containing nanoliposomes, multivesicular liposomes, proteoliposomes, both natural and synthetically-derived exosomes, natural, synthetic and semi-synthetic lamellar bodies, nanoparticulates, micelles, and emulsions.
- PEI polyethyleneimine
- lipid nanoparticles and liposomes such as polyethyleneimine (PEI)
- nanoliposomes such as lipid nanoliposomes, ceramide- containing nanoliposomes, multivesicular liposomes, proteoliposomes, both natural and synthetically-derived exosomes, natural, synthetic and semi-synthetic lamellar bodies, nanoparticulates, micelles, and emulsions.
- lipid formulations can vary in their structure
- lipid formulations have varied as to their intended meaning throughout the scientific literature, and this inconsistent use has caused confusion as to the exact meaning of several terms for lipid formulations.
- liposomes, cationic liposomes, and lipid nanoparticles are specifically described in detail and defined herein for the purposes of the present disclosure.
- Bilayer membranes of liposomes are typically formed by amphiphilic molecules, such as lipids of synthetic or natural origin that comprise spatially separated hydrophilic and hydrophobic domains (Lasic, Trends Biotechnol., 16: 307-321, 1998).
- Bilayer membranes of the liposomes can also be formed by amphiphilic polymers and surfactants (e.g., polymerosomes, niosomes, etc.). They generally present as spherical vesicles and can range in size from 20 nm to a few microns.
- Liposomal formulations can be prepared as a colloidal dispersion or they can be lyophilized to reduce stability risks and to improve the shelf- life for liposome-based drugs. Methods of preparing liposomal compositions are known in the art and would be within the skill of an ordinary artisan.
- Liposomes that have only one bilayer are referred to as being unilamellar, and those having more than one bilayer are referred to as multilamellar.
- the most common types of liposomes are small unilamellar vesicles (SUV), large unilamellar vesicle (LUV), and multilamellar vesicles (MLV).
- lysosomes, micelles, and reversed micelles are composed of monolayers of lipids.
- a liposome is thought of as having a single interior compartment, however some formulations can be multivesicular liposomes (MVL), which consist of numerous discontinuous internal aqueous compartments separated by several nonconcentric lipid bilayers.
- MDL multivesicular liposomes
- Liposomes have long been perceived as drug delivery vehicles because of their superior biocompatibility, given that liposomes are basically analogs of biological membranes, and can be prepared from both natural and synthetic phospholipids (Int J Nanomedicine. 2014; 9:1833-1843).
- a liposome has an aqueous solution core surrounded by a hydrophobic membrane, hydrophilic solutes dissolved in the core cannot readily pass through the bilayer, and hydrophobic compounds will associate with the bilayer.
- a liposome can be loaded with hydrophobic and/or hydrophilic molecules.
- a liposome is used to carry a nucleic acid such as RNA, the nucleic acid will be contained within the liposomal compartment in an aqueous phase.
- Liposomes can be composed of cationic, anionic, and/or neutral lipids.
- cationic liposomes are liposomes that are made in whole or part from positively charged lipids, or more specifically a lipid that comprises both a cationic group and a lipophilic portion.
- the positively charged moieties of cationic lipids used in cationic liposomes provide several advantages and some unique structural features.
- the lipophilic portion of the cationic lipid is hydrophobic and thus will direct itself away from the aqueous interior of the liposome and associate with other nonpolar and hydrophobic species.
- cationic liposomes are increasingly being researched for use in gene therapy due to their favorability towards negatively charged nucleic acids via electrostatic interactions, resulting in complexes that offer biocompatibility, low toxicity, and the possibility of the large-scale production required for in vivo clinical applications.
- Cationic lipids suitable for use in cationic liposomes are listed hereinbelow.
- lipid nanoparticles In contrast to liposomes and cationic liposomes, lipid nanoparticles (LNP) have a structure that includes a single monolayer or bilayer of lipids that encapsulates a compound in a solid phase. Thus, unlike liposomes, lipid nanoparticles do not have an aqueous phase or other liquid phase in its interior, but rather the lipids from the bilayer or monolayer shell are directly complexed to the internal compound thereby encapsulating it in a solid core. Lipid nanoparticles are typically spherical vesicles having a relatively uniform dispersion of shape and size.
- lipid nanoparticle can have a diameter in the range of from 10 nm to 1000 nm. However, more commonly they are considered to be smaller than 120 nm or even 100 nm.
- the lipid shell is formulated to include an ionizable cationic lipid which can complex to and associate with the negatively charged backbone of the nucleic acid core.
- Ionizable cationic lipids with apparent pKa values below about 7 have the benefit of providing a cationic lipid for complexing with the nucleic acid’s negatively charged backbone and loading into the lipid nanoparticle at pH values below the pKa of the ionizable lipid where it is positively charged. Then, at physiological pH values, the lipid nanoparticle can adopt a relatively neutral exterior allowing for a significant increase in the circulation half-lives of the particles following i.v. administration.
- lipid nanoparticles offer many advantages over other lipid-based nucleic acid delivery systems including high nucleic acid encapsulation efficiency, potent transfection, improved penetration into tissues to deliver therapeutics, and low levels of cytotoxicity and immunogenicity.
- cationic lipids Prior to the development of lipid nanoparticle delivery systems for nucleic acids, cationic lipids were widely studied as synthetic materials for delivery of nucleic acid medicines. In these early efforts, after mixing together at physiological pH, nucleic acids were condensed by cationic lipids to form lipid-nucleic acid complexes known as lipoplexes.
- lipoplexes proved to be unstable and characterized by broad size distributions ranging from the submicron scale to a few microns. Lipoplexes, such as the Lipofectamine ® reagent, have found considerable utility for in vitro transfection. However, these first-generation lipoplexes have not proven useful in vivo. The large particle size and positive charge (Imparted by the cationic lipid) result in rapid plasma clearance, hemolytic and other toxicities, as well as immune system activation.
- mRNA as disclosed herein or a pharmaceutically acceptable salt thereof can be incorporated into a lipid formulation (i.e., a lipid-based delivery vehicle).
- a lipid-based delivery vehicle typically serves to transport a desired mRNA to a target cell or tissue.
- the lipid-based delivery vehicle can be any suitable lipid-based delivery vehicle known in the art.
- the lipid-based delivery vehicle is a liposome, a cationic liposome, or a lipid nanoparticle containing an mRNA of the present disclosure.
- the lipid-based delivery vehicle comprises a nanoparticle or a bilayer of lipid molecules and an mRNA of the present disclosure.
- the lipid bilayer preferably further comprises a neutral lipid or a polymer.
- the lipid formulation preferably comprises a liquid medium.
- the formulation preferably further encapsulates a nucleic acid.
- the lipid formulation preferably further comprises a nucleic acid and a neutral lipid or a polymer. In some embodiments, the lipid formulation preferably encapsulates the nucleic acid.
- the description provides lipid formulations comprising one or more therapeutic mRNA molecules encapsulated within the lipid formulation.
- the lipid formulation comprises liposomes.
- the lipid formulation comprises cationic liposomes.
- the lipid formulation comprises lipid nanoparticles.
- the mRNA is fully encapsulated within the lipid portion of the lipid formulation such that the mRNA in the lipid formulation is resistant in aqueous solution to nuclease degradation.
- the lipid formulations described herein are substantially non-toxic to mammals such as humans.
- the lipid formulations of the disclosure also typically have a total lipid:RNA ratio (mass/mass ratio) of from about 1:1 to about 100:1, from about 1:1 to about 50:1, from about 2:1 to about 45:1, from about 3:1 to about 40:1, from about 5:1 to about 38:1, or from about 10:1 to about 40:1, or from about 15:1 to about 35:1, or from about 20:1 to about 40:1; or from about 25:1 to about 35:1; or from about 27:1 to about 32:1; or from about 28:1 to about 32:1; or from about 29:1 to about 31:1.
- the total lipid:RNA ratio (mass/mass ratio) is from about 25:1 to about 35:1.
- the ratio may be any value or subvalue within the recited ranges, including endpoints.
- the lipid formulations of the present disclosure typically have a mean diameter of from about 30 nm to about 150 nm, from about 40 nm to about 150 nm, from about 50 nm to about 150 nm, from about 60 nm to about 130 nm, from about 70 nm to about 110 nm, from about 70 nm to about 100 nm, from about 80 nm to about 100 nm, from about 90 nm to about 100 nm, from about 70 to about 90 nm, from about 80 nm to about 90 nm, from about 70 nm to about 80 nm, or about 30 nm, about 35 nm, about 40 nm, about 45 nm, about 50 nm, about 55 nm, about 60 nm, about 65 nm, about 70 nm, about 75 nm, about 80 nm, about 85 nm, about 90 nm, about 95 nm, about 100 nm, about 105
- the diameter may be any value or subvalue within the recited ranges, including endpoints.
- nucleic acids when present in the lipid nanoparticles of the present disclosure, are resistant in aqueous solution to degradation with a nuclease.
- the lipid formulations comprise an mRNA, a cationic lipid (e.g., one or more cationic lipids or salts thereof described herein), a phospholipid, and a conjugated lipid that inhibits aggregation of the particles (e.g., one or more PEG-lipid conjugates).
- the lipid formulations can also include cholesterol.
- the mRNA may be fully encapsulated within the lipid portion of the formulation, thereby protecting the nucleic acid from nuclease degradation.
- a lipid formulation comprising an mRNA is fully encapsulated within the lipid portion of the lipid formulation, thereby protecting the nucleic acid from nuclease degradation.
- the mRNA in the lipid formulation is not substantially degraded after exposure of the particle to a nuclease at 37°C for at least 20, 30, 45, or 60 minutes.
- the mRNA in the lipid formulation is not substantially degraded after incubation of the formulation in serum at 37°C for at least 30, 45, or 60 minutes or at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, or 36 hours.
- the mRNA is complexed with the lipid portion of the formulation.
- the nucleic acid-lipid compositions are substantially non-toxic to mammals such as humans.
- the present disclosure provides a nucleic acid-lipid composition comprising a plurality of nucleic acid-liposomes, nucleic acid-cationic liposomes, or nucleic acid-lipid nanoparticles.
- the nucleic acid-lipid composition comprises a plurality of mRNA-liposomes.
- the nucleic acid-lipid composition comprises a plurality of mRNA-cationic liposomes.
- the nucleic acid-lipid composition comprises a plurality of mRNA-lipid nanoparticles.
- the lipid formulations comprise mRNA that is fully encapsulated within the lipid portion of the formulation, such that from about 30% to about 100%, from about 40% to about 100%, from about 50% to about 100%, from about 60% to about 100%, from about 70% to about 100%, from about 80% to about 100%, from about 90% to about 100%, from about 30% to about 95%, from about 40% to about 95%, from about 50% to about 95%, from about 60% to about 95%, from about 70% to about 95%, from about 80% to about 95%, from about 85% to about 95%, from about 90% to about 95%, from about 30% to about 90%, from about 40% to about 90%, from about 50% to about 90%, from about 60% to about 90%, from about 70% to about 90%, from about 80% to about 90%, or at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%
- the proportions of the components can be varied, and the delivery efficiency of a particular formulation can be measured using assays known in the art.
- the expressible polynucleotides and heterologous mRNA constructs described herein are lipid formulated.
- the lipid formulation is preferably selected from, but not limited to, liposomes, cationic liposomes, and lipid nanoparticles.
- a lipid formulation is a cationic liposome or a lipid nanoparticle (LNP) comprising:
- an aggregation reducing agent such as polyethylene glycol (PEG) lipid or
- lipid optionally a non-cationic lipid (such as a neutral lipid), and
- the cationic lipid is an ionizable cationic lipid.
- the lipid nanoparticle formulation consists of (i) at least one cationic lipid; (ii) a helper lipid; (iii) a sterol (e.g. , cholesterol); and (iv) a PEG-lipid, in a molar ratio of about 40- 70% ionizable cationic lipid: about 2-15% helper lipid: about 20-45% sterol; about 0.5-5% PEG- lipid.
- cationic lipids including ionizable cationic lipids), helper lipids (e.g., neutral lipids), sterols, and ligand-containing lipids (e.g., PEG-lipids) are described hereinbelow.
- the lipid formulation preferably includes a cationic lipid suitable for forming a cationic liposome or lipid nanoparticle.
- Cationic lipids are widely studied for nucleic acid delivery because they can bind to negatively charged membranes and induce uptake.
- cationic lipids are amphiphiles containing a positive hydrophilic head group, two (or more) lipophilic tails, or a steroid portion and a connector between these two domains.
- the cationic lipid carries a net positive charge at about physiological pH.
- Cationic liposomes have been traditionally the most commonly used non-viral delivery systems for oligonucleotides, including plasmid DNA, antisense oligos, and siRNA/small hairpin RNA-shRNA).
- Cationic lipids such as DOTAP, (l,2-dioleoyl-3- trimethylammonium-propane) and DOTMA (N-[l-(2,3- dioleoyloxy)propyl]-N,N,N-trimethyl- ammonium methyl sulfate) can form complexes or lipoplexes with negatively charged nucleic acids by electrostatic interaction, providing high in vitro transfection efficiency.
- the cationic lipid may be, for example, N,N-dioleyl-N,N-dimethylammonium chloride (DODAC), N,N-distearyl-N,N- dimethylammonium bromide (DDAB), 1,2-dioleoyltrimethylammoniumpropane chloride (DOTAP) (also known as N-(2,3-dioleoyloxy)propyl)-N,N,N-trimethylammonium chloride and
- DODAC N,N-dioleyl-N,N-dimethylammonium chloride
- DDAB N,N-distearyl-N,N- dimethylammonium bromide
- DOTAP 1,2-dioleoyltrimethylammoniumpropane chloride
- DOTMA N-(l-(2,3-dioleyloxy)propyl)-N,N,N- trimethylammonium chloride
- DODMA N,N-dimethyl-2,3-dioleyloxy)propylamine
- DLinDMA 1.2-DiLinoleyloxy-N,N-dimethylaminopropane
- DLenDMA l,2-Dilinolenyloxy-N,N- dimethylaminopropane
- g- DLenDMA l,2-di-y-linolenyloxy-N,N-dimethylaminopropane
- DLin-C-DAP 1,2- Dilinoleyoxy-3-(dimethylamino)acetoxypropane
- DLin-DAC 1,2- Dilinoleyoxy-3- morpholinopropane
- DLin-MA l,2-Dilinoleoyl-3-dimethylaminopropane
- DLin-S-DMA 1,2- Dilinoleylthio-3-dimethylaminopropane
- cationic lipids include, but are not limited to, N,N-distearyl-N,N-dimethylammonium bromide (DDAB), 3P-(N-(N',N'-dimethylaminoethane)- carbarn oyl)cholesterol (DC-Choi), N-(l-(2,3- dioleyloxy)propyl)-N-2-(sperminecarboxamido)ethyl)-N,N-dimethylammonium trifluoracetate (DOSPA), dioctadecylamidoglycyl carboxyspermine (DOGS), l,2-dileoyl-sn-3- phosphoethanolamine (DOPE), l,2-dioleoyl-3-dimethylammonium propane (DODAP), N-(l,2- dimyristyloxyprop-3-yl)-N,N-dimethyl-N-hydroxyethyl ammonium bromide (DMRIE
- cationic lipids can be used, such as, e.g., LIPOFECTIN (including DOTMA and DOPE, available from GIBCO/BRL), and Lipofectamine (comprising DOSPA and DOPE, available from GIBCO/BRL).
- LIPOFECTIN including DOTMA and DOPE, available from GIBCO/BRL
- Lipofectamine comprising DOSPA and DOPE, available from GIBCO/BRL
- Suitable cationic lipids are disclosed in International Publication Nos. WO 09/086558, WO 09/127060, WO 10/048536, WO 10/054406, WO 10/088537, WO 10/129709, and WO 2011/153493; U.S. Patent Publication Nos. 2011/0256175, 2012/0128760, and 2012/0027803; U.S. Patent Nos. 8,158,601; and Love et al. , PNAS, 107(5), 1864-69, 2010, the contents of which are herein incorporated by reference.
- Suitable cationic lipids include those having alternative fatty acid groups and other dialkylamino groups, including those, in which the alkyl substituents are different (e.g., N-ethyl- N-methylamino-, and N-propyl-N-ethylamino-). These lipids are part of a subcategory of cationic lipids referred to as amino lipids.
- the cationic lipid is an amino lipid.
- amino lipids having less saturated acyl chains are more easily sized, particularly when the complexes must be sized below about 0.3 microns, for purposes of filter sterilization.
- Amino lipids containing unsaturated fatty acids with carbon chain lengths in the range of C 14 to C22 may be used.
- Other scaffolds can also be used to separate the amino group and the fatty acid or fatty alkyl portion of the amino lipid.
- the lipid formulation comprises the cationic lipid with Formula I according to the patent application PCT/EP2017/064066.
- the disclosure of PCT/EP2017/064066 is also incorporated herein by reference.
- amino or cationic lipids of the present disclosure are ionizable and have at least one protonatable or deprotonatable group, such that the lipid is positively charged at a pH at or below physiological pH (e.g., pH 7.4), and neutral at a second pH, preferably at or above physiological pH.
- the addition or removal of protons as a function of pH is an equilibrium process, and that the reference to a charged or a neutral lipid refers to the nature of the predominant species and does not require that all of the lipid be present in the charged or neutral form.
- Lipids that have more than one protonatable or deprotonatable group, or which are zwitterionic, are not excluded from use in the disclosure.
- the protonatable lipids have a pKa of the protonatable group in the range of about 4 to about 11.
- the ionizable cationic lipid has a pKa of about 5 to about 7.
- the pKa of an ionizable cationic lipid is about 6 to about 7.
- the lipid formulation comprises an ionizable cationic lipid of Formula I: or a pharmaceutically acceptable salt or solvate thereof, wherein R 5 and R 6 are each independently selected from the group consisting of a linear or branched C 1 -C 31 alkyl, C 2 -C 31 alkenyl or C 2 -C 31 alkynyl and cholesteryl; L 5 and L 6 are each independently selected from the group consisting of a linear C 1 -C 20 alkyl and C 2 -C 20 alkenyl; X 5 is -C(0)0-, whereby -C(0)0-R 6 is formed or -OC(O)- whereby -OC(0)-R 6 is formed; X 6 is -C(0)0- whereby -C(0)0-R 5 is formed or -OC(O)- whereby -OC(0)-R 5 is formed; X 7 is S or O; L 7 is absent or lower alkyl; R 4 is a linear or branched C1-
- X 7 is S.
- X 5 is -C(0)0-, whereby -C(0)0-R 6 is formed and X 6 is -C(0)0- whereby -C(0)0-R 5 is formed.
- R 7 and R 8 are each independently selected from the group consisting of methyl, ethyl and isopropyl.
- L 5 and L 6 are each independently a Ci-Cio alkyl. In some embodiments, L 5 is C1-C3 alkyl, and L 6 is C1-C5 alkyl. In some embodiments, L 6 is C1-C2 alkyl. In some embodiments, L 5 and L 6 are each a linear C7 alkyl. In some embodiments, L 5 and L 6 are each a linear C9 alkyl.
- R 5 and R 6 are each independently an alkenyl. In some embodiments, R 6 is alkenyl. In some embodiments, R 6 is C 2 -C 9 alkenyl. In some embodiments, the alkenyl comprises a single double bond. In some embodiments, R 5 and R 6 are each alkyl. In some embodiments, R 5 is a branched alkyl. In some embodiments, R 5 and R 6 are each independently selected from the group consisting of a C 9 alkyl, C 9 alkenyl and C 9 alkynyl. In some embodiments, R 5 and R 6 are each independently selected from the group consisting of a C 11 alkyl, Cn alkenyl and Cn alkynyl.
- R 5 and R 6 are each independently selected from the group consisting of a C 7 alkyl, C 7 alkenyl and C 7 alkynyl.
- R 5 is -CH((CH2) P CH3)2 or -CH((CH2) P CH3)((CH2) P-I CH3), wherein p is 4-8.
- p is 5 and L 5 is a C 1 -C 3 alkyl.
- p is 6 and L 5 is a C 3 alkyl.
- p is 7.
- p is 8 and L 5 is a C 1 -C 3 alkyl.
- R 5 consists of
- R 4 is ethylene or propylene. In some embodiments, R 4 is n-propylene or isobutylene.
- L 7 is absent, R 4 is ethylene, X 7 is S and R 7 and R 8 are each methyl. In some embodiments, L 7 is absent, R 4 is n-propylene, X 7 is S and R 7 and R 8 are each methyl. In some embodiments, L 7 is absent, R 4 is ethylene, X 7 is S and R 7 and R 8 are each ethyl.
- X 7 is S
- X 5 is -C(0)0-, whereby -C(0)0-R 6 is formed
- X 6 is -C(0)0- whereby -C(0)0-R 5 is formed
- L 5 and L 6 are each independently a linear C3-C7 alkyl
- L 7 is absent
- R 5 is -CH((CH2) P CH3)2
- R 6 is C7-C12 alkenyl.
- p is 6 and R 6 is C 9 alkenyl.
- the lipid formulation comprises an ionizable cationic lipid selected from the group consisting of
- the lipid formulation can comprise an ionizable cationic lipid selected from the group consisting of LIPID # 1 to LIPID # 8:
- the lipid formulation comprises an ionizable cationic pharmaceutically acceptable salt thereof.
- the lipid formulation comprises an ionizable acceptable salt thereof.
- any one or more lipids recited herein may be expressly excluded.
- the mRNA-lipid formulations of the present disclosure can comprise a helper lipid, which can be referred to as a neutral helper lipid, non-cationic lipid, non-cationic helper lipid, anionic lipid, anionic helper lipid, or a neutral lipid. It has been found that lipid formulations, particularly cationic liposomes and lipid nanoparticles have increased cellular uptake if helper lipids are present in the formulation. (Curr. Drug Metab. 2014; 15(9):882-92).
- lipids such as 1,2- dioleoylsn-glycero-3-phosphatidylcholine (DOPC), Di-Oleoyl-Phosphatidyl-Ethanoalamine (DOPE) and l,2-DiStearoyl-sn-glycero-3-PhosphoCholine (DSPC), being more fusogenic (i.e., facilitating fusion) than cationic lipids, can affect the polymorphic features of lipid-nucleic acid complexes, promoting the transition from a lamellar to a hexagonal phase, and thus inducing fusion and a disruption of the cellular membrane.
- DOPC 1,2- dioleoylsn-glycero-3-phosphatidylcholine
- DOPE Di-Oleoyl-Phosphatidyl-Ethanoalamine
- DSPC l,2-DiStearoyl-sn-glycero-3-PhosphoCholine
- Non-limiting examples of non-cationic lipids suitable for lipid formulations of the present disclosure include phospholipids such as lecithin, phosphatidylethanolamine, lysolecithin, lysophosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, sphingomyelin, egg sphingomyelin (ESM), cephalin, cardiolipin, phosphatidic acid, cerebrosides, dicetylphosphate, distearoylphosphatidylcholine (DSPC), dioleoylphosphatidylcholine (DOPC), dipalmitoylphosphatidylcholine (DPPC), dioleoylphosphatidylglycerol (DOPG), dipalmitoylphosphatidylglycerol (DPPG), dioleoylphosphatidylethanolamine (DOPE), palmitoyloleoyl-phosphatid
- acyl groups in these lipids are preferably acyl groups derived from fatty acids having C10- C24 carbon chains, e.g., lauroyl, myristoyl, palmitoyl, stearoyl, or oleoyl.
- fatty acids having C10- C24 carbon chains e.g., lauroyl, myristoyl, palmitoyl, stearoyl, or oleoyl.
- Additional examples of non-cationic lipids include sterols such as cholesterol and derivatives thereof.
- helper lipid cholesterol increases the spacing of the charges of the lipid layer interfacing with the nucleic acid making the charge distribution match that of the nucleic acid more closely. (J. R. Soc. Interface.
- Non-limiting examples of cholesterol derivatives include polar analogues such as 5a- cholestanol, 5a-coprostanol, cholesteryl-(2'-hydroxy)-ethyl ether, cholesteryl-(4'- hydroxy)-butyl ether, and 6-ketocholestanol; non-polar analogues such as 5a-cholestane, cholestenone, 5a- cholestanone, 5a-cholestanone, and cholesteryl decanoate; and mixtures thereof.
- the cholesterol derivative is a polar analogue such as cholesteryl-(4'-hydroxy)- butyl ether.
- the helper lipid present in the lipid formulation comprises or consists of a mixture of one or more phospholipids and cholesterol or a derivative thereof.
- the neutral lipid present in the lipid formulation comprises or consists of one or more phospholipids, e.g., a cholesterol-free lipid formulation.
- the neutral lipid present in the lipid formulation comprises or consists of cholesterol or a derivative thereof, e.g., a phospholipid-free lipid formulation.
- helper lipids include nonphosphorous containing lipids such as, e.g., stearylamine, dodecylamine, hexadecylamine, acetyl palmitate, glycerol ricinoleate, hexadecyl stearate, isopropyl myristate, amphoteric acrylic polymers, triethanolamine-lauryl sulfate, alkyl-aryl sulfate polyethyloxylated fatty acid amides, dioctadecyldimethyl ammonium bromide, ceramide, and sphingomyelin.
- nonphosphorous containing lipids such as, e.g., stearylamine, dodecylamine, hexadecylamine, acetyl palmitate, glycerol ricinoleate, hexadecyl stearate, isopropyl myristate,
- the helper lipid comprises from about 2 mol% to about 20 mol%, from about 3 mol% to about 18 mol%, from about 4 mol% to about 16 mol%, about 5 mol% to about 14 mol%, from about 6 mol% to about 12 mol%, from about 5 mol% to about 10 mol%, from about 5 mol% to about 9 mol%, or about 2 mol%, about 3 mol%, about 4 mol%, about 5 mol%, about 6 mol%, about 7 mol%, about 8 mol%, about 9 mol%, about 10 mol%, about 11 mol%, or about 12 mol% (or any fraction thereof or the range therein) of the total lipid present in the lipid formulation.
- the cholesterol or cholesterol derivative in the lipid formulation may comprise up to about 40 mol%, about 45 mol%, about 50 mol%, about 55 mol%, or about 60 mol% of the total lipid present in the lipid formulation.
- the cholesterol or cholesterol derivative comprises about 15 mol% to about 45 mol%, about 20 mol% to about 40 mol%, about 25 mol% to about 35 mol%, or about 28 mol% to about 35 mol%; or about 25 mol%, about 26 mol%, about 27 mol%, about 28 mol%, about 29 mol%, about 30 mol%, about 31 mol%, about 32 mol%, about 33 mol%, about 34 mol%, about 35 mol%, about 36 mol%, or about 37 mol% of the total lipid present in the lipid formulation.
- the phospholipid component in the mixture may comprise from about 2 mol% to about 20 mol%, from about 3 mol% to about 18 mol%, from about 4 mol % to about 16 mol %, about 5 mol % to about 14 mol %, from about 6 mol % to about 12 mol%, from about 5 mol% to about 10 mol%, from about 5 mol% to about 9 mol%, or about 2 mol%, about 3 mol%, about 4 mol%, about 5 mol%, about 6 mol%, about 7 mol%, about 8 mol%, about 9 mol%, about 10 mol%, about 11 mol%, or about 12 mol% (or any fraction thereof or the range therein) of the total lipid present in the lipid formulation.
- the percentage of helper lipid present in the lipid formulation is a target amount, and the actual amount of helper lipid present in the formulation may vary, for example, by ⁇ 5 mol%.
- a lipid formulation containing a cationic lipid compound or ionizable cationic lipid compound may be on a molar basis about 30-70% cationic lipid compound, about 25-40 % cholesterol, about 2-15% helper lipid, and about 0.5-5% of a polyethylene glycol (PEG) lipid, wherein the percent is of the total lipid present in the formulation.
- the composition is about 40-65% cationic lipid compound, about 25- 35% cholesterol, about 3-9% helper lipid, and about 0.5-3% of a PEG-lipid, wherein the percent is of the total lipid present in the formulation.
- the formulation may be a lipid particle formulation, for example containing 8- 30% nucleic acid compound, 5-30% helper lipid , and 0-20% cholesterol; 4-25% cationic lipid, 4-25% helper lipid, 2- 25% cholesterol, 10- 35% cholesterol -PEG, and 5% cholesterol-amine; or 2-30% cationic lipid, 2-30% helper lipid, 1- 15% cholesterol, 2- 35% cholesterol -PEG, and 1- 20% cholesterol-amine; or up to 90% cationic lipid and 2-10% helper lipids, or even 100% cationic lipid.
- the lipid formulations described herein may further comprise a lipid conjugate.
- the conjugated lipid is useful in that it prevents the aggregation of particles.
- Suitable conjugated lipids include, but are not limited to, PEG-lipid conjugates, cationic-polymer-lipid conjugates, and mixtures thereof.
- lipid delivery vehicles can be used for specific targeting by attaching ligands (e.g., antibodies, peptides, and carbohydrates) to its surface or to the terminal end of the attached PEG chains (Front Pharmacol. 2015 Dec 1; 6:286).
- the lipid conjugate is a PEG-lipid.
- PEG polyethylene glycol
- PEGylation has been widely used to stabilize lipid formulations and their payloads through physical, chemical, and biological mechanisms.
- Detergent-like PEG lipids e.g., PEG-DSPE
- PEG-DSPE can enter the lipid formulation to form a hydrated layer and steric barrier on the surface.
- the surface layer can be generally divided into two types, brush-like and mushroom like layers.
- PEG-DSPE-stabilized formulations PEG will take on the mushroom conformation at a low degree of PEGylation (usually less than 5 mol%) and will shift to brush conformation as the content of PEG-DSPE is increased past a certain level (Journal of Nanomaterials. 2011;2011 : 12). It has been shown that increased PEGylation leads to a significant increase in the circulation half-life of lipid formulations (Annu. Rev. Biomed. Eng. 2011 Aug 15; 13():507-30; J. Control Release. 2010 Aug 3; 145(3): 178-81).
- PEG-lipids include, but are not limited to, PEG coupled to dialkyloxypropyls (PEG-DAA), PEG coupled to diacylglycerol (PEG-DAG), PEG coupled to phospholipids such as phosphatidylethanolamine (PEG-PE), PEG conjugated to ceramides, PEG conjugated to cholesterol or a derivative thereof, and mixtures thereof.
- PEG-DAA dialkyloxypropyls
- PEG-DAG PEG coupled to diacylglycerol
- PEG coupled to phospholipids such as phosphatidylethanolamine (PEG-PE)
- PEG conjugated to ceramides PEG conjugated to cholesterol or a derivative thereof, and mixtures thereof.
- PEG is a linear, water-soluble polymer of ethylene PEG repeating units with two terminal hydroxyl groups.
- PEGs are classified by their molecular weights and include the following: monomethoxypolyethylene glycol (MePEG-OH), monomethoxypolyethylene glycol- succinate (MePEG-S), monomethoxypolyethylene glycol-succinimidyl succinate (MePEG-S- NHS), monomethoxypolyethylene glycol-amine (MePEG-NFF), monomethoxypolyethylene glycol-tresylate (MePEG-TRES), monomethoxypolyethylene glycol-imidazolyl-carbonyl (MePEG-IM), as well as such compounds containing a terminal hydroxyl group instead of a terminal methoxy group (e.g., HO-PEG-S, HO-PEG-S-NHS, HO-PEG-NH2).
- MePEG-OH monomethoxypolyethylene
- the PEG moiety of the PEG-lipid conjugates described herein may comprise an average molecular weight ranging from about 550 daltons to about 10,000 daltons. In certain instances, the PEG moiety has an average molecular weight of from about 750 daltons to about 5,000 daltons (e.g., from about 1,000 daltons to about 5,000 daltons, from about 1,500 daltons to about 3,000 daltons, from about 750 daltons to about 3,000 daltons, from about 750 daltons to about 2,000 daltons). In preferred embodiments, the PEG moiety has an average molecular weight of about 2,000 daltons or about 750 daltons. The average molecular weight may be any value or subvalue within the recited ranges, including endpoints.
- the PEG can be optionally substituted by an alkyl, alkoxy, acyl, or aryl group.
- the PEG can be conjugated directly to the lipid or may be linked to the lipid via a linker moiety.
- Any linker moiety suitable for coupling the PEG to a lipid can be used including, e.g., non-ester-containing linker moieties and ester-containing linker moieties.
- the linker moiety is a non-ester-containing linker moiety.
- Suitable non- ester-containing linker moieties include, but are not limited to, amido (-C(O)NH-), amino (-NR- ), carbonyl (-C(O)-), carbamate (-NHC(O)O-), urea
- a carbamate linker is used to couple the PEG to the lipid.
- an ester-containing linker moiety is used to couple the PEG to the lipid.
- Suitable ester-containing linker moieties include, e.g., carbonate (-OC(O)O-), succinoyl, phosphate esters (-O-(O)POH-O-), sulfonate esters, and combinations thereof.
- Phosphatidyl ethanolamines having a variety of acyl chain groups of varying chain lengths and degrees of saturation can be conjugated to PEG to form the lipid conjugate.
- Such phosphatidylethanolamines are commercially available or can be isolated or synthesized using conventional techniques known to those of skill in the art.
- Phosphatidylethanolamines containing saturated or unsaturated fatty acids with carbon chain lengths in the range of CIO to C20 are preferred.
- Phosphatidylethanolamines with mono- or di-unsaturated fatty acids and mixtures of saturated and unsaturated fatty acids can also be used.
- Suitable phosphatidylethanolamines include, but are not limited to, dimyristoyl- phosphatidylethanolamine (DMPE), dipalmitoyl-phosphatidylethanolamine (DPPE), dioleoyl- phosphatidylethanolamine (DOPE), and distearoyl-phosphatidylethanolamine (DSPE).
- DMPE dimyristoyl- phosphatidylethanolamine
- DPPE dipalmitoyl-phosphatidylethanolamine
- DOPE dioleoyl- phosphatidylethanolamine
- DSPE distearoyl-phosphatidylethanolamine
- the PEG-DAA conjugate is a PEG-didecyloxypropyl (Cio) conjugate, a PEG-dilauryloxypropyl (C12) conjugate, a PEG-dimyristyloxypropyl (C14) conjugate, a PEG-dipalmityloxypropyl (Ci 6 ) conjugate, or a PEG-distearyloxypropyl (Cix) conjugate.
- the PEG preferably has an average molecular weight of about 750 or about 2,000 daltons.
- the terminal hydroxyl group of the PEG is substituted with a methyl group.
- hydrophilic polymers can be used in place of PEG.
- suitable polymers that can be used in place of PEG include, but are not limited to, polyvinylpyrrolidone, polymethyloxazoline, polyethyloxazoline, polyhydroxypropyl, methacrylamide, polymethacrylamide, and polydimethylacrylamide, polylactic acid, polyglycolic acid, and derivatized celluloses such as hydroxymethylcellulose or hydroxyethylcellulose.
- the lipid conjugate (e.g., PEG-lipid) comprises from about 0.1 mol% to about 2 mol%, from about 0.5 mol% to about 2 mol%, from about 1 mol% to about 2 mol%, from about 0.6 mol% to about 1.9 mol%, from about 0.7 mol% to about 1.8 mol%, from about 0.8 mol% to about 1.7 mol%, from about 0.9 mol% to about 1.6 mol%, from about 0.9 mol% to about 1.8 mol%, from about 1 mol% to about 1.8 mol%, from about 1 mol% to about 1.7 mol%, from about 1.2 mol% to about 1.8 mol%, from about 1.2 mol% to about 1.7 mol%, from about 1.3 mol% to about 1.6 mol%, or from about 1.4 mol% to about 1.6 mol% (or any fraction thereof or range therein) of the total lipid present in the lipid formulation.
- the lipid conjugate (e.g., PEG-lipid) comprises about 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 1.2%, 1.3%, 1.4%, 1.5%, 1.6%, 1.7%, 1.8%, 1.9%, 2.0%, 2.5%, 3.0%, 3.5%, 4.0%, 4.5%, or 5%, (or any fraction thereof or range therein) of the total lipid present in the lipid formulation.
- the amount may be any value or subvalue within the recited ranges, including endpoints.
- the percentage of lipid conjugate (e.g., PEG-lipid) present in the lipid formulations of the disclosure is a target amount, and the actual amount of lipid conjugate present in the formulation may vary, for example, by ⁇ 0.5 mol%.
- concentration of the lipid conjugate can be varied depending on the lipid conjugate employed and the rate at which the lipid formulation is to become fusogenic.
- Lipid formulations for the intracellular delivery of nucleic acids are designed for cellular uptake by penetrating target cells through exploitation of the target cells’ endocytic mechanisms where the contents of the lipid delivery vehicle are delivered to the cytosol of the target cell.
- nucleic Acid Therapeutics 28(3): 146-157, 2018.
- the mRNA-lipid formulation enters hepatocytes in the liver through Apo-E receptor mediated endocytosis.
- lipid delivery vehicle Prior to endocytosis, functionalized ligands such as PEG-lipid at the surface of the lipid delivery vehicle are shed from the surface, which triggers internalization into the target cell.
- functionalized ligands such as PEG-lipid at the surface of the lipid delivery vehicle are shed from the surface, which triggers internalization into the target cell.
- some part of the plasma membrane of the cell surrounds the vector and engulfs it into a vesicle that then pinches off from the cell membrane, enters the cytosol and ultimately undergoes the endolysosomal pathway.
- the increased acidity as the endosome ages results in a vehicle with a strong positive charge on the surface. Interactions between the delivery vehicle and the endosomal membrane then result in a membrane fusion event that leads to cytosolic delivery of the payload.
- the cell For mRNA payloads, the cell’s own internal translation processes will then translate the mRNA into the encoded protein.
- the encoded protein can further undergo postranslation processing, including transportation to a targeted organelle or location within the cell. In the case of an OTC protein, the OTC protein is transported to the mitochondria.
- composition and concentration of the lipid conjugate By controlling the composition and concentration of the lipid conjugate, one can control the rate at which the lipid conjugate exchanges out of the lipid formulation and, in turn, the rate at which the lipid formulation becomes fusogenic.
- other variables including, e.g., pH, temperature, or ionic strength, can be used to vary and/or control the rate at which the lipid formulation becomes fusogenic.
- Other methods which can be used to control the rate at which the lipid formulation becomes fusogenic will become apparent to those of skill in the art upon reading this disclosure.
- composition and concentration of the lipid conjugate one can control the liposomal or lipid particle size.
- MLVs Multilamellar Vesicles
- LUV and SUV Small or Large Unilamellar vesicles
- Lipid formulations can also be prepared through the Double Emulsion technique, which involves lipids dissolution in a water/organic solvent mixture.
- the organic solution, containing water droplets is mixed with an excess of aqueous medium, leading to a water-in-oil-in-water (W/O/W) double emulsion formation. After mechanical vigorous shaking, part of the water droplets collapse, giving Large Unilamellar Vesicles (LUVs).
- Double Emulsion technique involves lipids dissolution in a water/organic solvent mixture.
- the organic solution containing water droplets, is mixed with an excess of aqueous medium, leading to a water-in-oil-in-water (W/O/W) double emulsion formation. After mechanical vigorous shaking, part of the water droplets collapse, giving Large Unilamellar Vesicles (LUVs).
- LUVs Large Unilamellar Vesicles
- the Reverse Phase Evaporation (REV) method also allows one to achieve LUVs loaded with nucleic acid.
- REV Reverse Phase Evaporation
- a two-phase system is formed by phospholipids dissolution in organic solvents and aqueous buffer.
- the resulting suspension is then sonicated briefly until the mixture becomes a clear one-phase dispersion.
- the lipid formulation is achieved after the organic solvent evaporation under reduced pressure. This technique has been used to encapsulate different large and small hydrophilic molecules including nucleic acids.
- the Microfluidic method unlike other bulk techniques, gives the possibility of controlling the lipid hydration process.
- the method can be classified in continuous-flow microfluidic and droplet-based microfluidic, according to the way in which the flow is manipulated.
- MHF microfluidic hydrodynamic focusing
- lipids are dissolved in isopropyl alcohol which is hydrodynamically focused in a microchannel cross junction between two aqueous buffer streams.
- Vesicles size can be controlled by modulating the flow rates, thus controlling the lipids solution/buffer dilution process.
- the method can be used for producing oligonucleotide (ON) lipid formulations by using a microfluidic device consisting of three-inlet and one-outlet ports.
- Dual Asymmetric Centrifugation differs from more common centrifugation as it uses an additional rotation around its own vertical axis.
- An efficient homogenization is achieved due to the two overlaying movements generated: the sample is pushed outwards, as in a normal centrifuge, and then it is pushed towards the center of the vial due to the additional rotation.
- VPC viscous vesicular phospholipid gel
- the lipid formulation size can be regulated by optimizing DAC speed, lipid concentration and homogenization time.
- the Ethanol Injection (El) method can be used for nucleic acid encapsulation. This method provides the rapid injection of an ethanolic solution, in which lipids are dissolved, into an aqueous medium containing nucleic acids to be encapsulated, through the use of a needle. Vesicles are spontaneously formed when the phospholipids are dispersed throughout the medium.
- the Detergent dialysis method can be used to encapsulate nucleic acids. Briefly lipid and plasmid are solubilized in a detergent solution of appropriate ionic strength, after removing the detergent by dialysis, a stabilized lipid formulation is formed. Unencapsulated nucleic acid is then removed by ion-exchange chromatography and empty vesicles by sucrose density gradient centrifugation. The technique is highly sensitive to the cationic lipid content and to the salt concentration of the dialysis buffer, and the method is also difficult to scale.
- Stable lipid formulations can also be produced through the Spontaneous Vesicle Formation by Ethanol Dilution method in which a stepwise or dropwise ethanol dilution provides the instantaneous formation of vesicles loaded with nucleic acid by the controlled addition of lipid dissolved in ethanol to a rapidly mixing aqueous buffer containing the nucleic acid.
- nucleic acids can also be obtained starting with preformed liposomes through two different methods: (1) A simple mixing of cationic liposomes with nucleic acids which gives electrostatic complexes called “lipoplexes”, where they can be successfully used to transfect cell cultures, but are characterized by their low encapsulation efficiency and poor performance in vivo ; and (2) a liposomal destabilization, slowly adding absolute ethanol to a suspension of cationic vesicles up to a concentration of 40% v/v followed by the dropwise addition of nucleic acids achieving loaded vesicles; however, the two main steps characterizing the encapsulation process are too sensitive, and the particles have to be downsized.
- the present disclosure provides for lipid formulations comprising an mRNA encoding an enzyme having ornithine transcarbamylase (OTC) activity (OTC mRNA).
- OTC ornithine transcarbamylase
- mRNA an enzyme having ornithine transcarbamylase activity
- OTC mRNA can be any suitable mRNA for expressing an OTC enzyme in vivo.
- the OTC mRNA encodes a modified OTC enzyme engineered to have increased in vivo stability against cellular degradation and/or increased mitochondrial uptake, including the OTC enzyme of SEQ ID NO: 4.
- an OTC mRNA-lipid formulation comprises a compound of Formula (I) and an mRNA encoding an enzyme having OTC activity.
- the mRNA encodes an OTC enzyme consisting of a sequence having 95% identity to SEQ ID NO: 3.
- the mRNA encodes an OTC enzyme consisting of SEQ ID NO: 3.
- the mRNA encodes an OTC enzyme consisting of a sequence having 95% identity to SEQ ID NO: 4.
- the mRNA encodes an OTC enzyme consisting of SEQ ID NO: 4.
- the compound of Formula I can be selected based on desirable properties including its lipophilicity, potency, selectivity for a specific target cell, in vivo biodegradability, toxicity and immunogenicity profile, and the pKa of the ionizable/protonatable group on the compound of Formula (I).
- X 7 is S.
- X 5 is -C(0)0-, whereby -C(0)0-R 6 is formed and X 6 is -C(0)0- whereby - C(0)0-R 5 is formed.
- R 7 and R 8 are each independently selected from the group consisting of methyl, ethyl and isopropyl.
- L 5 and L 6 are each independently a Ci-Cio alkyl.
- L 5 is C 1 -C 3 alkyl
- L 6 is C 1 -C 5 alkyl.
- L 6 is C 1 -C 2 alkyl.
- L 5 and L 6 are each a linear C7 alkyl. In some embodiments, L 5 and L 6 are each a linear C 9 alkyl. In some embodiments, R 5 and R 6 are each independently an alkenyl. In some embodiments, R 6 is alkenyl. In some embodiments, R 6 is C 2 -C 9 alkenyl. In some embodiments, the alkenyl comprises a single double bond. In some embodiments, R 5 and R 6 are each alkyl. In some embodiments, R 5 is a branched alkane. In some embodiments, R 5 and R 6 are each independently selected from the group consisting of a C 9 alkyl, C 9 alkenyl and C 9 alkynyl.
- R 5 and R 6 are each independently selected from the group consisting of a Cn alkyl, Cn alkenyl and Cn alkynyl. In some embodiments, R 5 and R 6 are each independently selected from the group consisting of a C7 alkyl, C7 alkenyl and Ci alkynyl. In some embodiments, R 5 is -CH((CH2) P CH3)2 or -CH((CH2) p CH3)((CH2)p-iCH3), wherein p is 4-8. In some embodiments, p is 5 and L 5 is a C 1 -C 3 alkyl. In some embodiments, p is 6 and L 5 is a C 3 alkyl. In some embodiments, p is 7.
- R 5 is a Ci- C3 alkyl.
- R 5 consists of — C H((C Fb ) P C Fl ⁇ , )((C Fb ) p - 1 C Fl ⁇ , ), wherein p is 7 or 8.
- R 4 is ethylene or propylene.
- R 4 is n-propylene or isobutylene.
- L 7 is absent, R 4 is ethylene, X 7 is S and R 7 and R 8 are each methyl.
- L 7 is absent, R 4 is n-propylene, X 7 is S and R 7 and R 8 are each methyl.
- L 7 is absent, R 4 is ethylene, X 7 is S and R 7 and R 8 are each methyl.
- L 7 is absent, R 4 is ethylene, X 7 is S and R 7 and R 8 are each ethyl.
- X 7 is S
- X 5 is -C(0)0-
- X 6 is -C(0)0-
- L 5 and L 6 are each independently a linear C3-C7 alkyl L 7 is absent
- R 5 is -CH((CH2) P CH3)2
- R 6 is C7-C12 alkenyl.
- p is 6 and R 6 is C9 alkenyl.
- any mRNA encoding an enzyme having OTC activity is suitable for inclusion in the first OTC mRNA-lipid formulation of the present disclosure.
- a suitable mRNA is a wild-type human OTC mRNA of sequence SEQ ID NO: 3.
- the OTC mRNA has low immunogenicity, high in vivo stability, and high translation efficiency.
- the OTC mRNA is expressible in human hepatocytes.
- the OTC mRNA has a coding region that is codon-optimized.
- the OTC mRNA comprises modified uridine nucleotides.
- the modified uridine nucleotides are N 1 -methyl pseudouridine or 5-methoxyuridine. In some embodiments, the modified uridine nucleotides are 5-methoxyuridine. In some embodiments, the OTC mRNA can be any of the OTC mRNA constructs described herein.
- the mRNA comprises an open reading frame (ORF or coding region) selected from SEQ ID NOs: 254-258.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 254.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 255.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 256.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 257.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 258.
- the mRNA comprises a sequence having about 85% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 90% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 95% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 96% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253.
- the mRNA comprises a sequence having about 97% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 98% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 99% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 99.5% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253.
- the mRNA comprises a sequence selected from SEQ ID NOS: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence selected from SEQ ID NO: 1. [00256] In any of the embodiments of the first OTC mRNA-lipid formulation, the OTC mRNA-lipid formulation comprises lipid nanoparticles. In some embodiments, the lipid nanoparticles completely encapsulate the OTC mRNA.
- the lipid nanoparticles have an average particle size of less than about 100 nm. In some embodiments, the lipid nanoparticles have an average particles size of about 55 to about 85 nm. In some embodiments, the lipid nanoparticles encapsulate at least about 50% of the mRNA. In some embodiments, the lipid nanoparticles encapsulate at least about 85% of the mRNA. In some embodiments, the lipid nanoparticles have greater than about 90% encapsulation efficiency. In some embodiments, the lipid nanoparticles have greater than about 95% encapsulation efficiency.
- an OTC mRNA-lipid formulation pharmaceutically acceptable salt thereof and an mRNA encoding an enzyme having OTC activity.
- any mRNA encoding an enzyme having OTC activity is suitable for inclusion in the second OTC mRNA-lipid formulation of the present disclosure.
- a suitable mRNA is a wild-type human OTC mRNA of SEQ ID NO: 3.
- the mRNA encodes an OTC enzyme consisting of a sequence having 95% identity to SEQ ID NO: 3.
- the mRNA encodes an OTC enzyme consisting of SEQ ID NO: 3.
- the mRNA encodes an OTC enzyme consisting of a sequence having 95% identity to SEQ ID NO: 4.
- the mRNA encodes an OTC enzyme consisting of SEQ ID NO: 4.
- the OTC mRNA has low immunogenicity, high in vivo stability, and high translation efficiency.
- the OTC mRNA is expressible in human hepatocytes.
- the OTC mRNA has a coding region that is codon- optimized.
- the OTC mRNA comprises modified uridine nucleotides.
- the modified uridine nucleotides are N 1 -methyl pseudouridine or 5- methoxyuridine.
- the modified uridine nucleotides are 5-methoxyuridine.
- the OTC mRNA can be any of the OTC mRNA constructs described herein.
- the mRNA comprises an open reading frame (ORF or coding region) selected from SEQ ID Nos: 254-258.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 254.
- the mRNA comprises an ORF having a sequence of SEQ ID
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 255.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 255.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 256.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 256.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 257.
- the mRNA comprises an ORF having a sequence of SEQ ID NO: 257.
- the mRNA comprises a sequence having about 85% identity to a sequence selected from SEQ ID NOS: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 90% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 95% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 96% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253.
- the mRNA comprises a sequence having about 97% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 98% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 99% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence having about 99.5% identity to a sequence selected from SEQ ID NOs: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence selected from SEQ ID NOS: 73, 119, and 251-253. In some embodiments, the mRNA comprises a sequence selected from SEQ ID NO: 1.
- the OTC mRNA-lipid formulation comprises lipid nanoparticles.
- the lipid nanoparticles completely encapsulate the OTC mRNA.
- the lipid nanoparticles have an average particle size of less than about 100 nm. In some embodiments, the lipid nanoparticles have an average particles size of about 55 nm to about 85 nm. In some embodiments, the lipid nanoparticles encapsulate at least about 50% of the mRNA. In some embodiments, the lipid nanoparticles encapsulate at least about 85% of the mRNA. In some embodiments, the lipid nanoparticles have greater than about 90% encapsulation efficiency.
- either the first or second OTC mRNA-lipid formulation further comprises a helper lipid.
- the helper lipid is selected from the group consisting of neutral and anionic lipids.
- the helper lipid is selected from the group consisting of dipalmitoyl phosphatidylcholine (DPPC), phosphatidylcholine (PC), dioleoylphosphatidyl ethanolamine (DOPE), dimyristoylphosphatidyl choline (DMPC), distearoylphosphatidyl choline, and dimyristoylphosphatidyl glycerol (DMPG).
- the noncationic lipid is distearoylphosphatidylcholine (DSPC).
- either the first or second OTC mRNA-lipid formulation further comprises cholesterol.
- either the first or second OTC mRNA-lipid formulation further comprises a polyethylene glycol (PEG)-lipid conjugate.
- PEG polyethylene glycol
- the PEG- lipid conjugate is PEG-DMG.
- the PEG-DMG is PEG2000-DMG.
- the lipid portion (meaning the total amount of lipids in the formulation) of either the first or second OTC mRNA-lipid formulation comprises about 48 mol% to about 66 mol% of the cationic lipid, about 2 mol% to about 12 mol% DSPC, about 25 to about 42 mol% cholesterol, and about 0.5 mol% to about 3 mol% PEG2000-DMG.
- the lipid portion of either the first or second OTC mRNA-lipid formulation comprises about 55 mol% to about 61 mol% of the cationic lipid, about 5 mol% to about 9 mol% DSPC, about 29 mol% to about 38 mol% cholesterol, and about 1 mol% to about 2 mol% PEG2000-DMG.
- the lipid portion of either the first or second OTC mRNA-lipid formulation comprises about 56 mol% to about 60 mol% of the cationic lipid, about 6 mol% to about 8 mol% DSPC, about 31 mol% to about 34 mol% cholesterol, and about 1.25 mol% to about 1.75 mol% PEG2000-DMG.
- either the first or second OTC mRNA-lipid formulation has a total lipid:mRNA weight ratio of about 50:1 to about 10:1. In some embodiments, either the first or second OTC mRNA-lipid formulation has a total lipid:mRNA weight ratio of about 40:1 to about 20:1. In some embodiments, either the first or second OTC mRNA-lipid formulation has a total lipid:mRNA weight ratio of about 35:1 to about 25:1. In some embodiments, either the first or second OTC mRNA-lipid formulation has a total lipid:mRNA weight ratio of about 28:1 to about 32:1. In some embodiments, either the first or second OTC mRNA-lipid formulation has a total lipid:mRNA weight ratio of about 29: 1 to about 31:1.
- nucleic acid lipid formulation delivery vehicles described herein can be combined with one or more additional nucleic acids, carriers, targeting ligands or stabilizing reagents, or in pharmacological compositions where it is mixed with suitable excipients.
- suitable excipients include “Remington's Pharmaceutical Sciences,” Mack Publishing Co., Easton, Pa., latest edition.
- the nucleic acid lipid formulation is an OTC mRNA lipid nanoparticle formulation as described herein.
- the pharmaceutical composition further comprises pharmaceutically acceptable excipients.
- Pharmaceutical compositions disclosed herein preferably facilitate expression of OTC mRNA in vivo.
- the lipid formulations and pharmaceutical compositions of the present disclosure may be administered and dosed in accordance with current medical practice, taking into account the clinical condition of the subject, the site and method of administration, the scheduling of administration, the subject's age, sex, body weight and other factors relevant to clinicians of ordinary skill in the art.
- the “effective amount” for the purposes herein may be determined by such relevant considerations as are known to those of ordinary skill in experimental clinical research, pharmacological, clinical and medical arts.
- the amount administered is effective to achieve at least some stabilization, improvement or elimination of symptoms and other indicators as are selected as appropriate measures of disease progress, regression or improvement by those of skill in the art.
- a suitable amount and dosing regimen is one that causes at least transient protein (e.g., enzyme) production.
- the pharmaceutical compositions described are administered systemically.
- Suitable routes of administration include, for example, oral, rectal, vaginal, transmucosal, pulmonary including intratracheal or inhaled, or intestinal administration; parenteral delivery, including intradermal, transdermal (topical), intramuscular, subcutaneous, intramedullary injections, as well as intrathecal, direct intraventricular, intravenous, intraperitoneal, or intranasal.
- the intramuscular administration is to a muscle selected from the group consisting of skeletal muscle, smooth muscle and cardiac muscle.
- the pharmaceutical composition is administered intravenously.
- the administration results in delivery of the mRNAto a hepatocyte (i.e., liver cell).
- the administration shows a selectivity towards hepatocytes over other types of liver cells (e.g., stellate cells, etc.).
- compositions may be administered to any desired tissue.
- the OTC mRNA delivered is expressed in a tissue different from the tissue in which the lipid formulation or pharmaceutical composition was administered.
- OTC mRNA is delivered and expressed in the liver.
- compositions disclosed herein can be formulated using one or more excipients to: (1) increase stability; (2) increase cell transfection; (3) permit a sustained or delayed release (e.g., from a depot formulation of the polynucleotide, primary construct, or mRNA); (4) alter the biodistribution (e.g., target the polynucleotide, primary construct, or mRNA to specific tissues or cell types); (5) increase the translation of encoded protein in vivo ; and/or (6) alter the release profile of encoded protein in vivo.
- compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology.
- preparatory methods include the step of associating the active ingredient (i.e., nucleic acid) with an excipient and/or one or more other accessory ingredients.
- a pharmaceutical composition in accordance with the present disclosure may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
- compositions may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, includes, but is not limited to, any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, and the like, as suited to the particular dosage form desired.
- a pharmaceutically acceptable excipient includes, but is not limited to, any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, and the like, as suited to the particular dosage form desired.
- excipients of the present disclosure can include, without limitation, liposomes, lipid nanoparticles, polymers, lipoplexes, core-shell nanoparticles, peptides, proteins, cells transfected with primary DNA construct, or mRNA (e.g., for transplantation into a subject), hyaluronidase, nanoparticle mimics and combinations thereof.
- the pharmaceutical compositions described herein can include one or more excipients, each in an amount that together increases the stability of the nucleic acid in the lipid formulation, increases cell transfection by the nucleic acid, increases the expression of the encoded protein, and/or alters the release profile of encoded proteins.
- the mRNA of the present disclosure may be formulated using self-assembled nucleic acid nanoparticles.
- a dosage form of the composition of this disclosure can be solid, which can be reconstituted in a liquid prior to administration.
- the solid can be administered as a powder.
- the solid can be in the form of a capsule, tablet, or gel.
- the pharmaceutical composition comprises a nucleic acid lipid formulation that has been lyophilized.
- the dosage form of the pharmaceutical compositions described herein can be a liquid suspension of OTC mRNA lipid nanoparticles described herein.
- the liquid suspension is in a buffered solution.
- the buffered solution comprises a buffer selected from the group consisting of HEPES, MOPS, TES, and TRIS.
- the buffer has a pH of about 7.4.
- the buffer is HEPES.
- the buffered solution further comprises a cryoprotectant.
- the cryoprotectant is selected from a sugar and glycerol or a combination of a sugar and glycerol.
- the sugar is a dimeric sugar.
- the sugar is sucrose.
- the buffer comprises HEPES, sucrose, and glycerol at a pH of 7.4.
- the suspension is frozen during storage and thawed prior to administration. In some embodiments, the suspension is frozen at a temperature below about 70 °C.
- the suspension is diluted with sterile water during intravenous administration. In some embodiments, intravenous administration comprises diluting the suspension with about 2 volumes to about 6 volumes of sterile water.
- the suspension comprises about 0.1 mg to about 3.0 mg OTC mRNA/mL, about 15 mg/mL to about 25 mg/mL of an ionizable cationic lipid, about 0.5 mg/mL to about 2.5 mg/mL of a PEG-lipid, about 1.8 mg/mL to about 3.5 mg/mL of a helper lipid, about 4.5 mg/mL to about 7.5 mg/mL of a cholesterol, about 7 mg/mL to about 15 mg/mL of a buffer, about 2.0 mg/mL to about 4.0 mg/mL of NaCl, about 70 mg/mL to about 110 mg/mL of sucrose, and about 50 mg/mL to about 70 mg/mL of glycerol.
- a lyophilized OTC-mRNA lipid nanoparticle formulation can be resuspended in a buffer as described herein.
- compositions of this disclosure may further contain as pharmaceutically acceptable carriers substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, and wetting agents, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, and mixtures thereof.
- pharmaceutically acceptable carriers include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like.
- the mRNA-lipid formulation may be administered in a time release formulation, for example in a composition which includes a slow release polymer.
- the active agent can be prepared with carriers that will protect against rapid release, for example a controlled release vehicle such as a polymer, microencapsulated delivery system, or a bioadhesive gel.
- Prolonged delivery of the mRNA, in various compositions of the disclosure can be brought about by including in the composition agents that delay absorption, for example, aluminum monostearate hydrogels and gelatin.
- the protein product encoded by the mRNA (e.g., a functional OTC protein or enzyme) is detectable in the target tissues for at least about one to seven days or longer.
- the amount of protein product necessary to achieve a therapeutic effect will vary depending on the severity of ornithine transcarbamylase deficiency or other disorder being treated and the condition of the patient.
- the protein product may be detectable in the target tissues at a concentration (e.g., a therapeutic concentration) of at least about 0.025-1.5 pg/ml (e.g., at least about 0.050 pg/ml, at least about 0.075 pg/ml, at least about 0.1 pg/ml, at least about 0.2 pg/ml, at least about 0.3 pg/ml, at least about 0.4 pg/ml, at least about 0.5 pg/ml, at least about 0.6 pg/ml, at least about 0.7 pg/ml, at least about 0.8 pg/ml, at least about 0.9 pg/ml, at least about 1.0 pg/ml, at least about 1.1 pg/ml, at least about 1.2 pg/ml, at least about 1.3 pg/ml, at least about 1.4 pg/ml, or at least about 1.5 pg/ml (e
- compositions of the disclosure are administered to a subject such that a OTC mRNA concentration of at least about 0.05 mg/kg, at least about 0.1 mg/kg, at least about 0.5 mg/kg, at least about 1.0 mg/kg, at least about 2.0 mg/kg, at least about 3.0 mg/kg, at least about 4.0 mg/kg, at least about 5.0 mg/kg of body weight is administered in a single dose or as part of single treatment cycle.
- compositions of the disclosure are administered to a subject such that a total amount of at least about 0.1 mg, at least about 0.5 mg, at least about 1.0 mg, at least about 2.0 mg, at least about 3.0 mg, at least about 4.0 mg, at least about 5.0 mg, at least about 6.0 mg, at least about 7.0 mg, at least about 8.0 mg, at least about 9.0 mg, at least about 10 mg, at least about 15 mg, at least about 20 mg, at least about 25 mg, at least about 30 mg, at least about 35 mg, at least about 40 mg, at least about 45 mg, at least about 50 mg, at least about 55 mg, at least about 60 mg, at least about 65 mg, at least about 70 mg, at least about 75 mg, at least about 80 mg, at least about 85 mg, at least about 90 mg, at least about 95 mg, at least about 100 mg, at least about 105 mg, at least about 110 mg, at least about 115 mg, at least about 120 mg, or at least about 125 mg OTC mRNA is administered in
- compositions and polynucleotides of the present disclosure may be used to treat a subject who is suffering from or susceptible to ornithine transcarbamylase (OTC) deficiency.
- OTC is a homotrimeric mitochondrial enzyme which is expressed almost exclusively in the liver and which encodes a precursor OTC protein that is cleaved in two steps upon incorporation into the mitochondrial matrix. (Horwich A L., et al. Cell 1986; 44: 451 - 459).
- OTC deficiency is a genetic disorder which results in a mutated and biologically inactive form of the enzyme ornithine transcarbamylase. OTC deficiency often becomes evident in the first few days of life, typically after protein ingestion.
- OTC deficiency In the classic severe form of OTC deficiency, within the first days of life patients present with lethargy, convulsions, coma and severe hyperammonemia, which quickly leads to a deteriorating and fatal outcome absent appropriate medical intervention. (Morrish S., et al., Genetics for Pediatricians; Remedica, Cold Spring Harbor Laboratory (2005)). If improperly treated or if left untreated, complications from OTC deficiency may include developmental delay and mental retardation. OTC deficient subjects may also present with progressive liver damage, skin lesions, and brittle hair. In some affected individuals, signs and symptoms of OTC deficiency may be less severe, and may not appear until later in life.
- the OTC gene which is located on the short arm of the X chromosome within band Xp21.1, spans more than 85 kb and is comprised of 10 exons encoding a protein of 1062 amino acids.
- OTC enzyme catalyzes the conversion or ornithine and carbamoyl phosphate to citrulline. Since OTC is on the X chromosome, females are primarily carriers while males with nonconservative mutations rarely survive past 72 hours of birth.
- a pharmaceutical composition of the present disclosure is administered to a subject once per month. In some embodiments, a pharmaceutical composition of the present disclosure is administered to a subject twice per month. In some embodiments, a pharmaceutical composition of the present disclosure is administered to a subject three times per month. In some embodiments, a pharmaceutical composition of the present disclosure is administered to a subject four times per month.
- OTC deficiency In healthy subjects, OTC is expressed almost exclusively in hepatocellular mitochondria. Although not expressed in the brain of healthy subjects, OTC deficiency can lead to neurological disorders. For example, one of the usual symptoms of OTC deficiency, which is heterogeneous in its presentation, is hyperammonaemic coma (Gordon, N., Eur J Paediatr Neural 2003; 7: 115-121.).
- OTC deficiency is heterogeneous, with over 200 unique mutations reported and large deletions that account for approximately 10-15% of all mutations, while the remainder generally comprises missense point mutations with smaller numbers of nonsense, splice-site and small deletion mutations.
- the phenotypic manifestations of OTC deficiency is also highly heterogeneous, which can range from acute neonatal hyperammonemic coma to asymptomatic hemizygous adults. (Gordon N. Eur J. Paediatr. Neurol. 2003; 7: 115-121).
- compositions of the present disclosure may be administered in a local rather than systemic manner, for example, via injection of the pharmaceutical composition directly into a targeted tissue, preferably in a depot or sustained release formulation.
- Local delivery can be affected in various ways, depending on the tissue to be targeted.
- compositions of the present disclosure can be inhaled (for nasal, tracheal, or bronchial delivery); compositions of the present disclosure can be injected into the site of injury, disease manifestation, or pain, for example; compositions can be provided in lozenges for oral, tracheal, or esophageal application; can be supplied in liquid, tablet or capsule form for administration to the stomach or intestines, can be supplied in suppository form for rectal or vaginal application; or can even be delivered to the eye by use of creams, drops, or even injection.
- Formulations containing compositions of the present disclosure complexed with therapeutic molecules or ligands can even be surgically administered, for example in association with a polymer or other structure or substance that can allow the compositions to diffuse from the site of implantation to surrounding cells. Alternatively, they can be applied surgically without the use of polymers or supports.
- a therapeutically effective dose of the provided composition when administered regularly, results in an increased OTC protein expression or activity level in a subject as compared to a baseline OTC protein expression or activity level before treatment.
- the OTC protein expression or activity level is measured in a biological sample obtained from the subject such as blood, plasma or serum, urine, or solid tissue extracts.
- the baseline level can be measured immediately before treatment.
- administering a pharmaceutical composition described herein results in an increased OTC protein expression or activity level in a biological sample (e.g., plasma/serum or urine) by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% as compared to a baseline level before treatment.
- administering the provided composition results in an increased OTC protein expression or activity level in a biological sample (e.g., plasma/serum or urine) by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% as compared to a baseline level before treatment for at least about 24 hours, at least about 48 hours, at least about 72 hours, at least about 3 days, at least about 4 days, at least about 5 days, at least about 6 days, at least about 7 days, at least about 8 days, at least about 9 days, at least about 10 days, at least about 11 days, at least about 12 days, at least about 13 days, at least about 14 days, or at least about 15 days.
- a biological sample e.g., plasma/serum or urine
- administering the provided composition results in an increased OTC protein expression or activity level in a biological sample (e.g., plasma/serum or urine) by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% as compared
- a therapeutically effective dose of the provided composition when administered regularly, results in an increased citrulline production in a subject as compared to a baseline citrulline production before treatment.
- the citrulline level before or after the treatment may be measured in a biological sample obtained from the subject such as, blood, plasma or serum, urine, or solid tissue extracts.
- treatment according to the present disclosure results in an increase of the citrulline level in a biological sample (e.g., plasma, serum, or urine) by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 1-fold, 1.5-fold, 2-fold, 2.5-fold, or 3-fold as compared to the baseline citrulline level, respectively.
- a therapeutically effective dose of the provided composition when administered regularly, results in reduction of at least one symptom or feature of the OTC deficiency, including in intensity, severity, or frequency or the symptom has delayed onset.
- a therapeutically effective dose of the provided composition when administered regularly, results in a reduced orotic acid level in a subject as compared to a baseline orotic acid level before treatment.
- a therapeutically effective dose of the provided composition when administered regularly, results in a reduced ammonia level in a subject as compared to a baseline ammonia level before treatment.
- a therapeutically effective dose of the provided composition when administered regularly, results in a reduced glutamine level in a subject as compared to a baseline glutamine level before treatment.
- the orotic acid, ammonia or glutamine level before or after the treatment may be measured in a biological sample obtained from the subject such as, blood, plasma, serum, urine, or solid tissue extracts.
- the baseline orotic acid, ammonia or glutamine level can be measured immediately before treatment.
- treatment according to the present disclosure results in a reduction of the orotic acid, ammonia, or glutamine level in a biological sample (e.g., blood, serum, or urine) obtained from the subject by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% as compared to the baseline orotic acid, ammonia, or glutamine level, respectively.
- a therapeutically effective dose of the provided composition when administered regularly, results in a reduced plasma ammonia level to less than about 500 pmol/L, 400 pmol/L, 300 pmol/L, 200 pmol/L, 150 pmol/L, or 100 pmol/L. In some embodiments, a therapeutically effective dose of the provided composition, when administered regularly, results in a reduced plasma glutamine level to less than about 800 pmol/L, 700 pmol/L, or 600 pmol/L.
- a therapeutically effective dose of the provided composition when administered regularly, results in a reduced urinary orotic acid level to less than about 20 pmol/mmol creatinine, 15 pmol/mmol creatinine, or 10 pmol/mmol creatinine.
- administering the provided composition results in an increased OTC protein level in the liver of a subject as compared to a baseline level before treatment. Typically, the baseline level is measured immediately before treatment. In some embodiments, administering the provided composition results in an increased OTC protein level in the liver by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% as compared to a baseline level before treatment. In some embodiments, administering the provided composition results in an increased OTC protein level in the liver as compared to a OTC protein level in the liver of subjects who are not treated.
- administering the provided composition results in an increased level of OTC protein in a liver cell (e.g., a hepatocyte) of a subject as compared to a baseline level before treatment. Typically, the baseline level is measured immediately before treatment.
- administering the provided composition results in an increased OTC protein level in the liver cell by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% as compared to a baseline level before treatment.
- administering the provided composition results in an increased OTC protein level in a liver cell as compared to the OTC protein level a liver cell of subjects who are not treated.
- administering the provided composition results in an increased OTC protein level in plasma or serum of a subject as compared to a baseline level before treatment. Typically, the baseline level is measured immediately before treatment. In some embodiments, administering the provided composition results in an increased OTC protein level in plasma or serum by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% as compared to a baseline level before treatment. In some embodiments, administering the provided composition results in an increased OTC protein level in plasma or serum as compared to an OTC protein level in plasma or serum of subjects who are not treated.
- administering the provided composition results in increased OTC enzyme activity in a biological sample from a subject as compared to the baseline level before treatment.
- the baseline level is measured immediately before treatment.
- Biological samples include, for example, whole blood, serum, plasma, urine and tissue samples (e.g., liver).
- administering the provided composition results in an increased OTC enzyme activity by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% as compared to a baseline level immediately before treatment
- administering the provided composition results in an increased OTC enzyme activity as compared to OTC enzyme activity in subjects who are not treated.
- kits for administering a therapeutic intervention to a subject suspected of having an ornithine transcarbamylase (OTC) enzyme deficiency including measuring in the subject a level of OTC enzyme activity indicator and administering to the subject a therapeutic intervention when an OTC enzyme indicator signals deficient OTC enzyme activity.
- OTC ornithine transcarbamylase
- the subject is a human.
- the subject is an adult.
- the subject is a human neonate.
- the therapeutic intervention includes administering a composition according to any of the various embodiments described herein.
- measuring a level of an OTC enzyme activity indicator is selected from measuring OTC enzyme levels in a liver biopsy, measuring nitrogen levels in a blood sample from the subject, measuring citrulline levels in a liver biopsy, and measuring orotic acid in a urinary sample from the subject.
- measuring a level of an OTC enzyme activity indicator includes measuring OTC enzyme levels in a liver biopsy.
- measuring a level of an OTC enzyme activity indicator includes measuring nitrogen levels in a blood sample from the subject, measuring citrulline levels in a liver biopsy.
- measuring a level of an OTC enzyme activity indicator includes measuring orotic acid in a urinary sample from the subject.
- kits for treating OTC deficiency in a subject identified as suffering from OTC deficiency include administering to the subject any composition provided herein.
- an OTC enzyme including a sequence of SEQ ID NO:3 is expressed in the subject.
- an OTC enzyme including a sequence of SEQ ID NO:4 is expressed in the subject.
- OTC mRNA, formulations thereof, or encoded OTC proteins described herein may be used in combination with one or more other therapeutic, prophylactic, diagnostic, or imaging agents.
- combination with it is not intended to imply that the agents must be administered at the same time and/or formulated for delivery together, although these methods of delivery are within the scope of the present disclosure.
- Compositions can be administered concurrently with, prior to, or subsequent to, one or more other desired therapeutics or medical procedures. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent.
- the methods of treatment of the present disclosure encompass the delivery of pharmaceutical, prophylactic, diagnostic, or imaging compositions in combination with agents that may improve their bioavailability, reduce and/or modify their metabolism, inhibit their excretion, and/or modify their distribution within the body.
- agents that may improve their bioavailability, reduce and/or modify their metabolism, inhibit their excretion, and/or modify their distribution within the body.
- mRNA disclosed herein and preferably an mRNA sequence comprising SEQ ID NO: 251 encoding a modified OTC protein of SEQ ID NO: 4 may be used in combination with a pharmaceutical agent for the treatment of OTC deficiency.
- the pharmaceutical agent includes, but is not limited to one or more of: sodium phenylbutyrate, glycerol phenylbutyrate (marketed e.g., as Ravicti ® ), sodium phenyl acetate, sodium benzoate, arginine, citrulline, Multiple vitamins, calcium supplements or combined with a low protein/high caloric diet regimen.
- agents utilized in combination with the presently disclosed OTC mRNA and formulations thereof be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
- the combinations, each or together may be administered according to the split dosing regimens as are known in the art.
- substituents of compounds of the present disclosure are disclosed in groups or in ranges. It is specifically intended that the present disclosure include each and every individual subcombination of the members of such groups and ranges.
- the term “Ci- 6 alkyl” is specifically intended to individually disclose methyl, ethyl, C3 alkyl, C4 alkyl, C5 alkyl, and C 6 alkyl.
- administered in combination means that two or more agents are administered to a subject at the same time or within an interval such that there may be an overlap of an effect of each agent on the patient. In some embodiments, they are administered within about 60, 30, 15, 10, 5, or 1 minute of one another. In some embodiments, the administrations of the agents are spaced sufficiently closely together such that a combinatorial (e.g., a synergistic) effect is achieved.
- the term “animal” refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans at any stage of development. In some embodiments, “animal” refers to non-human animals at any stage of development. In certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, and worms. In some embodiments, the animal is a transgenic animal, genetically engineered animal, or a clone.
- association means that the moieties are physically associated or connected with one another, either directly or via one or more additional moieties that serves as a linking agent, to form a structure that is sufficiently stable so that the moieties remain physically associated under the conditions in which the structure is used, e.g., physiological conditions.
- An “association” need not be strictly through direct covalent chemical bonding. It may also suggest ionic or hydrogen bonding or a hybridization-based connectivity sufficiently stable such that the “associated” entities remain physically associated.
- articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context.
- the disclosure includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process.
- the disclosure includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
- acyl represents a hydrogen or an alkyl group (e.g., a haloalkyl group), as defined herein, that is attached to the parent molecular group through a carbonyl group, as defined herein, and is exemplified by formyl (i.e., a carboxy aldehyde group), acetyl, trifluoroacetyl, propionyl, butanoyl and the like.
- exemplary unsubstituted acyl groups include from 1 to 7, from 1 to 11, or from 1 to 21 carbons.
- the alkyl group is further substituted with 1, 2, 3, or 4 substituents as described herein.
- alkenyl represents monovalent straight or branched chain groups of, unless otherwise specified, from 2 to 20 carbons (e.g., from 2 to 6 or from 2 to 10 carbons) containing one or more carbon-carbon double bonds and is exemplified by ethenyl, 1-propenyl, 2-propenyl, 2 -methyl- 1-propenyl, 1-butenyl, 2-butenyl, and the like. Alkenyls include both cis and trans isomers.
- Alkenyl groups may be optionally substituted with 1, 2, 3, or 4 substituent groups that are selected, independently, from amino, aryl, cycloalkyl, or heterocyclyl (e.g., heteroaryl), as defined herein, or any of the exemplary alkyl substituent groups described herein.
- alkoxy represents a chemical substituent of formula — OR, where R is a Ci -2o alkyl group (e.g., Ci- 6 or Ci-io alkyl), unless otherwise specified.
- exemplary alkoxy groups include methoxy, ethoxy, propoxy (e.g., n-propoxy and isopropoxy), t-butoxy, and the like.
- the alkyl group can be further substituted with 1, 2, 3, or 4 substituent groups as defined herein (e.g., hydroxy or alkoxy).
- alkoxyalkyl represents an alkyl group that is substituted with an alkoxy group.
- Exemplary unsubstituted alkoxyalkyl groups include between 2 to 40 carbons (e.g., from 2 to 12 or from 2 to 20 carbons, such as Ci- 6 alkoxy-Ci- 6 alkyl, Ci-io alkoxy-Ci-io alkyl, or Ci-20 alkoxy-Ci.20 alkyl).
- the alkyl and the alkoxy each can be further substituted with 1, 2, 3, or 4 substituent groups as defined herein for the respective group.
- alkoxycarbonyl represents an alkoxy, as defined herein, attached to the parent molecular group through a carbonyl atom (e.g., — C(O) — OR, where R is H or an optionally substituted Ci- 6 , Ci-10, or Ci-20 alkyl group).
- exemplary unsubstituted alkoxycarbonyl include from 1 to 21 carbons (e.g., from 1 to 11 or from 1 to 7 carbons).
- the alkoxy group is further substituted with 1, 2, 3, or 4 substituents as described herein.
- alkoxycarbonylalkyl represents an alkyl group, as defined herein, that is substituted with an alkoxycarbonyl group, as defined herein (e.g., -alkyl- C(O) — OR, where R is an optionally substituted Ci-20, Ci-10, or Ci- 6 alkyl group).
- Exemplary unsubstituted alkoxycarbonylalkyl include from 3 to 41 carbons (e.g., from 3 to 10, from 3 to 13, from 3 to 17, from 3 to 21, or from 3 to 31 carbons, such as Ci- 6 alkoxycarbonyl -Ci- 6 alkyl, Ci-10 alkoxycarbonyl -Ci-10 alkyl, or Ci-20 alkoxycarbonyl-Ci-20 alkyl).
- each alkyl and alkoxy group is further independently substituted with 1, 2, 3, or 4 substituents as described herein (e.g., a hydroxy group).
- alkoxycarbonylalkenyl represents an alkenyl group, as defined herein, that is substituted with an alkoxycarbonyl group, as defined herein (e.g., -alkenyl-C(O) — OR, where R is an optionally substituted Ci-20, Ci-10, or Ci- 6 alkyl group).
- Exemplary unsubstituted alkoxycarbonylalkenyl include from 4 to 41 carbons (e.g., from 4 to 10, from 4 to 13, from 4 to 17, from 4 to 21, or from 4 to 31 carbons, such as Ci- 6 alkoxycarbonyl- C2-6 alkenyl, Ci-10 alkoxycarbonyl-C2-io alkenyl, or Ci-20 alkoxycarbonyl-C2-2o alkenyl).
- each alkyl, alkenyl, and alkoxy group is further independently substituted with 1, 2, 3, or 4 substituents as described herein (e.g., a hydroxy group).
- alkyl is inclusive of both straight chain and branched chain saturated groups from 1 to 20 carbons (e.g., from 1 to 10 or from 1 to 6), unless otherwise specified.
- Alkyl groups are exemplified by methyl, ethyl, n- and iso-propyl, n-, sec-, iso- and tert-butyl, neopentyl, and the like, and may be optionally substituted with one, two, three, or, in the case of alkyl groups of two carbons or more, four substituents independently selected from the group consisting of: (1) Ci- 6 alkoxy; (2) Ci- 6 alkyl sulfmyl; (3) amino, as defined herein (e.g., unsubstituted amino (i.e., — Nth) or a substituted amino (i.e., — N(R N I )2, where R N1 is as defined for amino); (4) -C(0)0- or
- R E and R F is, independently, selected from the group consisting of (a) hydrogen, (b) Ci-6 alkyl, (c) C6-10 aryl and (d) Ci-6 alkyl-C6-io aryl; (18) — C(0)R g , where R° is selected from the group consisting of (a) Ci-20 alkyl (e.g., Ci- 6 alkyl), (b) C2-20 alkenyl (e.g., C2-6 alkenyl), (c) C6-10 aryl, (d) hydrogen, (e) Ci-6 alkyl-C6-io aryl, (f) amino- Ci-20 alkyl, (g) polyethylene glycol of — (CH2) S 2(0CH2CH2) SI (CH2) S 30R', wherein si is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer
- R' is H or
- si is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from
- each of these groups can be further substituted as described herein.
- the alkyl group of a Ci-alkaryl can be further substituted with an oxo group to afford the respective aryloyl substituent.
- lower alkyl means a group having one to six carbons in the chain which chain may be straight or branched.
- suitable alkyl groups include methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, n-pentyl, and hexyl.
- alkylsulfmyl represents an alkyl group attached to the parent molecular group through an — S(O) — group.
- exemplary unsubstituted alkylsulfmyl groups are from 1 to 6, from 1 to 10, or from 1 to 20 carbons.
- the alkyl group can be further substituted with 1, 2, 3, or 4 substituent groups as defined herein.
- alkylsulfmylalkyl represents an alkyl group, as defined herein, substituted by an alkylsulfmyl group.
- exemplary unsubstituted alkylsulfmylalkyl groups are from 2 to 12, from 2 to 20, or from 2 to 40 carbons.
- each alkyl group can be further substituted with 1, 2, 3, or 4 substituent groups as defined herein.
- alkynyl represents monovalent straight or branched chain groups from 2 to 20 carbon atoms (e.g., from 2 to 4, from 2 to 6, or from 2 to 10 carbons) containing a carbon-carbon triple bond and is exemplified by ethynyl, 1-propynyl, and the like.
- Alkynyl groups may be optionally substituted with 1, 2, 3, or 4 substituent groups that are selected, independently, from aryl, cycloalkyl, or heterocyclyl (e.g., heteroaryl), as defined herein, or any of the exemplary alkyl substituent groups described herein.
- amino represents — N(R N1 )2, wherein each R N1 is, independently, H, OH, NO2, N(R N2 )2, S0 2 0R N2 , S0 2 R N2 , SOR N2 , an N-protecting group, alkyl, alkenyl, alkynyl, alkoxy, aryl, alkaryl, cycloalkyl, alkylcycloalkyl, carboxyalkyl (e.g., optionally substituted with an O-protecting group, such as optionally substituted arylalkoxycarbonyl groups or any described herein), sulfoalkyl, acyl (e.g., acetyl, trifluoroacetyl, or others described herein), alkoxycarbonylalkyl (e.g., optionally substituted with an O-protecting group, such as optionally substituted arylalkoxycarbonyl groups or
- amino groups of the disclosure can be an unsubstituted amino (i.e., — NH2) or a substituted amino (i.e., — N(R')2).
- amino is — N3 ⁇ 4 or — NHR n1 , wherein R N1 is, independently, OH, NO2, NH2, NR N2 2, S0 2 0R N2 , S0 2 R N2 , SOR N2 , alkyl, carboxyalkyl, sulfoalkyl, acyl (e.g., acetyl, trifluoroacetyl, or others described herein), alkoxycarbonylalkyl (e.g., t-butoxycarbonylalkyl) or aryl, and each R N2 can be H, Ci-20 alkyl (e.g., Ci- 6 alkyl), or Ci-10 aryl.
- amino acid refers to a molecule having a side chain, an amino group, and an acid group (e.g., a carboxy group of — CO 2 H or a sulfo group of — SO 3 H), wherein the amino acid is attached to the parent molecular group by the side chain, amino group, or acid group (e.g., the side chain).
- the amino acid is attached to the parent molecular group by a carbonyl group, where the side chain or amino group is attached to the carbonyl group.
- Exemplary side chains include an optionally substituted alkyl, aryl, heterocyclyl, alkylaryl, alkylheterocyclyl, aminoalkyl, carbarn oylalkyl, and carboxyalkyl.
- Exemplary amino acids include alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, hydroxynorvaline, isoleucine, leucine, lysine, methionine, norvaline, ornithine, phenylalanine, proline, pyrrolysine, selenocysteine, serine, taurine, threonine, tryptophan, tyrosine, and valine.
- Amino acid groups may be optionally substituted with one, two, three, or, in the case of amino acid groups of two carbons or more, four substituents independently selected from the group consisting of: (1) Ci- 6 alkoxy; (2) Ci- 6 alkyl sulfinyl; (3) amino, as defined herein (e.g., unsubstituted amino (i.e., — NH?) or a substituted amino (i.e.,
- R N1 is as defined for amino
- R N1 is as defined for amino
- C6-10 aryl-Ci-6 alkoxy (5) azido; (6) halo; (7) (C2-9 heterocyclyl)oxy; (8) hydroxy; (9) nitro; (10) oxo (e.g., carboxyaldehyde or acyl); (11) C1-7 spirocyclyl; (12) thioalkoxy; (13) thiol; (14) — C0 2 R A , where R A is selected from the group consisting of (a) Ci- 2 o alkyl (e.g., Ci- 6 alkyl), (b) C 2.2 o alkenyl (e.g., C 2-6 alkenyl), (c) C6-10 aryl,
- — NR N1 (CH 2 ) S2 (CH 2 CH 2 0) SI (CH 2 ) S3 NR n1 wherein si is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each R N1 is, independently, hydrogen or optionally substituted Ci- 6 alkyl; (20) — NR J C(0)OR K , wherein R J is selected from the group consisting of (al) hydrogen and (bl) Ci- 6 alkyl, and R K is selected from the group consisting of (a2) Ci-20 alkyl (e.g., Ci- 6 alkyl), (b2) C2-20 alkenyl (e.g., C2-6 alkenyl), (c2) C6-10 aryl, (d2) hydrogen, (e2) Ci-6 alkyl-C
- aminoalkoxy represents an alkoxy group, as defined herein, substituted by an amino group, as defined herein.
- the alkyl and amino each can be further substituted with 1, 2, 3, or 4 substituent groups as described herein for the respective group (e.g., CC>2R a , where R A is selected from the group consisting of (a) Ci- 6 alkyl, (b) C6-10 aryl, (c) hydrogen, and (d) Ci- 6 alkyl-C 6 -io aryl, e.g., carboxy).
- aminoalkyl represents an alkyl group, as defined herein, substituted by an amino group, as defined herein.
- the alkyl and amino each can be further substituted with 1, 2, 3, or 4 substituent groups as described herein for the respective group (e.g., CC>2R a , where R A is selected from the group consisting of (a) Ci- 6 alkyl, (b) C6-10 aryl, (c) hydrogen, and (d) Ci- 6 alkyl-C 6 -io aryl, e.g., carboxy, and/or an N-protecting group).
- aminoalkenyl represents an alkenyl group, as defined herein, substituted by an amino group, as defined herein.
- the alkenyl and amino each can be further substituted with 1, 2, 3, or 4 substituent groups as described herein for the respective group R A is selected from the group consisting of (a) Ci- 6 alkyl, (b) C 6 -io aryl, (c) hydrogen, and (d) Ci- 6 alkyl-C 6 -io aryl, e.g., carboxy, and/or an N-protecting group).
- anionic lipid means a lipid that is negatively charged at physiological pH.
- these lipids include, but are not limited to, phosphatidylglycerols, cardiolipins, diacylphosphatidylserines, diacylphosphatidic acids, N-dodecanoyl phosphatidylethanolamines, N-succinyl phosphatidylethanolamines, N- glutarylphosphatidylethanolamines, lysylphosphatidylglycerols, palmitoyloleyolphosphatidyl glycerol (POPG), and other anionic modifying groups joined to neutral lipids.
- phosphatidylglycerols include, but are not limited to, phosphatidylglycerols, cardiolipins, diacylphosphatidylserines, diacylphosphatidic acids, N-dodecanoyl phosphatidylethanolamines, N-succiny
- phrases “at least one of A, B, and C” or “at least one of A, B, or C” each refer to only A, only B, or only C; any combination of A, B, and C; and/or at least one of each of A, B, and C.
- boranyl represents — B(R B1 )3, where each R B1 is, independently, selected from the group consisting of H and optionally substituted alkyl.
- the boranyl group can be substituted with 1, 2, 3, or 4 substituents as defined herein for alkyl.
- biocompatible means compatible with living cells, tissues, organs or systems posing little to no risk of injury, toxicity or rejection by the immune system.
- biodegradable means capable of being broken down into innocuous products by the action of living things.
- biologically active refers to a characteristic of any substance that has activity in a biological system and/or organism. For instance, a substance that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active.
- a polynucleotide of the present disclosure may be considered biologically active if even a portion of the polynucleotide is biologically active or mimics an activity considered biologically relevant.
- boranophosphate has the ordinary meaning as understood in the art and can include protonated, deprotonated, and tautomeric forms thereof.
- a boranophosphate within the context of a compound can have the structure
- Carbocyclic and “carbocyclyl,” as used herein, refer to an optionally substituted C3-12 monocyclic, bicyclic, or tricyclic structure in which the rings, which may be aromatic or non-aromatic, are formed by carbon atoms.
- Carbocyclic structures include cycloalkyl, cycloalkenyl, and aryl groups.
- carbamoylalkyl represents an alkyl group, as defined herein, substituted by a carbamoyl group, as defined herein.
- the alkyl group can be further substituted with 1, 2, 3, or 4 substituent groups as described herein.
- carboxy aldehyde represents an acyl group having the structure —
- cationic lipid means amphiphilic lipids and salts thereof having a positive, hydrophilic head group; one, two, three, or more hydrophobic fatty acid or fatty alkyl chains; and a connector between these two domains.
- An ionizable or protonatable cationic lipid is typically protonated (i.e., positively charged) at a pH below its pK a and is substantially neutral at a pH above the pK a.
- Preferred ionizable cationic lipids are those having a pKa that is less than physiological pH, which is typically about 7.4.
- the cationic lipids of the disclosure may also be termed titratable cationic lipids.
- the cationic lipids can be an "amino lipid" having a protonatable tertiary amine (e.g., pH-titratable) head group.
- Some amino exemplary amino lipid can include Cis alkyl chains, wherein each alkyl chain independently has 0 to 3 (e.g., 0, 1, 2, or 3) double bonds; and ether, ester, or ketal linkages between the head group and alkyl chains.
- Such cationic lipids include, but are not limited to, DSDMA, DODMA, DLinDMA, DLenDMA, g-DLenDMA, DLin-K-DMA, DLin-K-C2-DMA (also known as DLin-C2K-DMA, XTC2, and C2K), DLin-K-C3 -DM A, DLin-K-C4-DMA, DLen-C2K-DMA, y-DLen-C2K-DMA, DLin-M- C2-DMA (also known as MC2), DLin-M-C3 -DMA (also known as MC3) and (DLin-MP- DMA)(also known as 1-Bl 1). [00344]
- the term “comprising” is intended to be open and permits but does not require the inclusion of additional elements or steps. When the term “comprising” is used herein, the term “consisting of’ is thus also encompassed and
- composition means a product comprising the specified ingredients in the specified amounts, as well as any product that results, directly or indirectly, from combination of the specified ingredients in the specified amounts.
- complementary nucleotide bases means a pair of nucleotide bases that form hydrogen bonds with each other.
- Complementary segments or strands of nucleic acid hybridize (i.e. join by hydrogen bonding) with each other.
- complementary is meant that a nucleic acid can form hydrogen bond(s) with another nucleic acid sequence either by traditional Watson-Crick or by other non-traditional modes of binding.
- cycloalkyl represents a monovalent saturated or unsaturated non-aromatic cyclic hydrocarbon group from three to eight carbons, unless otherwise specified, and is exemplified by cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, bicycle heptyl, and the like.
- cycloalkyl group includes one carbon-carbon double bond
- the cycloalkyl group can be referred to as a “cycloalkenyl” group.
- Exemplary cycloalkenyl groups include cyclopentenyl, cyclohexenyl, and the like.
- the cycloalkyl groups of this disclosure can be optionally substituted with: (1) C1-7 acyl (e.g., carboxyaldehyde); (2) Ci-20 alkyl (e.g., Ci-6 alkyl, Ci-6 alkoxy-Ci-6 alkyl,
- each of these groups can be further substituted as described herein.
- the alkyl group of a Ci-alkaryl or a Ci-alkylheterocyclyl can be further substituted with an oxo group to afford the respective aryloyl and (heterocyclyl)oyl substituent group.
- stereomer means stereoisomers that are not mirror images of one another and are non-superimposable on one another.
- diacylglycerol or "DAG” includes a compound having 2 fatty acyl chains, R 1 and R 2 , both of which have independently between 2 and 30 carbons bonded to the 1- and 2-position of glycerol by ester linkages.
- the acyl groups can be saturated or have varying degrees of unsaturation. Suitable acyl groups include, but are not limited to, lauroyl (C 12 ), myristoyl (C14), palmitoyl (Ci6), stearoyl (Cix), and icosoyl (C20).
- R 1 and R 2 are the same, i.e., R 1 and R 2 are both myristoyl (i.e., dimyristoyl), R 1 and R 2 are both stearoyl (i.e., distearoyl).
- dialkyloxypropyl or "DAA” includes a compound having 2 alkyl chains, R and R, both of which have independently between 2 and 30 carbons.
- the alkyl groups can be saturated or have varying degrees of unsaturation.
- an effective amount of an agent is that amount sufficient to effect beneficial or desired results, for example, clinical results, and, as such, an “effective amount” depends upon the context in which it is being applied.
- an effective amount of an agent is, for example, an amount sufficient to achieve treatment, as defined herein, of cancer, as compared to the response obtained without administration of the agent.
- enantiomer means each individual optically active form of a compound of the disclosure, having an optical purity or enantiomeric excess (as determined by methods standard in the art) of at least 80% (i.e., at least 90% of one enantiomer and at most 10% of the other enantiomer), preferably at least 90% and more preferably at least 98%.
- an “enzyme having ornithine transcarbamylase activity”, an “enzyme having OTC activity” or “an OTC enzyme” means a protein or an enzyme that catalyzes a reaction between carbamoyl phosphate and ornithine to form citrulline and phosphate.
- OTC plays an essential role in the urea cycle which has the purpose of capturing toxic ammonia and transforming it into a less toxic urea nitrogen source for excretion.
- the term “fully encapsulated” means that the nucleic acid (e.g., mRNA) in the nucleic acid-lipid particle is not significantly degraded after exposure to serum or a nuclease assay that would significantly degrade free RNA.
- nucleic acid-lipid particles When fully encapsulated, preferably less than 25% of the nucleic acid in the particle is degraded in a treatment that would normally degrade 100% of free nucleic acid, more preferably less than 10%, and most preferably less than 5% of the nucleic acid in the particle is degraded. "Fully encapsulated” also means that the nucleic acid-lipid particles do not rapidly decompose into their component parts upon in vivo administration.
- halo and “Halogen”, as used herein, represents a halogen selected from bromine, chlorine, iodine, or fluorine.
- haloalkyl represents an alkyl group, as defined herein, substituted by a halogen group (i.e., F, Cl, Br, or I).
- a haloalkyl may be substituted with one, two, three, or, in the case of alkyl groups of two carbons or more, four halogens.
- Haloalkyl groups include perfluoroalkyls (e.g., — CF 3 ), — CHF 2 , — CH 2 F, — CCb, — CftC ⁇ Br, — CH 2 CH(CH 2 CH 2 Br)CH 3 , and — CHICH 3 .
- the haloalkyl group can be further substituted with 1, 2, 3, or 4 substituent groups as described herein for alkyl groups.
- heteroalkyl refers to an alkyl group, as defined herein, in which one or two of the constituent carbon atoms have each been replaced by nitrogen, oxygen, or sulfur.
- the heteroalkyl group can be further substituted with 1, 2, 3, or 4 substituent groups as described herein for alkyl groups.
- hydrocarbon represents a group consisting only of carbon and hydrogen atoms.
- hydroxy represents an — OH group.
- the hydroxy group can be substituted with 1, 2, 3, or 4 substituent groups (e.g., O- protecting groups) as defined herein for an alkyl.
- hydroxyalkenyl represents an alkenyl group, as defined herein, substituted by one to three hydroxy groups, with the proviso that no more than one hydroxy group may be attached to a single carbon atom of the alkyl group, and is exemplified by dihydroxypropenyl, hydroxyisopentenyl, and the like.
- the hydroxyalkenyl group can be substituted with 1, 2, 3, or 4 substituent groups (e.g., O-protecting groups) as defined herein for an alkyl.
- hydroxyalkyl represents an alkyl group, as defined herein, substituted by one to three hydroxy groups, with the proviso that no more than one hydroxy group may be attached to a single carbon atom of the alkyl group, and is exemplified by hydroxymethyl, dihydroxypropyl, and the like.
- the hydroxyalkyl group can be substituted with 1, 2, 3, or 4 substituent groups (e.g., O-protecting groups) as defined herein for an alkyl.
- hydrate means a solvate wherein the solvent molecule is EhO.
- the term “isomer,” as used herein, means any tautomer, stereoisomer, enantiomer, or diastereomer of any compound of the disclosure. It is recognized that the compounds of the disclosure can have one or more chiral centers and/or double bonds and, therefore, exist as stereoisomers, such as double-bond isomers (i.e., geometric E/Z isomers) or diastereomers (e.g., enantiomers (i.e., (+) or (-)) or cis/trans isomers).
- the chemical structures depicted herein, and therefore the compounds of the disclosure encompass all of the corresponding stereoisomers, that is, both the stereomerically pure form (e.g., geometrically pure, enantiomerically pure, or diastereomerically pure) and enantiomeric and stereoisomeric mixtures, e.g., racemates.
- Enantiomeric and stereoisomeric mixtures of compounds of the disclosure can typically be resolved into their component enantiomers or stereoisomers by well-known methods, such as chiral-phase gas chromatography, chiral-phase high performance liquid chromatography, crystallizing the compound as a chiral salt complex, or crystallizing the compound in a chiral solvent.
- Enantiomers and stereoisomers can also be obtained from stereomerically or enantiomerically pure intermediates, reagents, and catalysts by well-known asymmetric synthetic methods.
- nucleic acid means deoxyribonucleotides or ribonucleotides and polymers thereof in single- or double-stranded form.
- the term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides.
- Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2'-0-methyl ribonucleotides, peptide-nucleic acids (PNAs).
- PNAs peptide-nucleic acids
- stereoisomer refers to all possible different isomeric as well as conformational forms which a compound may possess (e.g., a compound of any formula described herein), in particular all possible stereochemically and conformationally isomeric forms, all diastereomers, enantiomers and/or conformers of the basic molecular structure. Some compounds of the present disclosure may exist in different tautomeric forms, all of the latter being included within the scope of the present disclosure.
- sulfonyl represents an — S(0) 2 — group.
- compound is meant to include all stereoisomers, geometric isomers, tautomers, and isotopes of the structures depicted.
- Nucleotides or amino acids that are relatively conserved are those that are conserved amongst more related sequences than nucleotides or amino acids appearing elsewhere in the sequences.
- two or more sequences are said to be “completely conserved” if they are 100% identical to one another.
- two or more sequences are said to be “highly conserved” if they are at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another.
- two or more sequences are said to be “highly conserved” if they are about 70% identical, about 80% identical, about 90% identical, about 95%, about 98%, or about 99% identical to one another. In some embodiments, two or more sequences are said to be “conserved” if they are at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another.
- two or more sequences are said to be “conserved” if they are about 30% identical, about 40% identical, about 50% identical, about 60% identical, about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another. Conservation of sequence may apply to the entire length of an oligonucleotide or polypeptide or may apply to a portion, region or feature thereof.
- Cyclic refers to the presence of a continuous loop. Cyclic molecules need not be circular, only joined to form an unbroken chain of subunits. Cyclic molecules such as the mRNA of the present disclosure may be single units or multimers or comprise one or more components of a complex or higher order structure.
- cytotoxic refers to killing or causing injurious, toxic, or deadly effect on a cell (e.g., a mammalian cell (e.g., a human cell)), bacterium, virus, fungus, protozoan, parasite, prion, or a combination thereof.
- delivery refers to the act or manner of delivering a compound, substance, entity, moiety, cargo or payload.
- delivery agent or “delivery vehicle” refers to any substance which facilitates, at least in part, the in vivo delivery of a polynucleotide to targeted cells.
- digest means to break apart into smaller pieces or components. When referring to polypeptides or proteins, digestion results in the production of peptides.
- encoded protein cleavage signal refers to the nucleotide sequence which encodes a protein cleavage signal.
- engineered when they are designed to have a feature or property, whether structural or chemical, that varies from a starting point, wild type or native molecule.
- RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5' cap formation, and/or 3' end processing); (3) translation of an RNA into a polypeptide or protein; and (4) post- translational modification of a polypeptide or protein.
- feature refers to a characteristic, a property, or a distinctive element.
- fragment refers to a portion.
- fragments of proteins may comprise polypeptides obtained by digesting full-length protein isolated from cultured cells.
- the term “functional” biological molecule is a biological molecule in a form in which it exhibits a property and/or activity by which it is characterized.
- homology refers to the overall relatedness between polymeric molecules, e.g. between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
- polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical or similar.
- homologous necessarily refers to a comparison between at least two sequences (polynucleotide or polypeptide sequences).
- two polynucleotide sequences are considered to be homologous if the polypeptides they encode are at least about 50%, 60%, 70%, 80%, 90%, 95%, or even 99% for at least one stretch of at least about 20 amino acids.
- homologous polynucleotide sequences are characterized by the ability to encode a stretch of at least 4-5 uniquely specified amino acids. For polynucleotide sequences less than 60 nucleotides in length, homology is determined by the ability to encode a stretch of at least 4-5 uniquely specified amino acids.
- two protein sequences are considered to be homologous if the proteins are at least about 50%, 60%, 70%, 80%, or 90% identical for at least one stretch of at least about 20 amino acids.
- hydrophobic lipids means compounds having apolar groups that include, but are not limited to, long-chain saturated and unsaturated aliphatic hydrocarbon groups and such groups optionally substituted by one or more aromatic, cycloaliphatic, or heterocyclic group(s). Suitable examples include, but are not limited to, diacylglycerol, dialkyl glycerol, N-N-dialkylamino, 1, 2-diacyl oxy-3-aminopropane, and l,2-dialkyl-3- aminopropane.
- identity refers to the overall relatedness between polymeric molecules, e.g., between oligonucleotide molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two polynucleotide sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes).
- the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence.
- the nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two nucleotide sequences can be determined using methods such as those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; and Sequence Analysis Primer, Gribskov, M.
- the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4:11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two nucleotide sequences can, alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix.
- Methods commonly employed to determine percent identity between sequences include, but are not limited to those disclosed in Carillo, H., and Lipman, D., SIAM J Applied Math., 48:1073 (1988); incorporated herein by reference. Techniques for determining identity are codified in publicly available computer programs. Exemplary computer software to determine homology between two sequences include, but are not limited to, GCG program package, Devereux, J., et ah, Nucleic Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN, and FASTA Altschul, S. F. et ak, J. Molec. Biol., 215, 403 (1990)).
- isolated refers to a substance or entity that has been separated from at least some of the components with which it was associated (whether in nature or in an experimental setting). Isolated substances may have varying levels of purity in reference to the substances from which they have been associated. Isolated substances and/or entities may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated. In some embodiments, isolated agents are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure.
- a substance is “pure” if it is substantially free of other components.
- substantially isolated By “substantially isolated” is meant that the compound is substantially separated from the environment in which it was formed or detected. Partial separation can include, for example, a composition enriched in the compound of the present disclosure. Substantial separation can include compositions containing at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% by weight of the compound of the present disclosure, or salt thereof. Methods for isolating compounds and their salts are routine in the art.
- lipid means an organic compound that comprises an ester of fatty acid and is characterized by being insoluble in water, but soluble in many organic solvents. Lipids are usually divided into at least three classes: (1) “simple lipids,” which include fats and oils as well as waxes; (2) “compound lipids,” which include phospholipids and glycolipids; and (3) “derived lipids” such as steroids.
- lipid delivery vehicle means a lipid formulation that can be used to deliver a therapeutic nucleic acid (e.g., mRNA) to a target site of interest (e.g., cell, tissue, organ, and the like).
- the lipid delivery vehicle can be a nucleic acid-lipid particle, which can be formed from a cationic lipid, a non-cationic lipid (e.g., a phospholipid), a conjugated lipid that prevents aggregation of the particle (e.g., a PEG-lipid), and optionally cholesterol.
- the therapeutic nucleic acid e.g., mRNA
- lipid encapsulated means a nucleic acid such as an mRNA that is completely encapsulated, partial encapsulated, or both in a lipid formulation.
- the nucleic acid e.g., mRNA
- the nucleic acid is fully encapsulated in the lipid particle.
- lipid conjugate means a conjugated lipid that inhibits aggregation of lipid particles.
- lipid conjugates include, but are not limited to, PEG-lipid conjugates such as, e.g., PEG coupled to dialkyloxypropyls (e.g., PEG-DAA conjugates), PEG coupled to diacylglycerols (e.g., PEG-DAG conjugates), PEG coupled to cholesterol, PEG coupled to phosphatidylethanolamines, and PEG conjugated to ceramides, cationic PEG lipids, polyoxazoline (POZ)-lipid conjugates, polyamide oligomers, and mixtures thereof.
- PEG-lipid conjugates such as, e.g., PEG coupled to dialkyloxypropyls (e.g., PEG-DAA conjugates), PEG coupled to diacylglycerols (e.g., PEG-DAG conjugates), PEG coupled to cholesterol, PEG coupled to phosphatidy
- PEG or POZ can be conjugated directly to the lipid or may be linked to the lipid via a linker moiety.
- Any linker moiety suitable for coupling the PEG or the POZ to a lipid can be used including, e.g., non-ester-containing linker moieties and ester-containing linker moieties.
- non-ester-containing linker moieties such as amides or carbamates, are used.
- amphipathic lipid or “amphiphilic lipid” means the material in which the hydrophobic portion of the lipid material orients into a hydrophobic phase, while the hydrophilic portion orients toward the aqueous phase. Hydrophilic characteristics derive from the presence of polar or charged groups such as carbohydrates, phosphate, carboxylic, sulfato, amino, sulfhydryl, nitro, hydroxyl, and other like groups. Hydrophobicity can be conferred by the inclusion of apolar groups that include, but are not limited to, long-chain saturated and unsaturated aliphatic hydrocarbon groups and such groups substituted by one or more aromatic, cycloaliphatic, or heterocyclic group(s). Examples of amphipathic compounds include, but are not limited to, phospholipids, aminolipids, and sphingolipids.
- linker refers to a group of atoms, e.g., 10-1,000 atoms, and can be comprised of the atoms or groups such as, but not limited to, carbon, amino, alkylamino, oxygen, sulfur, sulfoxide, sulfonyl, carbonyl, and imine.
- the linker can be attached to a modified nucleoside or nucleotide on the nucleobase or sugar moiety at a first end, and to a payload, e.g., a detectable or therapeutic agent, at a second end.
- the linker may be of sufficient length as to not interfere with incorporation into a nucleic acid sequence.
- the linker can be used for any useful purpose, such as to form multimers (e.g., through linkage of two or more polynucleotides) or conjugates, as well as to administer a payload, as described herein.
- Examples of chemical groups that can be incorporated into the linker include, but are not limited to, alkyl, alkenyl, alkynyl, amido, amino, ether, thioether, ester, alkyl, heteroalkyl, aryl, or heterocyclyl, each of which can be optionally substituted, as described herein.
- a disulfide bond — S — S —
- Non-limiting examples of a selectively cleavable bond include an amido bond can be cleaved for example by the use of tris(2-carboxyethyl)phosphine (TCEP), or other reducing agents, and/or photolysis, as well as an ester bond can be cleaved for example by acidic or basic hydrolysis.
- TCEP tris(2-carboxyethyl)phosphine
- mammal means a human or other mammal or means a human being.
- mRNA messenger RNA
- mRNA refers to any polynucleotide which encodes a protein or polypeptide of interest and which is capable of being translated to produce the encoded protein or polypeptide of interest in vitro, in vivo, in situ or ex vivo.
- modified refers to a changed state or structure of a molecule of the disclosure or of an otherwise standard reference molecule.
- Molecules may be modified in many ways including chemically, structurally, and functionally.
- the mRNA molecules of the present disclosure are modified by the introduction of non-natural nucleosides and/or nucleotides, e.g., as it relates to the natural ribonucleotides A, U, G, and C.
- Noncanonical nucleotides such as the cap structures are not considered “modified” although they may differ from the chemical structure of the A, C, G, U ribonucleotides.
- nonhuman vertebrate includes all vertebrates except Homo sapiens , including wild and domesticated species.
- non-human vertebrates include, but are not limited to, mammals, such as alpaca, banteng, bison, camel, cat, cattle, deer, dog, donkey, gayal, goat, guinea pig, horse, llama, mule, pig, rabbit, reindeer, sheep water buffalo, and yak.
- nucleotide is meant to include nucleotides that have natural bases (standard) or modified bases well known in the art. Such bases are generally located at the G position of a nucleotide sugar moiety. Nucleotides generally comprise a base, sugar, and a phosphate group. The nucleotides can be unmodified or modified at the sugar, phosphate, and/or base moiety, (also referred to interchangeably as nucleotide analogs, modified nucleotides, non natural nucleotides, non-standard nucleotides and other; see, for example, Usman and McSwiggen, supra; Eckstein, et al., International PCT Publication No.
- base modifications that can be introduced into nucleic acid molecules include: inosine, purine, pyridin-4-one, pyridin-2-one, phenyl, pseudouracil, 2,4,6- trimethoxy benzene, 3-methyl uracil, dihydrouridine, naphthyl, aminophenyl, 5-alkylcytidines (e.g., 5-methylcytidine), 5-alkyluridines (e.g., ribothymidine), 5-halouridine (e.g., 5- bromouridine) or 6-azapyrimidines or 6-alkylpyrimidines (e.g., 6-methyluridine), propyne, and others (Burgin, et al., Biochemistry 35:14090, 1996; Uhlman & Peyman, supra).
- modified bases in this aspect is meant nucleotide bases other than adenine, guanine, cytosine, and urac
- off target refers to any unintended effect on any one or more target, gene, or cellular transcript.
- codon-optimized means a natural (or purposefully designed variant of a natural) coding sequence which has been redesigned by choosing different codons without altering the encoded protein amino acid sequence increasing the protein expression levels (Gustafsson et al, Codon bias and heterologous protein expression. 2004, Trends Biotechnol 22: 346-53).
- CAI high codon adaptation index
- LowU method mRNA secondary structures, cis-regulatory sequences, GC content and many other similar variables have been shown to somewhat correlate with protein expression levels (Villalobos et al., Gene Designer: a synthetic biology tool for constructing artificial DNA segments. 2006, BMC Bioinformatics 7:285).
- High CAI (codon adaptation index) method picks a most frequently used synonymous codon for an entire protein coding sequence. The most frequently used codon for each amino acid is deduced from 74218 protein-coding genes from a human genome.
- the LowU method targets only Li-containing codons that can be replaced with a synonymous codon with fewer U moieties.
- the more frequently used codon will be selected.
- the remaining codons in the sequence are not changed by the LowU method. This method may be used in conjunction with the disclosed mRNAs to design coding sequences that are to be synthesized with 5- methoxy uridine.
- ORF open reading frame to a nucleic acid sequence (DNA or RNA) refers to the portion of a sequence that is capable of encoding a polypeptide of interest. ORFs generally begin with the start codon ATG, and end with a nonsense or termination codon or signal.
- operably linked refers to a functional connection between two or more molecules, constructs, transcripts, entities, moieties or the like.
- patient refers to a subject who may seek or be in need of treatment, requires treatment, is receiving treatment, will receive treatment, or a subject who is under care by a trained professional for a particular disease or condition.
- optionally substituted X e.g., optionally substituted alkyl
- X is optionally substituted
- alkyl wherein said alkyl is optionally substituted
- peptide is less than or equal to 50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acids long.
- pharmaceutically acceptable is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- phrases “pharmaceutically acceptable excipient,” as used herein, refers any ingredient other than the compounds described herein (for example, a vehicle capable of suspending or dissolving the active compound) and having the properties of being substantially nontoxic and non-inflammatory in a patient.
- Excipients may include, for example: antiadherents, antioxidants, binders, coatings, compression aids, disintegrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, and waters of hydration.
- antiadherents antioxidants, binders, coatings, compression aids, disintegrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, and waters of hydration.
- excipients include, but are not limited to: butylated hydroxytoluene (BEIT), calcium carbonate, calcium phosphate (dibasic), calcium stearate, croscarmellose, crosslinked polyvinyl pyrrolidone, citric acid, crospovidone, cysteine, ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl methylcellulose, lactose, magnesium stearate, maltitol, mannitol, methionine, methylcellulose, methyl paraben, microcrystalline cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone, pregelatinized starch, propyl paraben, retinyl palmitate, shellac, silicon dioxide, sodium carboxymethyl cellulose, sodium citrate, sodium starch glycolate, sorbitol, starch (com), stearic acid, sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C,
- pharmaceutically acceptable salts refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form (e.g., by reacting the free base group with a suitable organic acid).
- suitable organic acid examples include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like.
- Representative acid addition salts include acetate, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecyl sulfate, ethanesulfonate, fumarate, glucoheptonate, glycerophosphate, hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate,
- alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like, as well as nontoxic ammonium, quaternary ammonium, and amine cations, including, but not limited to ammonium, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, triethylamine, ethylamine, and the like.
- the pharmaceutically acceptable salts of the present disclosure include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids.
- the pharmaceutically acceptable salts of the present disclosure can be synthesized from the parent compound which contains a basic or acidic moiety by conventional chemical methods.
- such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred.
- nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred.
- Lists of suitable salts are found in Remington's Pharmaceutical Sciences, 17 th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418, Pharmaceutical Salts: Properties, Selection, and Use , P. H. Stahl and C. G. Wermuth (eds.), Wiley-VCH, 2008, and Berge et ah, Journal of Pharmaceutical Science, 66, 1-19 (1977), each of which is incorporated herein by reference in its entirety.
- the term “pharmacokinetic” refers to any one or more properties of a molecule or compound as it relates to the determination of the fate of substances administered to a living organism. Pharmacokinetics is divided into several areas including the extent and rate of absorption, distribution, metabolism and excretion. This is commonly referred to as ADME where: (A) Absorption is the process of a substance entering the blood circulation; (D) Distribution is the dispersion or dissemination of substances throughout the fluids and tissues of the body; (M) Metabolism (or Biotransformation) is the irreversible transformation of parent compounds into daughter metabolites; and (E) Excretion (or Elimination) refers to the elimination of the substances from the body. In rare cases, some drugs irreversibly accumulate in body tissue.
- solvate means a compound of the disclosure wherein molecules of a suitable solvent are incorporated in the crystal lattice.
- a suitable solvent is physiologically tolerable at the dosage administered.
- solvates may be prepared by crystallization, recrystallization, or precipitation from a solution that includes organic solvents, water, or a mixture thereof.
- Suitable solvents are ethanol, water (for example, mono-, di-, and tri-hydrates), N-methylpyrrolidinone (NMP), dimethyl sulfoxide (DMSO), N,N'-dimethylformamide (DMF), N,N'-dimethylacetamide (DMAC), l,3-dimethyl-2-imidazolidinone (DMEU), l,3-dimethyl-3,4,5,6-tetrahydro-2-(lH)- pyrimidinone (DMPU), acetonitrile (ACN), propylene glycol, ethyl acetate, benzyl alcohol, 2- pyrrolidone, benzyl benzoate, and the like.
- NMP N-methylpyrrolidinone
- DMSO dimethyl sulfoxide
- DMF N,N'-dimethylformamide
- DMAC N,N'-dimethylacetamide
- DMEU N,N'-dimethyl-2-imidazo
- phosphate is used in its ordinary sense as understood by those skilled in the art and includes its protonated forms, for example
- phosphorothioate refers to a compound of the general formula its protonated forms, for example, and its tautomers such as
- the term “physicochemical” means of or relating to a physical and/or chemical property.
- the term “preventing” refers to partially or completely delaying onset of an infection, disease, disorder and/or condition; partially or completely delaying onset of one or more symptoms, features, or clinical manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying onset of one or more symptoms, features, or manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying progression from an infection, a particular disease, disorder and/or condition; and/or decreasing the risk of developing pathology associated with the infection, the disease, disorder, and/or condition.
- protein cleavage site refers to a site where controlled cleavage of the amino acid chain can be accomplished by chemical, enzymatic or photochemical means.
- protein cleavage signal refers to at least one amino acid that flags or marks a polypeptide for cleavage.
- proteins of interest or “desired proteins” include those provided herein and fragments, mutants, variants, and alterations thereof.
- purify means to make substantially pure or clear from unwanted components, material defilement, admixture or imperfection.
- RNA means a molecule comprising at least one ribonucleotide residue.
- ribonucleotide is meant a nucleotide with a hydroxyl group at the 2' position of a b-D-ribo-furanose moiety.
- the terms includes double-stranded RNA, single- stranded RNA, isolated RNA such as partially purified RNA, essentially pure RNA, synthetic RNA, recombinantly produced RNA, as well as altered RNA that differs from naturally occurring RNA by the addition, deletion, substitution, and/or alteration of one or more nucleotides.
- Such alterations can include addition of non-nucleotide material, such as to the end(s) of an interfering RNA or internally, for example at one or more nucleotides of the RNA.
- Nucleotides in the RNA molecules of the instant disclosure can also comprise non-standard nucleotides, such as non- naturally occurring nucleotides or chemically synthesized nucleotides or deoxynucleotides. These altered RNAs can be referred to as analogs or analogs of naturally-occurring RNA.
- ribonucleic acid and "RNA” refer to a molecule containing at least one ribonucleotide residue, including siRNA, antisense RNA, single stranded RNA, microRNA, mRNA, noncoding RNA, and multivalent RNA.
- sample refers to a subset of its tissues, cells or component parts (e.g. body fluids, including but not limited to blood, mucus, lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva, amniotic fluid, amniotic cord blood, urine, vaginal fluid and semen).
- body fluids including but not limited to blood, mucus, lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva, amniotic fluid, amniotic cord blood, urine, vaginal fluid and semen).
- a sample further may include a homogenate, lysate or extract prepared from a whole organism or a subset of its tissues, cells or component parts, or a fraction or portion thereof, including but not limited to, for example, plasma, serum, spinal fluid, lymph fluid, the external sections of the skin, respiratory, intestinal, and genitourinary tracts, tears, saliva, milk, blood cells, tumors, organs.
- a sample further refers to a medium, such as a nutrient broth or gel, which may contain cellular components, such as proteins or nucleic acid molecule.
- signal sequences or “signal peptide” refer to a sequence which can direct the transport or localization of a protein.
- single unit dose is a dose of any therapeutic administered in one dose/at one time/single route/single point of contact, i.e., single administration event.
- similarity refers to the overall relatedness between polymeric molecules, e.g. between polynucleotide molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of percent similarity of polymeric molecules to one another can be performed in the same manner as a calculation of percent identity, except that calculation of percent similarity takes into account conservative substitutions as is understood in the art.
- solvate means a physical association of a compound of this disclosure with one or more solvent molecules. This physical association involves varying degrees of ionic and covalent bonding, including hydrogen bonding. In certain instances, the solvate will be capable of isolation, for example when one or more solvent molecules are incorporated in the crystal lattice of the crystalline solid. “Solvate” encompasses both solution- phase and isolatable solvates. Non-limiting examples of suitable solvates include ethanolates, methanolates, and the like.
- split dose is the division of single unit dose or total daily dose into two or more doses.
- stable refers to a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and preferably capable of formulation into an efficacious therapeutic agent.
- stabilize means to make or become stable.
- substituted means substitution with specified groups other than hydrogen, or with one or more groups, moieties, or radicals which can be the same or different, with each, for example, being independently selected.
- the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
- One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result.
- the term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
- the phrase “suffering from” relates to an individual who is “suffering from” a disease, disorder, and/or condition has been diagnosed with or displays one or more symptoms of a disease, disorder, and/or condition.
- the phrase “susceptible to” relates to an individual who is “susceptible to” a disease, disorder, and/or condition has not been diagnosed with and/or may not exhibit symptoms of the disease, disorder, and/or condition but harbors a propensity to develop a disease or its symptoms.
- an individual who is susceptible to a disease, disorder, and/or condition may be characterized by one or more of the following: (1) a genetic mutation associated with development of the disease, disorder, and/or condition; (2) a genetic polymorphism associated with development of the disease, disorder, and/or condition; (3) increased and/or decreased expression and/or activity of a protein and/or nucleic acid associated with the disease, disorder, and/or condition; (4) habits and/or lifestyles associated with development of the disease, disorder, and/or condition; (5) a family history of the disease, disorder, and/or condition; and (6) exposure to and/or infection with a microbe associated with development of the disease, disorder, and/or condition.
- an individual who is susceptible to a disease, disorder, and/or condition will develop the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will not develop the disease, disorder, and/or condition.
- Synthesis of polynucleotides or polypeptides or other molecules of the present disclosure may be chemical or enzymatic.
- targeted cells refers to any one or more cells of interest.
- the cells may be found in vitro , in vivo , in situ or in the tissue or organ of an organism.
- the organism may be an animal, preferably a mammal, more preferably a human and most preferably a patient.
- therapeutic agent refers to any agent that, when administered to a subject, has a therapeutic, diagnostic, and/or prophylactic effect and/or elicits a desired biological and/or pharmacological effect.
- terapéuticaally effective amount means an amount of an agent to be delivered (e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.) that is sufficient, when administered to a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.
- an agent to be delivered e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.
- terapéuticaally effective outcome means an outcome that is sufficient in a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.
- total daily dose is an amount given or prescribed in 24 hr period. It may be administered as a single unit dose.
- transcription factor refers to a DNA-binding protein that regulates transcription of DNA into RNA, for example, by activation or repression of transcription. Some transcription factors effect regulation of transcription alone, while others act in concert with other proteins. Some transcription factor can both activate and repress transcription under certain conditions. In general, transcription factors bind a specific target sequence or sequences highly similar to a specific consensus sequence in a regulatory region of a target gene. Transcription factors may regulate transcription of a target gene alone or in a complex with other molecules.
- treating refers to partially or completely alleviating, ameliorating, improving, relieving, delaying onset of, inhibiting progression of, reducing severity of, and/or reducing incidence of one or more symptoms or features of a particular infection, disease, disorder, and/or condition.
- “treating” cancer may refer to inhibiting survival, growth, and/or spread of a tumor. Treatment may be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition and/or to a subject who exhibits only early signs of a disease, disorder, and/or condition for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition.
- Unmodified refers to any substance, compound or molecule prior to being changed in any way. Unmodified may, but does not always, refer to the wild type or native form of a biomolecule. Molecules may undergo a series of modifications whereby each modified molecule may serve as the “unmodified” starting molecule for a subsequent modification.
- the compounds described herein can be asymmetric (e.g., having one or more stereocenters). All stereoisomers, such as enantiomers and diastereomers, are intended unless otherwise indicated.
- Tautomeric forms result from the swapping of a single bond with an adjacent double bond and the concomitant migration of a proton.
- Tautomeric forms include prototropic tautomers which are isomeric protonation states having the same empirical formula and total charge.
- Examples prototropic tautomers include ketone-enol pairs, amide-imidic acid pairs, lactam-lactim pairs, amide-imidic acid pairs, enamine-imine pairs, and annular forms where a proton can occupy two or more positions of a heterocyclic system, such as, 1H- and 3H-imidazole, 1H-, 2H- and 4H- 1,2, 4-triazole, 1H- and 2H-isoindole, and 1H- and 2H-pyrazole.
- Tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution.
- Compounds of the present disclosure also include all of the isotopes of the atoms occurring in the intermediate or final compounds. “Isotopes” refers to atoms having the same atomic number but different mass numbers resulting from a different number of neutrons in the nuclei. For example, isotopes of hydrogen include tritium and deuterium.
- the compounds and salts of the present disclosure can be prepared in combination with solvent or water molecules to form solvates and hydrates by routine methods.
- half-life is the time required for a quantity such as nucleic acid or protein concentration or activity to fall to half of its value as measured at the beginning of a time period.
- in vitro' refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).
- in vivo refers to events that occur within an organism (e.g., animal, plant, or microbe or cell or tissue thereof).
- a monomer refers to a single unit, e.g., a single nucleic acid, which may be joined with another molecule of the same or different type to form an oligomer.
- a monomer may be an unlocked nucleic acid, i.e., a UNA monomer.
- neutral lipid means a lipid species that exist either in an uncharged or neutral zwitterionic form at a selected pH.
- such lipids include, for example, diacylphosphatidylcholine, diacylphosphatidylethanolamine, ceramide, sphingomyelin, cephalin, cholesterol, cerebrosides, and diacylglycerols.
- non-cationic lipid means an amphipathic lipid, a neutral lipid or anionic lipid as described herein.
- oligomer may be used interchangeably with “polynucleotide” and refers to a molecule comprising at least two monomers and includes oligonucleotides such as DNAs and RNAs.
- the oligomers of the present disclosure may contain sequences in addition to the coding sequence (CDS). These additional sequences may be untranslated sequences, i.e., sequences which are not converted to protein by a host cell.
- RNA sequence refers to a sequence that comprises a region, e.g. , the coding region of an RNA (e.g. , the coding sequence of human CFTR or a codon-optimized version thereof), that is capable of being converted to a protein or a fragment thereof, e.g. , the human CFTR protein or a fragment thereof.
- subject refers to any organism to which a composition in accordance with the disclosure may be administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes.
- Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans) and/or plants.
- ransable may be used interchangeably with the term “expressible” and refers to the ability of polynucleotide, or a portion thereof, to be converted to a polypeptide by a host cell.
- translation is the process in which ribosomes in a cell's cytoplasm create polypeptides.
- messenger RNA mRNA
- tRNA messenger RNA
- translatable when used in this specification in reference to an oligomer, means that at least a portion of the oligomer, e.g. , the coding region of an oligomer sequence (also known as the coding sequence or CDS), is capable of being converted to a protein or a fragment thereof.
- translation efficiency refers to a measure of the production of a protein or polypeptide by translation of an mRNA sequence in vitro or in vivo.
- This disclosure provides a range of mRNA sequence molecules wherein the mRNA sequence can be expressible to provide a polypeptide or protein.
- unit dose refers to a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
- the amount of the active ingredient may generally be equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage including, but not limited to, one-half or one-third of such a dosage.
- Example 1 In vitro transcription protocol
- Constructs of mRNAs described herein were synthesized in vitro using T7RNA polymerase-mediated, DNA-dependent RNA transcription.
- modified and unmodified uridine triphosphates were used depending on the desired polynucleotide configuration.
- Modified UTPs used included 5-methoxy UTP (5MeOU), N 1 - methyl pseudo UTP, Nl-methoxy methyl pseudo UTP (Nl-MOM), 5-hydroxy methyl UTP, 5- carboxy UTP, and a mixture of modified UTPs, using a linearized template for each UTR combination.
- the mRNA was purified using column chromatography, the DNA and double stranded RNA contamination of all mRNAs was removed using an enzymatic reaction, and the mRNA was concentrated, and buffer exchanged.
- Lipid encapsulated mRNA particles were prepared by mixing lipids (ionizable cationic lipid: DSPC: Cholesterol: PEG-DMG) in ethanol with OTC mRNA dissolved in citrate buffer. The mixed material was instantaneously diluted with Phosphate Buffer. Ethanol was removed by dialysis against phosphate buffer using regenerated cellulose membrane (100 kD MWCO) or by tangential flow filtration (TFF) using modified polyethersulfone (mPES) hollow fiber membranes (100 kD MWCO).
- lipids ionizable cationic lipid: DSPC: Cholesterol: PEG-DMG
- HEPES 4-(2-hydroxyethyl)-l-piperazineethanesulfonic acid
- the formulation was concentrated followed by 0.2 pm filtration using PES filters.
- the mRNA concentration in the formulation was then measured by Ribogreen fluorimetric assay following which the concentration was adjusted to a final desired concentration by diluting with HEPES buffer containing 40-60 mM NaCl, 7-12% sucrose, pH 7.3 containing glycerol.
- the final formulation was then filtered through a 0.2 pm filter and filled into glass vials, stoppered, capped and placed at -70 ⁇ 5°C.
- the frozen formulations were characterized for their mRNA content by HPLC or Ribogreen assay and percent encapsulation by Ribogreen assay, mRNA integrity by fragment analyzer, lipid content by high performance liquid chromatography (HPLC), particle size by dynamic light scattering on a Malvern Zetasizer Nano ZS, pH and osmolality.
- TCW In-Cell Western (TCW) [00462] 96-well collagen plates were used to seed the cells at the appropriate density in Dulbecco’s Modified Eagle Media (DMEM)/Fetal Bovine Serum (FBS) culture media. At the optimal confluence, cells were transfected with the targeted mRNAs diluted in the transfection reagent mix (MessengerMax and Opti-MEM). Cells were placed in a CO2 incubator and allowed to grow. At the desired timepoint, media was removed, and cells were fixed in 4% fresh paraformaldehyde (PFA) for 20 min. After that, fixative was removed, and cells were permeabilized several times in Tris buffered saline with TWEEN (TBST) for 5 minutes each time.
- PFA paraformaldehyde
- a UTR library was screened in vitro using mRNA construct #571 comprising the sequence of SEQ ID NO: 34 as the CDS (coding sequence).
- Hepal,6 and Hep3B cells were transfected with the different mRNAs using commercially available transfection reagents and protein expression was measured, as described above (In-Cell Western assays, Example 1).
- OTC protein expression levels were measured by near-infrared fluorescent imaging systems. Commercially available antibodies for OTC were used for detection. Untransfected cells and reference sequences were used as internal controls.
- FIG. 1A is a scatter plot of OTC protein expression levels found in Hepal,6 and Hep3B cells at 24 hours.
- FIG. 1A is a scatter plot of OTC protein expression levels found in Hepal,6 and Hep3B cells at 24 hours.
- IB is a scatter plot of OTC protein expression levels found in Hepal,6 and Hep3B cells at 48 hours.
- the aim of the screen was to determine a UTR-specific impact on OTC expression levels in a human (Hep3B) and a mouse (Hepal,6) liver cell line to determine which UTRs would work best in both models and, in particular, to assess translatability from mouse-to-human. Top expressing UTRs were used in further profiling studies.
- Example 3 Round 1 of protein stability mRNA compound screening in Hepal.6 and Hep3B at 24h - Correlation.
- N1MPU N'-rnethyl pseudouridine
- 5MeOU 5- methoxyuridine
- FIG. 2 is a scatter plot showing the correlation of OTC protein expression levels in Hepal,6 cells at 24 hours as a function of mRNAs tested and including N1MPU and 5MeOU chemistries.
- FIG. 2 is a scatter plot showing the correlation of OTC protein expression levels in Hepal,6 cells at 24 hours as a function of mRNAs tested and including N1MPU and 5MeOU chemistries.
- FIG. 3 is a scatter plot showing the correlation of OTC protein expression levels in Hep3B cells at 24 hours as a function of mRNAs tested and including N1MPU and 5MeOU chemistries. Shown in the figures is the degree of variability in expression levels for mRNAs with two different chemistries tested in a mouse and a human liver cell line. It can be seen that, in this experiment, most of the mRNA compounds express better when an N1MPU chemistry is used.
- Example 4 Round 2 of protein stability mRNA compound screening in Human Primary Hepatocvtes at 24h and 48h - Correlation.
- Example 5 Round 3 of protein stability compound screening in Human Primary Hepatocytes at 24h and 48h - Correlation.
- Example 6 OTC protein-expression levels in human primary cells transfected with OTC mRNA constructs 1799 7 (5MeOU chemistry) encoding the OTC protein of SEP ID NO: 3 and 1921 7 (5MeOU chemistry) encoding the modified OTC protein of SEP ID NO: 4
- Spf/ash mice received an IV injection with either PBS or lipid-formulated (as described in Example 1) hOTC-mRNA at a 10 mg/kg dose level.
- WT mice were used as internal controls to determine endogenous levels.
- a time course (6 hours, 24 hours and 48 hours) was performed, and expression levels were measured by MRM using human- and mouse-specific epitopes for OTC.
- Human- and mouse-specific heavy peptides were designed to measure total levels of OTC from both species.
- Graphs represent the amount of protein (ng/mg tissue) detected by MRM specific for human OTC (FIG. 9A) or mouse OTC (FIG. 9B). This data set shows that quantitative levels of human OTC (hOTC) were observed in treated mice that derived from translation of the delivered mRNAs. A high level of quantifiable hOTC protein was seen up to 48 hours.
- Example 8 OTC expression levels measured by western blot in mice dosed at 3 mg/kg.
- Spf/ash mice received an IV injection with either phosphate buffered saline (PBS) or lipid-formulated OTC-mRNAs at a 3 mg/kg dose using two different uridine nucleotide chemistries (NIMPU and 5MeOU).
- PBS phosphate buffered saline
- OTC-mRNAs lipid-formulated OTC-mRNAs at a 3 mg/kg dose using two different uridine nucleotide chemistries (NIMPU and 5MeOU).
- WT mice were used as internal controls to determine endogenous levels. Animals were sacrificed 24 hours post-dose.
- OTC expression levels were measured by Western Blot (WB) using an OTC specific antibody. In the results provided in FIG. 10, the bars represent the percentage of expression relative to WT levels (100%). The data shows that WT levels of total OTC were achieved for several codon-optimized sequences in a mouse background.
- Example 9 OTC expression levels measured by MRM in a dose range-finding study.
- Balb/c mice received an IV injection with either PBS or lipid-formulated OTC-mRNAs at three different doses (0.3 mg/kg, 1 mg/kg and 3mg/kg) and using two different uridine chemistries (NIMPU and 5MeOU). Animals were sacrificed 24 hours post-dose and expression levels were measured by MRM using human and mouse specific epitopes for OTC. MRM was used to quantitatively determine human-specific and mouse-specific OTC protein levels (FIG. 11). The graph in FIG. 11 shows expression of human OTC in Balb/c mice (ng per mg of liver tissue). The horizontal dotted line represents relative mouse OTC levels in Balb/c mice (FIG. 11).
- FIG. 11 Expression levels of human OTC (hOTC) protein for mRNA construct 713 using 5MeOU and mRNA construct 571 using N1MPU are shown in FIG. 11. The data generated in this figure shows that WT levels of human OTC were achieved with the codon- optimized sequences disclosed herein in a dose-dependent manner in a mouse background.
- Example 10 Urinary Orotate levels measured in PBS- and mRNA-treated Spf/ash mice.
- Spf/ash mice received an IV injection with either PBS or lipid-formulated OTC-mRNA construct 1799.7 (5MeOU chemistry) at three different doses: 0.3 mg/kg, 1 mg/kg and 3 mg/kg.
- Urinary orotate levels were determined in untreated wild-type (WT) and both untreated and treated Spf/ash mice.
- a urinary orotate time course was performed in Spf/ash and WT mice, and urinary orotate levels were measured at each timepoint. The results can be seen in FIG. 12.
- Urinary orotate was normalized to creatinine, which is represented in the graph on the y-axis throughout the time course and served as a proof-of-concept of functional restoration of OTC activity post-injection.
- a sustainable reduction of urinary orotate levels was observed for up to 14 days, with reduced urinary orotate levels in treated Spf/ash mice comparable to urinary orotate levels in WT mice.
- Example 11 Pharmacokinetic/Pharmacodynamic (PK/PD) analysis comparing human OTC expression levels and Urinary Orotate at 96 hours post dose.
- PK/PD Pharmacokinetic/Pharmacodynamic
- Spf/ash mice received an IV injection with either PBS or certain lipid- formulated OTC-mRNAs from Table 5 at 1 mg/kg and 3 mg/kg using two different uridine chemistries (N1MPU and 5MeOU). WT mice were used as internal controls. Human-specific OTC levels were measured by MRM, and urinary orotate was determined in each sample and normalized to creatinine. The resultant PK/PD profile is plotted in FIG. 13 and the PK/PD analysis shows the correlation between protein expression levels and reduction of urinary orotate in a compound-specific manner. Construct 1799.7 (5MeOU chemistry) showed a high PK/PD correlation.
- Example 12 Fractioning of Spf/ash mice in vivo samples treated with selected mRNAs.
- Spf/ash mice received an IV injection with either PBS or lipid-formulated (as described in Example 1) OTC-mRNAs at 1 mg/kg and 3 mg/kg.
- WT mice were used as internal controls. Livers were harvested from the mice and sample fractionation was performed on the liver samples, separating the cytosolic and mitochondrial fractions.
- OTC levels were measured by Western Blot (WB) using human specific (hOTC) and crossreactive (crOTC) antibodies (FIG. 14). Cyclooxygenase IV (CoxIV) was used as a mitochondrial control.
- OTC protein expression levels were measured by near-infrared fluorescent imaging systems and normalized to total protein. The WB results indicate differences in OTC expression levels within mitochondrial and cytosolic fractions when the 2016 and 2260 mRNA constructs were delivered in the Spf/ash mice. These results indicate that both compounds can efficiently target the mitochondria.
- Example 13 Plot of the mitochondrial vs cytosolic fractions of Spf/ash mouse samples treated with mRNA constructs 2016 and 2260.
- Spf/ash mice received an IV injection with either PBS or lipid-formulated OTC-mRNAs at 3 mg/kg. WT mice were used as internal controls. Sample fractionation was performed on liver samples harvested from the mice, separating the cytosolic and mitochondrial fractions. OTC levels were measured by Western Blot using a human specific antibody. OTC protein expression levels were measured by near-infrared fluorescent imaging systems and both fractions, normalized to total protein, were plotted (FIG. 15). The plot of protein expression levels shown in FIG. 14 (Example 12) indicates that even though both compounds, 2016 and 2260, deliver similar protein levels in the cytosol, 2260 delivers more human OTC than 2016 in the mitochondria.
- the 2260 compound includes a modified mitochondrial signaling peptide sequence provided herein.
- Example 14 Urinary orotate levels in Spf/ash mice treated with mRNA construct 2260.
- Spf/ash mice received an IV injection with either PBS or lipid-formulated (as described in Example 1) OTC-mRNA at 1 mg/kg and 3 mg/kg. WT mice were included as an internal control. Urinary orotate levels were measured at 0, 1, 3, 7 and 14 days, and levels were normalized to creatinine (FIG. 16). The functional read-out of this assay shows that urinary orotate levels were reduced for up to 14 days with compound 2260 in a dose-dependent manner.
- Spf/ash mice received an IV injection with either PBS or lipid-formulated OTC-mRNA (1799.7) at three doses: 0.3 mg/kg, 1 mg/kg and 3 mg/kg. Mice were fed a high protein diet from day 0 to the end of the study. Treated animals were injected intravenously on days 0, 7, 14, 21 and 28 (indicated by the arrows in the chart in FIG. 17). Survival rates were determined every week. The plot in FIG. 17 summarizes the entire study timeline and the survival rates observed for the different groups. The results show that animals treated with human OTC mRNAs described herein displayed greater survival during a hyperammonemic crisis, suggesting a protective role of OTC mRNAs described herein in detoxifying the animals from toxic ammonia. The survival rate was dose-dependent, and animals treated with a 3 mg/kg dose had a higher survival rate than animals treated at 1 mg/kg or 0.3 mg/kg.
- Example 16 Comparison of hOTC expression levels from mRNAs with different modifications.
- lipid-formulated OTC-mRNA construct 2262 were injected intravenously into 8 to 10 week-old female Balb/c mice at a dose of 1 mg/kg. Different chemistries were used in this study as indicated in the bottom (x) axis of the chart provided in FIG. 18. Mouse livers were harvested at 24 hours post IV-administration, and western blotting was performed using a hOTC specific antibody. Levels were normalized to total protein (FIG. 18). Each construct was formulated as a lipid nanoparticle comprising an ionizable cationic lipid as described in Example 1. This dataset shows the impact of different uridine chemistries on the expression levels of the codon-optimized mRNAs described herein.
- Lipid formulations were prepared as in Example 1 to evaluate ionizable cationic lipids in the lipid formulations for their physicochemical properties: particle size (desired to be 55 to 85 nm), polydispersity index (should not be more than 0.2) and percent encapsulated mRNA (not less than 85%).
- the physicochemical properties of the formulations are summarized in Table 7 below:
- the molar percentage of Lipid # 7 played an important role in the physicochemical properties of the formulation. Most notably, formulations containing 42% of Lipid # 7 had the highest PDI (with two out of three formulations outside of the acceptable range), while formulations containing 58% of Lipid # 7 had the lowest PDI. Conversely, formulations containing 58% of Lipid # 7 had the greatest particle size, but were still within the acceptable range. The percent encapsulated mRNA for all formulations were within the acceptable range, with formulations containing 42% or 50% of Lipid # 7 having slightly higher % encapsulated mRNA.
- Example 18 Comparison of the effect of ionizable cationic lipids on PTC expression in Balb/c Mice.
- Lipid formulations were prepared as in Example 1, using the 571 mRNA construct for each of Lipid # 2, Lipid # 7, Lipid # 8, Lipid # 4, Lipid # 5, and Lipid # 6 to test the dose-dependent effect of these lipids on the expression of hOTC in Balb/c mice.
- Formulations of each of these lipids were administered intravenously to the mice at doses of 0.3 mg/kg, 1.0 mg/kg, and 3.0 mg/kg.
- the expression levels are shown relative to wild-type mouse OTC (mOTC) expression levels in FIG. 19.
- mOTC wild-type mouse OTC
- each of the formulations showed dose-dependent expression, with increasing concentrations of hOTC seen as doses increased.
- the formulations comprising Lipid # 2 and Lipid # 1 showed the greatest levels of hOTC expression, with Lipid # 1 showing about 3 to 4-fold greater expression than Lipid # 2.
- Example 19 Further comparisons of the effect of ionizable cationic lipids on OTC expression.
- lipid formulations were prepared as in Example 1, using the 571 mRNA construct for each of Lipid # 1, Lipid # 2, Lipid # 3, and Lipid # 7 to test the dose- dependent effect of these lipids on the expression of hOTC in Balb/c mice.
- Formulations of each of these lipids were administered intravenously to the mice at doses of 1.0 mg/kg and 3.0 mg/kg. The expressions levels are shown in FIG. 20. As can be seen, there was a dose-related increase in hOTC expression. Lipid # 3 showed an exceptional dose-response as the dose increased, while Lipid # 7 appeared to have only a small dose response.
- Example 20 Survival rate of Spf/ash mice for lipid formulations using different ionizable cationic lipids
- the pharmacology of the OTC mRNA lipid formulations was investigated in studies that elucidated their efficacy and potential mechanism of action in a series of studies in the hemizygous male Spf/ash mouse model. These mice possess a genetic mutation on the X- chromosome (hypomorphic model) that causes abnormal splicing of the endogenous OTC mRNA, resulting in less than 10% of residual OTC enzymatic activity in the liver.
- the hypomorphic Spf/ash mouse shares similar biochemical features with OTCD patients, including elevated concentrations of urinary orotic acid (orotate), blood glutamine, and decreased concentrations of blood citrulline and arginine.
- the hemizygous male Spf/ash mice used in the pharmacology studies were derived by crossing B6EiC3Sn a/A-Otcspfash/J Het mice x B6EiC3SnFl/J mice as homozygous mice are not viable.
- the heterozygous male B6EiC3SnFl/J mice were used as wildtype (WT) controls.
- Spf/ash mice do not typically display severe hyperammonemia and reduced ureagenesis. Acute disruption of their urea acid cycle was induced by a bolus administration of ammonium chloride (NH 4 CI), resulting in hyperammonemia and reduced ureagenesis. In addition, their urea cycle was also stressed by maintaining these mice on a high protein diet (HPD).
- HPD high protein diet
- Treated animals were injected by intravenously on days 0, 7, 14, 21 and 28 (indicated by the dashed lines in the charts in FIGS. 21-23). Survival rates were determined daily. The plots in FIGS. 21-23 summarize the entire study timeline and the survival rates observed for the different groups. The results show that animals treated with human OTC mRNAs described herein displayed greater survival during a hyperammonemic crisis, suggesting a protective role of OTC mRNAs described herein in detoxifying the animals from toxic ammonia. The survival rate was dose-dependent.
- Lipid # 7 was the most efficacious in prolonging survival, followed by Lipid # 3, then Lipid # 2. For the 3.0 mg/kg level, Lipid # 3 was more efficacious than Lipid # 2.
- lipid formulations as prepared in Example 1 using mRNA construct 1799.7 and either Lipid # 2, Lipid # 3, or Lipid # 1 were tested in CD-I mice at high dosages. All animals received an intravenous bolus treatment at a dosing volume of 10 mL/kg, once a week on Day 0, Day 7, Day 14, Day 21, and Day 28 of the study. Animals were observed daily for morbidity and mortality and body weights were determined twice weekly. Blood was collected from all animals for the measurement of ALT, AST and serum cytokines at 6 hours after the first and last dose.
- Animals were terminated 72 hours after the final dose (Day 31) for gross observation, measurement of whole body and organ weights (liver and spleen), tissue collection for histopathology (liver, kidney, spleen, heart and lung) and blood collection for analysis of cytokines, hematology and clinical chemistry.
- FIG. 24 shows the dose-dependent effect of OTC mRNA lipid formulation treatment on survival rate after multiple dose administrations.
- a 100% survival rate was observed at the 3 mg/kg dose level for both Lipid # 3 and Lipid # 2 and at 1 mg/kg for Lipid # 7 (in both genders). Males appeared to be more sensitive than females for Lipid # 3 and Lipid # 2, with 100% mortality observed in the Lipid # 2 10 mg/kg male group. Furthermore, mortality was observed at the 10 mg/kg dose level for Lipid # 3 and Lipid # 2, and at the 3 mg/kg dose level for Lipid # 7. At 10 mg/kg, Lipid # 3 was better tolerated than Lipid # 2. Data resulting from this study suggested a ranking of Lipid # 3 > Lipid # 2 > Lipid # 7 for tolerability.
- Serum cytokines were evaluated both at 6 hours after the first and final dose and 72 hours after the final dose. Significant dose-dependent increases (for some cytokines > 100-fold) were observed 6 hours after the first and final dose for TNF-a, ILl-b, IFNy, MCP-1, IL-6, and IFNa for all lipid-formulated OTC mRNA-treated animals that returned to baseline 72 hours after the final dose, with the exception of TNF-a and IFNy for Lipid # 7 at 3 mg/kg. While there were other changes observed at the 72-hour post dose time point, due to variability within the dose group and a lack of dose dependency, they were not attributed to the administration of the OTC mRNA formulation.
- Lipid # 1 The highest level of Lipid # 1 was observed in the liver, with a ranking of liver > spleen > plasma > kidney. In the plasma, Lipid # 1 was no longer detected by 14 days post dose. By 28 days post-dose (the last time point evaluated), Lipid # 7 was detected at a concentration of 18,433 pg/mL in the spleen, 17,233 pg/mL in the liver and 2,340 pg/mL in the kidney. The half-life for Lipid # 7 was determined to be 57 hours for plasma, 84 hours for liver, and 234 hours for kidney. Tissue half-life of Lipid # 7 could not be determined for the spleen.
- mice received a single intravenous bolus treatment of 1 mg/kg of the Lipid # 3 formulation at a dosing volume of 10 mL/kg.
- Lipid # 3 The highest level of Lipid # 3 was observed in the liver, with a ranking of liver > plasma > spleen > kidney > lung > heart > brain. In the plasma, Lipid # 3 was no longer detected by 4 hours post-dose. Lipid # 3 was not detected in brain tissue at either time point post-dose. Lipid # 3 T ma x occurred at 0.033 to 1 hour post-dose in kidney, 0.033 to 1-hour post dose in liver, and 1 to 2 hours post-dose in spleen. Because only two time points were assessed for heart and lung, the Tmax of Lipid # 3 could not be determined.
- MLFNLRILLNN AAFRN GHNFM VRNFRC GQPLQNK V QLKGRDLLTLKNF T GEEIK YMLW LSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLG VNESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPnNGLSDLYHPIQILADYLTLQ EHY S SLKGLTLS WIGDGNNILHSIMMS AAKF GMHLQ AATPKGYEPD AS VTKLAEQ Y AK ENGTKLLLTNDPLE AAHGGNVLITDTWISMGQEEEKKKRLQ AFQGY Q VTMKT AK VA A SDWTFLHCLPRKPEEVDDEVF Y SPRSLVFPEAENRKWTIMAVM V SLLTD Y SPQLQKPKF
- TEV (SEQ ID NO: 5)
- AT1G58420 (SEQ ID NO: 6)
- HCV (SEQ ID NO: 8)
- HSP70-P2 (SEQ ID NO: 11)
- HSP70-P1 (SEQ ID NO: 15)
- a ACUUC ACC GGAGA AGAGAU C A AGU AC AU GCU GU GGCU C AGC GC AGACUU GA AG
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Dispersion Chemistry (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Emergency Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP21763861.8A EP4114470A4 (en) | 2020-03-03 | 2021-03-03 | COMPOSITIONS AND METHODS FOR TREATING ORNITHINE TRANSCARBAMYLASE DEFICIENCY |
| CA3169889A CA3169889A1 (en) | 2020-03-03 | 2021-03-03 | Compositions and methods for the treatment of ornithine transcarbamylase deficiency |
| AU2021231795A AU2021231795A1 (en) | 2020-03-03 | 2021-03-03 | Compositions and methods for the treatment of ornithine transcarbamylase deficiency |
| JP2022552798A JP7832114B2 (ja) | 2020-03-03 | 2021-03-03 | オルニチントランスカルバミラーゼ欠損症の治療のための組成物及び方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202062984764P | 2020-03-03 | 2020-03-03 | |
| US62/984,764 | 2020-03-03 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021178510A1 true WO2021178510A1 (en) | 2021-09-10 |
Family
ID=77613705
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/020634 Ceased WO2021178510A1 (en) | 2020-03-03 | 2021-03-03 | Compositions and methods for the treatment of ornithine transcarbamylase deficiency |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US12351834B2 (https=) |
| EP (1) | EP4114470A4 (https=) |
| JP (1) | JP7832114B2 (https=) |
| AU (1) | AU2021231795A1 (https=) |
| CA (1) | CA3169889A1 (https=) |
| WO (1) | WO2021178510A1 (https=) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11591544B2 (en) | 2020-11-25 | 2023-02-28 | Akagera Medicines, Inc. | Ionizable cationic lipids |
| WO2023118450A1 (en) * | 2021-12-23 | 2023-06-29 | Etherna Immunotherapies Nv | METHOD FOR LARGE-SCALE PRODUCTION OF LARGE-SIZED LNPs |
| US12064479B2 (en) | 2022-05-25 | 2024-08-20 | Akagera Medicines, Inc. | Lipid nanoparticles for delivery of nucleic acids and methods of use thereof |
| US12398379B2 (en) | 2018-12-06 | 2025-08-26 | Arcturus Therapeutics, Inc. | Compositions and methods for treating ornithine transcarbamylase deficiency |
| US20250339480A1 (en) * | 2021-04-21 | 2025-11-06 | Jichi Medical University | Adeno-associated virus virion for treating ornithine transcarbamylase deficiency |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10383952B2 (en) | 2016-12-21 | 2019-08-20 | Arcturus Therapeutics, Inc. | Ionizable cationic lipid for RNA delivery |
| WO2021183563A1 (en) | 2020-03-09 | 2021-09-16 | Arcturus Therapeutics, Inc. | Coronavirus vaccine compositions and methods |
| US12178921B2 (en) | 2020-08-14 | 2024-12-31 | Arcturus Therapeutics, Inc. | Method of lyophilizing lipid nanoparticles |
| CN116087165B (zh) * | 2022-12-22 | 2023-07-28 | 南京林业大学 | 一种简单快速检测mtc和/或otc和/或tc的方法 |
| WO2025053636A1 (ko) * | 2023-09-05 | 2025-03-13 | 한국생명공학연구원 | 지질 나노 입자를 이용한 핵산 전달 시스템 |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070196334A1 (en) * | 2003-06-25 | 2007-08-23 | Shaharyar Khan | Modified vectors for organelle transfection |
| WO2018119163A1 (en) * | 2016-12-21 | 2018-06-28 | Payne Joseph E | Ionizable cationic lipid for rna delivery |
| US20190002906A1 (en) * | 2017-05-31 | 2019-01-03 | Arcturus Therapeutics, Inc. | Synthesis and structure of high potency rna therapeutics |
| US20190192688A1 (en) * | 2017-12-20 | 2019-06-27 | Translate Bio, Inc. | Composition and Methods for Treatment of Ornithine Transcarbamylase Deficiency |
| US20200181584A1 (en) * | 2018-12-06 | 2020-06-11 | Arcturus Therapeutics, Inc. | Compositions and methods for treating ornithine transcarbamylase deficiency |
| US20200297634A1 (en) * | 2019-03-19 | 2020-09-24 | Arcturus Therapeutics, Inc. | Method of making lipid-encapsulated rna nanoparticles |
Family Cites Families (57)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP3257675B2 (ja) | 1990-10-12 | 2002-02-18 | マックス−プランク−ゲゼルシャフト ツール フェルデルング デル ビッセンシャフテン エー.ファウ. | 修飾リボザイム |
| US5652094A (en) | 1992-01-31 | 1997-07-29 | University Of Montreal | Nucleozymes |
| ATE490267T1 (de) | 2001-06-05 | 2010-12-15 | Curevac Gmbh | Stabilisierte mrna mit erhöhtem g/c-gehalt, kodierend für ein virales antigen |
| EP1687017B1 (en) | 2003-10-24 | 2013-03-06 | Gencia Corporation | Methods and compositions for delivering polynucleotides |
| EP3611266B1 (en) | 2005-08-23 | 2022-11-09 | The Trustees of the University of Pennsylvania | Rna containing modified nucleosides and methods of use thereof |
| EP2049665A2 (en) | 2006-07-28 | 2009-04-22 | Applera Corporation | Dinucleotide mrna cap analogs |
| WO2009058911A2 (en) | 2007-10-31 | 2009-05-07 | Applied Biosystems Inc. | Preparation and isolation of 5' capped mrna |
| WO2009082817A1 (en) | 2007-12-27 | 2009-07-09 | Protiva Biotherapeutics, Inc. | Silencing of polo-like kinase expression using interfering rna |
| WO2009086558A1 (en) | 2008-01-02 | 2009-07-09 | Tekmira Pharmaceuticals Corporation | Improved compositions and methods for the delivery of nucleic acids |
| AU2009238175C1 (en) | 2008-04-15 | 2023-11-30 | Arbutus Biopharma Corporation | Novel lipid formulations for nucleic acid delivery |
| WO2010037408A1 (en) | 2008-09-30 | 2010-04-08 | Curevac Gmbh | Composition comprising a complexed (m)rna and a naked mrna for providing or enhancing an immunostimulatory response in a mammal and uses thereof |
| CN104119242B (zh) | 2008-10-09 | 2017-07-07 | 泰米拉制药公司 | 改善的氨基脂质和递送核酸的方法 |
| WO2010048536A2 (en) | 2008-10-23 | 2010-04-29 | Alnylam Pharmaceuticals, Inc. | Processes for preparing lipids |
| HUE037082T2 (hu) | 2008-11-10 | 2018-08-28 | Arbutus Biopharma Corp | Új lipidek és készítmények terápiás hatóanyagok szállítására |
| EP3243504A1 (en) | 2009-01-29 | 2017-11-15 | Arbutus Biopharma Corporation | Improved lipid formulation |
| KR20180094137A (ko) | 2009-05-05 | 2018-08-22 | 알닐람 파마슈티칼스 인코포레이티드 | 지질 조성물 |
| MX342785B (es) | 2009-06-10 | 2016-10-12 | Alnylam Pharmaceuticals Inc | Formulacion mejorada de lipido. |
| HUE042177T2 (hu) | 2009-12-01 | 2019-06-28 | Translate Bio Inc | Szteroidszármazék mRNS szállítására humán genetikai betegségekben |
| SG186085A1 (en) | 2010-06-03 | 2013-01-30 | Alnylam Pharmaceuticals Inc | Biodegradable lipids for the delivery of active agents |
| WO2012000104A1 (en) | 2010-06-30 | 2012-01-05 | Protiva Biotherapeutics, Inc. | Non-liposomal systems for nucleic acid delivery |
| PL3586861T3 (pl) | 2011-06-08 | 2022-05-23 | Translate Bio, Inc. | Kompozycje nanocząstek lipidowych i sposoby dostarczania mrna |
| RU2648950C2 (ru) | 2011-10-03 | 2018-04-02 | Модерна Терапьютикс, Инк. | Модифицированные нуклеозиды, нуклеотиды и нуклеиновые кислоты и их применение |
| EP4721752A2 (en) | 2011-12-30 | 2026-04-08 | Cellscript, Llc | Herstellung und verwendung von in vitro-synthetisierter ssrna zur einführung in säugetierzellen zur induktion einer biologischen oder biochemischen wirkung |
| US9254311B2 (en) | 2012-04-02 | 2016-02-09 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins |
| US20140090108A1 (en) | 2012-09-18 | 2014-03-27 | Freydoun Garabagi | Vectors and Methods For Enhancing Recombinant Protein Expression in Plants |
| WO2014093924A1 (en) | 2012-12-13 | 2014-06-19 | Moderna Therapeutics, Inc. | Modified nucleic acid molecules and uses thereof |
| WO2014130722A1 (en) | 2013-02-20 | 2014-08-28 | Valerion Therapeutics, Llc | Methods and compositions for treatment of forbes-cori disease |
| US20160022840A1 (en) | 2013-03-09 | 2016-01-28 | Moderna Therapeutics, Inc. | Heterologous untranslated regions for mrna |
| US8912147B2 (en) | 2013-04-15 | 2014-12-16 | BioBlast Pharma Ltd. | Mitochondrial proteins constructs and uses thereof |
| EP3027221A1 (en) | 2013-07-30 | 2016-06-08 | PhaseRx, Inc. | Block copolymers and their conjugates or complexes with oligonucleotides |
| WO2015051169A2 (en) | 2013-10-02 | 2015-04-09 | Moderna Therapeutics, Inc. | Polynucleotide molecules and uses thereof |
| EA034103B1 (ru) | 2013-10-22 | 2019-12-27 | Транслейт Био, Инк. | СПОСОБ ЛЕЧЕНИЯ ФЕНИЛКЕТОНУРИИ С ПРИМЕНЕНИЕМ мРНК |
| US9593077B2 (en) | 2013-11-18 | 2017-03-14 | Arcturus Therapeutics, Inc. | Ionizable cationic lipid for RNA delivery |
| RS60902B1 (sr) | 2014-03-09 | 2020-11-30 | Univ Pennsylvania | Kompozicije korisne u lečenju nedostatka ornitinske transkarbamilaze (otc) |
| US10202591B2 (en) | 2014-06-13 | 2019-02-12 | Valerion Therapeutics, Llc | Methods and compositions for treatment of glycogen storage diseases and glycogen metabolism disorders |
| AU2015338923B2 (en) | 2014-11-02 | 2021-10-21 | Arcturus Therapeutics, Inc. | Messenger UNA molecules and uses thereof |
| EP3461904A1 (en) | 2014-11-10 | 2019-04-03 | ModernaTX, Inc. | Alternative nucleic acid molecules containing reduced uracil content and uses thereof |
| WO2016077123A1 (en) | 2014-11-10 | 2016-05-19 | Moderna Therapeutics, Inc. | Multiparametric nucleic acid optimization |
| KR102380363B1 (ko) | 2014-11-18 | 2022-03-29 | 아크투루스 쎄라퓨틱스, 인크. | Rna 전달을 위한 이온성 양이온 지질 |
| US9709490B2 (en) | 2014-12-08 | 2017-07-18 | Canon Kabushiki Kaisha | Refractive index distribution measuring method, refractive index distribution measuring apparatus, and optical element manufacturing method |
| US11219634B2 (en) * | 2015-01-21 | 2022-01-11 | Genevant Sciences Gmbh | Methods, compositions, and systems for delivering therapeutic and diagnostic agents into cells |
| EP3328439B1 (en) | 2015-07-31 | 2020-04-08 | Arcturus Therapeutics, Inc. | Multiligand agent for drug delivery |
| ES2964690T3 (es) | 2015-09-21 | 2024-04-09 | Trilink Biotechnologies Llc | Método para sintetizar ARN con caperuza 5' |
| US11389546B2 (en) | 2015-12-09 | 2022-07-19 | Modernatx, Inc. | Heterologous UTR sequences for enhanced mRNA expression |
| US9834510B2 (en) | 2015-12-30 | 2017-12-05 | Arcturus Therapeutics, Inc. | Aromatic ionizable cationic lipid |
| CA3027312A1 (en) * | 2016-06-13 | 2017-12-21 | Translate Bio, Inc. | Messenger rna therapy for the treatment of ornithine transcarbamylase deficiency |
| US10576167B2 (en) | 2016-08-17 | 2020-03-03 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US10487105B2 (en) | 2016-10-19 | 2019-11-26 | Arcturus Therapeutics, Inc. | Trinucleotide MRNA cap analogs |
| BR112019008481A2 (pt) | 2016-10-26 | 2020-03-03 | Curevac Ag | Vacinas de mrna de nanopartículas lipídicas |
| MA46761A (fr) * | 2016-11-10 | 2019-09-18 | Translate Bio Inc | Administration sous-cutanée d'arn messager |
| US10526284B2 (en) | 2016-12-21 | 2020-01-07 | Arcturus Therapeutics, Inc. | Ionizable cationic lipid for RNA delivery |
| US10383952B2 (en) | 2016-12-21 | 2019-08-20 | Arcturus Therapeutics, Inc. | Ionizable cationic lipid for RNA delivery |
| EP3565605A1 (en) | 2017-01-03 | 2019-11-13 | ethris GmbH | Ornithine transcarbamylase coding polyribonucleotides and formulations thereof |
| US10227302B2 (en) | 2017-02-09 | 2019-03-12 | Arcturus Therapeutics, Inc. | Ionizable cationic lipid for RNA delivery |
| WO2018160592A1 (en) | 2017-02-28 | 2018-09-07 | Arcturus Therapeutics, Inc. | Translatable molecules and synthesis thereof |
| WO2018222926A1 (en) | 2017-05-31 | 2018-12-06 | Ultragenyx Pharmaceutical Inc. | Therapeutics for glycogen storage disease type iii |
| EP3714048B1 (en) * | 2017-11-22 | 2025-04-09 | ModernaTX, Inc. | Polynucleotides encoding ornithine transcarbamylase for the treatment of urea cycle disorders |
-
2021
- 2021-03-03 JP JP2022552798A patent/JP7832114B2/ja active Active
- 2021-03-03 AU AU2021231795A patent/AU2021231795A1/en active Pending
- 2021-03-03 EP EP21763861.8A patent/EP4114470A4/en active Pending
- 2021-03-03 US US17/191,247 patent/US12351834B2/en active Active
- 2021-03-03 WO PCT/US2021/020634 patent/WO2021178510A1/en not_active Ceased
- 2021-03-03 CA CA3169889A patent/CA3169889A1/en active Pending
-
2024
- 2024-10-08 US US18/909,701 patent/US20250136953A1/en active Pending
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070196334A1 (en) * | 2003-06-25 | 2007-08-23 | Shaharyar Khan | Modified vectors for organelle transfection |
| WO2018119163A1 (en) * | 2016-12-21 | 2018-06-28 | Payne Joseph E | Ionizable cationic lipid for rna delivery |
| US20190002906A1 (en) * | 2017-05-31 | 2019-01-03 | Arcturus Therapeutics, Inc. | Synthesis and structure of high potency rna therapeutics |
| US20190192688A1 (en) * | 2017-12-20 | 2019-06-27 | Translate Bio, Inc. | Composition and Methods for Treatment of Ornithine Transcarbamylase Deficiency |
| US20200181584A1 (en) * | 2018-12-06 | 2020-06-11 | Arcturus Therapeutics, Inc. | Compositions and methods for treating ornithine transcarbamylase deficiency |
| US20200297634A1 (en) * | 2019-03-19 | 2020-09-24 | Arcturus Therapeutics, Inc. | Method of making lipid-encapsulated rna nanoparticles |
Non-Patent Citations (2)
| Title |
|---|
| PRIEVE ET AL.: "Targeted mRNA Therapy for Ornithine Transcarbamylase Deficiency", MOLECULAR THERAPY, vol. 26, no. 3, 3 January 2018 (2018-01-03), pages 801 - 813, XP055568760, DOI: 10.1016/j.ymthe.2017.12.024 * |
| See also references of EP4114470A4 * |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12398379B2 (en) | 2018-12-06 | 2025-08-26 | Arcturus Therapeutics, Inc. | Compositions and methods for treating ornithine transcarbamylase deficiency |
| US11591544B2 (en) | 2020-11-25 | 2023-02-28 | Akagera Medicines, Inc. | Ionizable cationic lipids |
| US12077725B2 (en) | 2020-11-25 | 2024-09-03 | Akagera Medicines, Inc. | Ionizable cationic lipids |
| US12331264B2 (en) | 2020-11-25 | 2025-06-17 | Akagera Medicines, Inc. | Lipid nanoparticles for delivery of nucleic acids and methods of use thereof |
| US12606773B2 (en) | 2020-11-25 | 2026-04-21 | Akagera Medicines, Inc. | Ionizable cationic lipids |
| US20250339480A1 (en) * | 2021-04-21 | 2025-11-06 | Jichi Medical University | Adeno-associated virus virion for treating ornithine transcarbamylase deficiency |
| WO2023118450A1 (en) * | 2021-12-23 | 2023-06-29 | Etherna Immunotherapies Nv | METHOD FOR LARGE-SCALE PRODUCTION OF LARGE-SIZED LNPs |
| US12064479B2 (en) | 2022-05-25 | 2024-08-20 | Akagera Medicines, Inc. | Lipid nanoparticles for delivery of nucleic acids and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| US20210284974A1 (en) | 2021-09-16 |
| US20250136953A1 (en) | 2025-05-01 |
| AU2021231795A1 (en) | 2022-10-06 |
| JP7832114B2 (ja) | 2026-03-17 |
| CA3169889A1 (en) | 2021-09-10 |
| EP4114470A1 (en) | 2023-01-11 |
| US12351834B2 (en) | 2025-07-08 |
| JP2023516676A (ja) | 2023-04-20 |
| EP4114470A4 (en) | 2024-04-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12351834B2 (en) | Compositions and methods for the treatment of ornithine transcarbamylase deficiency | |
| US12070509B2 (en) | Nucleic acids and methods of treatment for cystic fibrosis | |
| AU2020200489B2 (en) | Stereochemically enriched compositions for delivery of nucleic acids | |
| JP6620093B2 (ja) | メッセンジャーrnaを送達するための組成物及び方法 | |
| US20230159449A1 (en) | Lipid formulations containing nucleic acids and methods of treatment for cystic fibrosis | |
| US12398379B2 (en) | Compositions and methods for treating ornithine transcarbamylase deficiency | |
| US20230323345A1 (en) | Una oligomers for the treatment of polyglutamine diseases | |
| US20230227826A1 (en) | Una oligomers for the treatment of polyglutamine diseases | |
| US20220220189A1 (en) | Compositions and methods for treatment of hemochromatosis |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21763861 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3169889 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022552798 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021231795 Country of ref document: AU Date of ref document: 20210303 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2021763861 Country of ref document: EP Effective date: 20221004 |