WO2021161262A1 - TREATMENT OF PATIENTS HAVING c-MET EXON 14 SKIPPING MUTATIONS - Google Patents
TREATMENT OF PATIENTS HAVING c-MET EXON 14 SKIPPING MUTATIONS Download PDFInfo
- Publication number
- WO2021161262A1 WO2021161262A1 PCT/IB2021/051203 IB2021051203W WO2021161262A1 WO 2021161262 A1 WO2021161262 A1 WO 2021161262A1 IB 2021051203 W IB2021051203 W IB 2021051203W WO 2021161262 A1 WO2021161262 A1 WO 2021161262A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- egfr
- met
- seq
- inhibitor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/53—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with three nitrogens as the only ring hetero atoms, e.g. chlorazanil, melamine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
- C12Q1/6886—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5752—Immunoassay; Biospecific binding assay; Materials therefor for cancer of the lungs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/106—Pharmacogenomics, i.e. genetic variability in individual responses to drugs and drug metabolism
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/156—Polymorphic or mutational markers
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/71—Assays involving receptors, cell surface antigens or cell surface determinants for growth factors; for growth regulators
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/82—Translation products from oncogenes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- the present invention relates to treatment of subjects having c-Met exon 14 skipping mutations.
- Both receptors signal through the same survival and anti-apoptotic pathways (ERK and AKT); thus, inhibiting the pair in combination may limit the potential for compensatory pathway activation thereby improving overall efficacy.
- Mutations in c-Met are associated with a number of cancers, including renal, gastric, nervous system, sarcomas, and lung cancer. Mutations that result in higher activity or expression, or deletion of negative regulation sites are often implicated in these cancers. For example, deletion of exon 14 and the negative regulation site at Tyr 1003 is associated with a significant percentage of non-small cell lung cancers (NSCLC) and adenocarcinomas.
- NSCLC non-small cell lung cancers
- the disclosure provides a method of treating a subject having cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody to the subject having cancer that is positive for c-Met exon 14 skipping mutation.
- EGFR bispecific anti-epidermal growth factor receptor
- c-Met hepatocyte growth factor receptor
- the disclosure also provides a method treating a subject having cancer with a bispecific anti-EGFR/c-Met antibody, comprising: providing a biological sample from the subject; determining presence or absence of a c-Met exon 14 skipping mutation in the sample; administering or providing for administration the bispecific anti-EGFR/c-Met antibody to the subject determined to have c-Met exon 14 skipping mutation.
- the disclosure also provides a method of treating a subject having cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody to the subject having cancer that is positive for c-Met exon 14 skipping mutation.
- EGFR bispecific anti-epidermal growth factor receptor
- c-Met hepatocyte growth factor receptor
- the disclosure provides a method for treating a subject having cancer with a bispecific anti-EGFR c-Met antibody, comprising: a) providing a biological sample from the subject; b) determining presence or absence of a c-Met exon 14 skipping mutation in the sample; c) administering or providing for administration the bispecific anti-EGFR c- Met antibody to the subject determined to have c-Met exon 14 skipping mutation.
- the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDRl) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 a second domain that binds c-Met, wherein the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10, the LCDR2 of SEQ ID NO: 11 and the LCDR3 of SEQ ID NO: 12.
- HCDR1 heavy chain complementarity determining region 1
- the first domain that specifically binds EGFR comprises a heavy chain variable region (VH) of SEQ ID NO: 13 and a light chain variable region (VL) of SEQ ID NO: 14, and the second domain that specifically binds c-Met comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the bispecific anti-EGFR/c-Met antibody is an IgGl isotype.
- the bispecific anti-EGFR/c-Met antibody comprises a first heavy chain (HC1) of SEQ ID NO: 17, a first light chain (LC1) of SEQ ID NO: 18, a second heavy chain (HC2) of SEQ ID NO: 19 and a second light chain (LC2) of SEQ ID NO: 20.
- the bispecific anti-EGFR c-Met antibody comprises a biantennary glycan structure with a fucose content of about between 1% to about 15%.
- the subject is relapsed or resistant to treatment with one or more prior anti-cancer therapies.
- the one or more prior anti-cancer therapies comprises one or more chemotherapeutic agents, checkpoint inhibitors, targeted anti-cancer therapies or kinase inhibitors, or any combination thereof.
- the one or more prior anti-cancer thearpies comprises carboplatin, paclitaxel, gemcitabine, cisplatin, vinorelbine, docetaxel, palbociclib, crizotinib, PD-(L)1 axis inhibitor, an inhibitor of EGFR, an inhibitor of c-Met, an inhibitor of HER2, an inhibitor of HER3 , an inhibitor of HER4, an inhibitor of VEGFR, an inhibitor of AXL, erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, capmatinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitinib, or any combination thereof
- the subject is treatment naive.
- cancer that is positive for c-Met exon 14 skipping mutation is positive for CDK4 amplification, EGFR amplification, KRAS amplification, MDM2 amplification, TERT amplification, NF1 R2450*; RAD50 L597Vfs*5, MET c.3082 +3 A>G, EGFR, wild-type EGFR, an EGFR activating mutation, increased levels of circulating HGF, c-MET amplification or a mutant KRAS, or any combination thereof.
- the EGFR activating mutation comprises L718Q, G719A, G719X (X being any amino acid), L861X (X being any amino acid), L858R, E746K, L747S, E749Q, A750P, A755V, V765M, C797S, L858P or T790M substitution, deletion of E746-A750, deletion of R748-P753, insertion of Ala (A) between M766 and A767, insertion of Ser, Val and Ala (SVA) between S768 and V769, insertion of Asn and Ser (NS) between P772 and H773, insertion of one or more amino acids between D761 and E762, A763 and Y764, Y764 and Y765, M766 and A767, A767 and V768, S768 and V769, V769 and D770, D770 and N771, N771 and P772, P772 and H773, H773 and
- the mutant KRAS comprises a G12V, G12C, G12A or G12D substitution, or any combination thereof.
- the cancer is lung cancer, gastric cancer, colorectal cancer, brain cancer, cancer derived from epithelial cells, breast cancer, ovarian cancer, colorectal cancer, anal cancer, prostate cancer, kidney cancer, bladder cancer, head and neck cancer, pharynx cancer, cancer of the nose, pancreatic cancer, skin cancer, oral cancer, cancer of the tongue, esophageal cancer, vaginal cancer, cervical cancer, cancer of the spleen, testicular cancer, gastric cancer, cancer of the thymus, colon cancer, thyroid cancer, liver cancer, hepatocellular carcinoma (HCC) or sporadic or hereditary papillary renal cell carcinoma (PRCC), or any combination thereof.
- HCC hepatocellular carcinoma
- PRCC hereditary papillary renal cell carcinoma
- the lung cancer is non-small cell lung cancer (NSCLC), small cell lung cancer (SCLC) or lung adenocarcinoma, pulmonary sarcomatoid carcinoma or any combination thereof.
- NSCLC non-small cell lung cancer
- SCLC small cell lung cancer
- lung adenocarcinoma pulmonary sarcomatoid carcinoma or any combination thereof.
- the method comprises further administering one or more anticancer therapies to the subject.
- the one or more anti-cancer therapies comprise chemotherapy, radiation therapy, surgery, a targeted anti-cancer therapy or a kinase inhibitor, or any combination thereof.
- the kinase inhibitor is an inhibitor of EGFR, an inhibitor of c- Met, an inhibitor of HER2, an inhibitor of HER3, an inhibitor of HER4, an inhibitor of VEGFR or an inhibitor of AXL.
- the kinase inhibitor is erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, capmatinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitinib.
- the c-Met exon 14 skipping mutation is a de novo mutation.
- the c-Met exon 14 skipping mutation is an acquired mutation.
- the bispecific anti-EGFR/c-Met antibody is administered at a dose of between about 140 mg to about 1750 mg. In one embodiment the bispecific anti-EGFR c-Met antibody is administered at a dose of about 700 mg, about 750 mg, about 800 mg, about 850 mg, 900 mg, 950 mg, 1000 mg, 1050 mg, 1100 mg, 1150 mg, 1200 mg, 1250 mg, 1300 mg, 1350 mg or 1400 mg.
- the bispecific anti-EGFR c-Met antibody is administered twice a week, once a week, once in two weeks, once in three weeks or once in four weeks.
- An embodiment of the disclosure provides a method of treating a subject having cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering to the subject a combination therapy, wherein the combination therapy comprises a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFRj/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (II)
- EGFRj/hepatocyte growth factor receptor (c-Met) antibody a therapeutically effective amount of a compound of formula (II)
- the bispecific anti-EGFR/c-Met antibody comprises a first domain that binds EGFR comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 and a second domain that binds c-Met comprising the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10, the LCDR2 of SEQ ID NO: 11 and the LCDR3 of SEQ ID NO: 12.
- the first domain that binds EGFR comprises a heavy chain variable region (VH) of SEQ ID NO: 13 and a light chain variable region (VL) of SEQ ID NO: 14 and the second domain that binds c-Met comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the bispecific anti-EGFR/c-Met antibody is an IgGl isotype.
- the bispecific anti-EGFR c-Met antibody comprises a first heavy chain (HC1) of SEQ ID NO: 17, a first light chain (LC1) of SEQ ID NO: 18, a second heavy chain (HC2) of SEQ ID NO: 19 and a second light chain (LC2) of SEQ ID NO: 20.
- the bispecific anti-EGFR/c-Met antibody has a biantennary glycan structure with a fucose content of between about 1% to about 15%.
- the compound of formula (II) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is 2-Fluoro-N-methyl-4-[7-(quinolin-6- ylmethyl)imidazo [ 1 ,2-b] [ 1 ,2, 4]triazin-2-yl]benzamide— hydrogen chloride— water (1/2/1).
- the subject is relapsed or resistant to treatment with one or more prior anti-cancer therapies.
- the one or more prior anti-cancer therapies comprises one or more chemotherapeutic agents, checkpoint inhibitors, targeted anti-cancer therapies or kinase inhibitors, or any combination thereof.
- the one or more prior anti-cancer thearpies comprises carboplatin, paclitaxel, gemcitabine, cisplatin, vinorelbine, docetaxel, palbociclib, crizotinib, PD-(L)1 axis inhibitor, an inhibitor of EGFR, an inhibitor of c-Met, an inhibitor of HER2, an inhibitor of HER3, an inhibitor of HER4, an inhibitor of VEGFR, an inhibitor of AXL, erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitinib, or any combination thereof.
- the subject is treatment naive.
- cancer that is positive for c-Met exon 14 skipping mutation is positive for CDK4 amplification, EGFR amplification, KRAS amplification, MDM2 amplification, TERT amplification, NF1 R2450*; RAD50 L597Vfs*5, MET c.3082 +3A>G, EGFR, wild-type EGFR, an EGFR activating mutation, increased levels of circulating HGF, c-MET amplification or a mutant KRAS, or any combination thereof.
- the EGFR activating mutation comprises L718Q, G719A, G719X (X being any amino acid), L861X (X being any amino acid), L858R, E746K, L747S, E749Q, A750P, A755V, V765M, C797S, L858P or T790M substitution, deletion of E746-A750, deletion of R748-P753, insertion of Ala (A) between M766 and A767, insertion of Ser, Val and Ala (SVA) between S768 and V769, insertion of Asn and Ser (NS) between P772 and H773, insertion of one or more amino acids between D761 and E762, A763 and Y764, Y764 and Y765, M766 and A767, A767 and V768, S768 and V769, V769 and D770, D770 and N771, N771 and P772, P772 and H773, H773 and
- the cancer is lung cancer, gastric cancer, colorectal cancer, brain cancer, cancer derived from epithelial cells, breast cancer, ovarian cancer, colorectal cancer, anal cancer, prostate cancer, kidney cancer, bladder cancer, head and neck cancer, pharynx cancer, cancer of the nose, pancreatic cancer, skin cancer, oral cancer, cancer of the tongue, esophageal cancer, vaginal cancer, cervical cancer, cancer of the spleen, testicular cancer, gastric cancer, cancer of the thymus, colon cancer, thyroid cancer, liver cancer, hepatocellular carcinoma (HCC) or sporadic or hereditary papillary renal cell carcinoma (PRCC), or any combination thereof.
- HCC hepatocellular carcinoma
- PRCC hereditary papillary renal cell carcinoma
- lung cancer is non-small cell lung cancer (NSCLC), small cell lung cancer (SCLC) or lung adenocarcinoma, pulmonary sarcomatoid carcinoma or any combination thereof.
- NSCLC non-small cell lung cancer
- SCLC small cell lung cancer
- lung adenocarcinoma pulmonary sarcomatoid carcinoma or any combination thereof.
- the method comprises further administering one or more anticancer therapies to the subject.
- the one or more anti-cancer therapies comprises chemotherapy, radiation therapy, surgery, a targeted anti-cancer therapy or a kinase inhibitor, or any combination thereof.
- the kinase inhibitor is an inhibitor of EGFR, an inhibitor of c- Met, an inhibitor of HER2, an inhibitor of HER3, an inhibitor of HER4, an inhibitor of VEGFR or an inhibitor of AXL.
- the kinase inhibitor is erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, capmatinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitinib.
- the c-Met exon 14 skipping mutation is a de novo mutation.
- the c-Met exon 14 skipping mutation is an acquired mutation.
- the bispecific anti-EGFR/c-Met antibody is administered at a dose of between about 140 mg to about 1750 mg.
- the bispecific anti-EGFR/c-Met antibody is administered at a dose of about 700 mg, about 750 mg, about 800 mg, about 850 mg, 900 mg, 950 mg, 1000 mg, 1050 mg, 1100 mg, 1150 mg, 1200 mg, 1250 mg, 1300 mg, 1350 mg or 1400 mg.
- the bispecific anti-EGFR c-Met antibody is administered twice a week, once a week, once in two weeks, once in three weeks or once in four weeks.
- FIG. 1 shows efficacy of EGFR/c-Met antibody (JNJ-372) in a tumor model harboring c-Met exon 14 skipping mutation. Shrinkage of tumors were evident in JNJ-372 treated mice whereas tumors expanded in erlotinib or cetuximab treated animals.
- FIG. 2 shows a CT scan at baseline (top panel), at 6 weeks of treatment (middle panel) and at 12 weeks of treatment (bottom panel) with 1050 mg JNJ-372. Tumor size is indicated in each panel.
- FIGs. 3A-3B show mean tumor volumes (FIG. 3 A) and mean body weights (FIG. 3B) in mice with tumors harboring c-Met exon 14 skipping mutation (LU2503), treated with JNJ-61186372 (JNJ-372), capmatinib, or Isotype control; arrowheads indicate individual animal termination due to tumor size; vertical dashed line represents end of dosing.
- FIGs. 4A-4B show mean tumor volumes (FIG. 4A) and mean body weights (FIG. 4B) in mice with tumors harboring c-Met exon 14 skipping mutation (LU2503), treated with JNJ-61186372 (JNJ-372), capmatinib, JNJ-61186372 and capmatinib, or Isotype control; arrowheads indicate individual animal termination due to tumor size; vertical dashed line represents end of dosing.
- FIG. 5 shows protein levels determined by western blot, in LU2503 tumors grown in mice treated with JNJ-61186372 (JNJ-372), capmatinib, JNJ-61186372 and capmatinib, or Isotype control.
- FIGs. 6A-6B show protein levels determined by western blot and quantified by using Image J software and normalized to b-tubulin, in LU2503 tumors grown in mice treated with JNJ-61186372 (“372”), capmatinib (“cap”), JNJ-61186372 and capmatinib (“372+cap”), or Isotype control (“Iso Ctrl”).
- FIGs. 7A-7C show protein levels determined by western blot and quantified by using Image J software and normalized to b-tubulin, in LU2503 tumors grown in mice treated with JNJ-61186372 (“372”), capmatinib (“cap”), JNJ-61186372 and capmatinib (“372+cap”), or Isotype control (“Iso Ctrl”).
- FIG. 8 shows mean tumor volumes in mice with tumors harboring c-Met exon 14 skipping mutation (DFCI-440), treated with JNJ-61186372 (JNJ-372), capmatinib, JNJ- 61186372 and capmatinib, or Isotype control.
- a cell includes a combination of two or more cells, and the like.
- a first option refers to the applicability of the first element without the second.
- a second option refers to the applicability of the second element without the first.
- a third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or” as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or.”
- transitional terms “comprising,” “consisting essentially of,” and “consisting of’ are intended to connote their generally accepted meanings in the patent vernacular; that is, (i) “comprising,” which is synonymous with “including,” “containing,” or “characterized by,” is inclusive or open-ended and does not exclude additional, unrecited elements or method steps; (ii) “consisting of’ excludes any element, step, or ingredient not specified in the claim; and (iii) “consisting essentially of’ limits the scope of a claim to the specified materials or steps “and those that do not materially affect the basic and novel characteristic(s)” of the claimed invention.
- Embodiments described in terms of the phrase “comprising” (or its equivalents) also provide as embodiments those independently described in terms of “consisting of’ and “consisting essentially of.”
- “Co-administration,” “administration with,” “administration in combination with,” “in combination with” or the like, encompass administration of the selected therapeutics or drugs to a single patient, and are intended to include treatment regimens in which the therapeutics or drugs are administered by the same or different route of administration or at the same or different time.
- Isolated refers to a homogenous population of molecules (such as synthetic polynucleotides, polypeptides vectors or viruses) which have been substantially separated and/or purified away from other components of the system the molecules are produced in, such as a recombinant cell, as well as a protein that has been subjected to at least one purification or isolation step.
- molecules such as synthetic polynucleotides, polypeptides vectors or viruses
- isolated refers to a molecule that is substantially free of other cellular material and/or chemicals and encompasses molecules that are isolated to a higher purity, such as to 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% purity.
- Treat”, “treating” or “treatment” of a disease or disorder such as cancer refers to accomplishing one or more of the following: reducing the severity and/or duration of the disorder, inhibiting worsening of symptoms characteristic of the disorder being treated, limiting or preventing recurrence of the disorder in subjects that have previously had the disorder, or limiting or preventing recurrence of symptoms in subjects that were previously symptomatic for the disorder.
- Prevent”, “preventing”, “prevention”, or “prophylaxis” of a disease or disorder means preventing that a disorder occurs in subject.
- Diagnosing refers to methods to determine if a subject is suffering from a given disease or condition or may develop a given disease or condition in the future or is likely to respond to treatment for a prior diagnosed disease or condition, i.e., stratifying a patient population on likelihood to respond to treatment. Diagnosis is typically performed by a physician based on the general guidelines for the disease to be diagnosed or other criteria that indicate a subject is likely to respond to a particular treatment.
- “Responsive”, “responsiveness” or “likely to respond” refers to any kind of improvement or positive response, such as alleviation or amelioration of one or more symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, preventing spread of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
- Newly diagnosed refers to a subject who has been diagnosed with EGFR or c- Met expressing cancer but has not yet received treatment for multiple myeloma.
- “Therapeutically effective amount” refers to an amount effective, at doses and for periods of time necessary, to achieve a desired therapeutic result.
- a therapeutically effective amount may vary depending on factors such as the disease state, age, sex, and weight of the individual, and the ability of a therapeutic or a combination of therapeutics to elicit a desired response in the individual. Exemplary indicators of an effective therapeutic or combination of therapeutics that include, for example, improved well-being of the patient.
- Refractory refers to a disease that does not respond to a treatment.
- a refractory disease can be resistant to a treatment before or at the beginning of the treatment, or a refractory disease can become resistant during a treatment.
- Relapsed refers to the return of a disease or the signs and symptoms of a disease after a period of improvement after prior treatment with a therapeutic.
- Subject includes any human or nonhuman animal.
- Nonhuman animal includes all vertebrates, e.g., mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows, chickens, amphibians, reptiles, etc.
- the terms “subject” and “patient” are used interchangeably herein.
- “About” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. Unless explicitly stated otherwise within the Examples or elsewhere in the Specification in the context of a particular assay, result or embodiment, “about” means within one standard deviation per the practice in the art, or a range of up to 5%, whichever is larger.
- Cancer refers to an abnormal growth of cells which tend to proliferate in an uncontrolled way and, in some cases, to metastasize (spread) to other areas of a patient’s body.
- EGFR or c-Met expressing cancer refers to cancer that has detectable expression of EGFR or c-Met or has EGFR or c-Met mutation or amplification.
- EGFR or c-Met expression, amplification and mutation status can be detected using know methods, such as sequencing, fluorescent in situ hybridization, immunohistochemistry, flow cytometry or western blotting using tumor biopsies or blood samples. Expression can also be detected by sequening from circulating tumor DNA (ctDNA).
- EGFR epidermal growth factor receptor
- human EGFR also known as HER1 or ErbBl (Ullrich el al, Nature 309:418-425, 1984) having the amino acid sequence shown in GenBank accession number NP 005219, as well as naturally -occurring variants thereof.
- Hepatocyte growth factor receptor or “c-Met” or “MET” as used herein refers to the human c-Met having the amino acid sequence shown in GenBank Accession No: NP 001120972 and natural variants thereof.
- Bispecific anti-EGFR/c-Met antibody or “bispecific EGFR/c-Met antibody” refers to a bispecific antibody having a first domain that specifically binds EGFR and a second domain that specifically binds c-Met.
- the domains specifically binding EGFR and c-Met are typically VH/VL pairs, and the bispecific anti-EGFR/c-Met antibody is monovalent in terms of binding to EGFR and c-Met.
- Specific binding or “specifically binds” or “specifically binding” or “binds” refer to an antibody binding to an antigen or an epitope within the antigen with greater affinity than for other antigens.
- the antibody binds to the antigen or the epitope within the antigen with an equilibrium dissociation constant (K D ) of about 5xl0 8 M or less, for example about lxlO 9 M or less, about lxlO 10 M or less, about lxlO 11 M or less, or about lxlO 12 M or less, typically with the K D that is at least one hundred-fold less than its K D for binding to a non-specific antigen (e.g., BSA, casein).
- K D equilibrium dissociation constant
- the dissociation constant may be measured using known protocols.
- Antibodies that bind to the antigen or the epitope within the antigen may, however, have cross-reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno) or Pan troglodytes (chimpanzee, chimp). While a monospecific antibody binds one antigen or one epitope, a bispecific antibody binds two distinct antigens or two distinct epitopes.
- Antibodies is meant in a broad sense and includes immunoglobulin molecules including monoclonal antibodies including murine, human, humanized and chimeric monoclonal antibodies, antigen binding fragments, multispecific antibodies, such as bispecific, trispecific, tetraspecific etc., dimeric, tetrameric or multimeric antibodies, single chain antibodies, domain antibodies and any other modified configuration of the immunoglobulin molecule that comprises an antigen binding site of the required specificity.
- “Full length antibodies” are comprised of two heavy chains (HC) and two light chains (LC) inter-connected by disulfide bonds as well as multimers thereof (e.g. IgM).
- Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (comprised of domains CHI, hinge, CH2 and CH3).
- Each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL).
- the VH and the VL regions may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FR segments, arranged from amino-to-carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3 andFRL
- CDR complementarity determining regions
- CDR CDR
- HCDR1 CDR1
- HCDR2 CDR3
- LCDR1 CDR2
- LCDR3 CDR3
- Immunoglobulins may be assigned to five major classes, IgA, IgD, IgE, IgG and IgM, depending on the heavy chain constant domain amino acid sequence.
- IgA and IgG are further sub-classified as the isotypes IgAl, IgA2, IgGl, IgG2, IgG3 and IgG4.
- Antibody light chains of any vertebrate species may be assigned to one of two clearly distinct types, namely kappa (K) and lambda (l), based on the amino acid sequences of their constant domains.
- Antigen binding fragment refers to a portion of an immunoglobulin molecule that binds an antigen.
- Antigen binding fragments may be synthetic, enzymatically obtainable or genetically engineered polypeptides and include the VH, the VL, the VH and the VL, Fab, F(ab')2, Fd and Fv fragments, domain antibodies (dAb) consisting of one VH domain or one VL domain, shark variable IgNAR domains, camelized VH domains, minimal recognition units consisting of the amino acid residues that mimic the CDRs of an antibody, such as FR3-CDR3-FR4 portions, the HCDR1, the HCDR2 and/or the HCDR3 and the LCDR1, the LCDR2 and/or the LCDR3.
- VH and VL domains may be linked together via a synthetic linker to form various types of single chain antibody designs where the VH/VL domains may pair intramolecularly, or intermolecularly in those cases when the VH and VL domains are expressed by separate single chain antibody constructs, to form a monovalent antigen binding site, such as single chain Fv (scFv) or diabody ; described for example inlnt. Patent Publ. Nos. W01998/44001, WO1988/01649, WO1994/13804 and W01992/01047.
- scFv single chain Fv
- “Monoclonal antibody” refers to an antibody obtained from a substantially homogenous population of antibody molecules, i.e., the individual antibodies comprising the population are identical except for possible well-known alterations such as removal of C-terminal lysine from the antibody heavy chain or post-translational modifications such as amino acid isomerization or deamidation, methionine oxidation or asparagine or glutamine deamidation.
- Monoclonal antibodies typically bind one antigenic epitope.
- a bispecific monoclonal antibody binds two distinct antigenic epitopes.
- Monoclonal antibodies may have heterogeneous glycosylation within the antibody population.
- Monoclonal antibody may be monospecific or multispecific such as bispecific, monovalent, bivalent or multivalent.
- Recombinant refers to DNA, antibodies and other proteins that are prepared, expressed, created or isolated by recombinant means when segments from different sources are joined to produce recombinant DNA, antibodies or proteins.
- Bispecific refers to an antibody that specifically binds two distinct antigens or two distinct epitopes within the same antigen.
- the bispecific antibody may have crossreactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca cynomolgus (cynomolgus, cyno) or Pan troglodytes, or may bind an epitope that is shared between two or more distinct antigens.
- Antagonist refers to a molecule that, when bound to a cellular protein, suppresses at least one reaction or activity that is induced by a natural ligand of the protein.
- a molecule is an antagonist when the at least one reaction or activity is suppressed by at least about 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% more than the at least one reaction or activity suppressed in the absence of the antagonist (e.g., negative control), or when the suppression is statistically significant when compared to the suppression in the absence of the antagonist.
- PD-(L)1 axis inhibitor refers to a molecule that inhibits PD-1 downstream signaling.
- PD-(L)1 axis inhibitor may be a molecule that binds PD-1, PD-L1 or PD-L2.
- Biological sample refers to a collection of similar fluids, cells, or tissues isolated from a subject, as well as fluids, cells, or tissues present within a subject.
- Exemplary samples are biological fluids such as blood, serum and serosal fluids, plasma, lymph, urine, saliva, cystic fluid, tear drops, feces, sputum, mucosal secretions of the secretory tissues and organs, vaginal secretions, ascites fluids, fluids of the pleural, pericardial, peritoneal, abdominal and other body cavities, fluids collected by bronchial lavage, synovial fluid, liquid solutions contacted with a subject or biological source, for example, cell and organ culture medium including cell or organ conditioned medium, lavage fluids and the like, tissue biopsies, tumor tissue biopsies, tumor tissue samples, fine needle aspirations, surgically resected tissue, organ cultures or cell cultures.
- Low fucose or “low fucose content’ ’ as used in the application refers to antibodies with fucose content of about between 1%-15%.
- Normal fucose or ‘normal fucose content” as used herein refers to antibodies with fucose content of about over 50%, typically about over 80% or over 85%.
- c-Met exon 14 deletion or “c-Met exon 14 skipping mutation” refers to a c-Met gene that is mutated to remove at least a portion of exon 14 of c-Met, or a c-Met transcript that is spliced to remove at least a portion of exon 14 of c-Met.
- the portion deleted may include a portion that encodes the negative regulation site Tyr 1003 in the juxtamembrane region of the c-Met protein.
- the exon 14 region of c-Met gene encompasses nucleotides 3284 to 3424 in the full-length nucleotide sequences of GenBank Accession No.
- “Pharmaceutical composition” refers to a composition comprising an active ingredient such as the bispecific EGFR/c-Met antibody and one or more pharmaceutically acceptable carriers, or such as the EGFR TK inhibitor capmatinib, or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof, and one or more pharmaceutically acceptable carriers.
- “Pharmaceutically acceptable carrier” or “excipient” refers to an ingredient in a pharmaceutical composition, other than the active ingredient, which is nontoxic to a subject.
- a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, stabilizer or preservative.
- a pharmaceutically acceptable carrier includes, but is not limited to, a diluent, disintegrant, or glidant; or a diluent, disintegrant, wetting agent, glidant or lubricant.
- Solids and “hydrates” are solvent addition forms which the compounds of the present invention are able to form, whereby the multicomponent compound comprises both the host molecule (e.g., compound of Formula (I) or salt thereof) and guest molecule (water (“hydrate”) or another solvent (“solvate”)) incorporated in the structure.
- host molecule e.g., compound of Formula (I) or salt thereof
- guest molecule water (“hydrate”) or another solvent (“solvate”)
- Tautomer or “tautomeric form” refers to structural isomers of different energies which are interconvertible via a low energy barrier.
- proton tautomers also known as prototropic tautomers
- Valence tautomers include interconversions by reorganization of some of the bonding electrons.
- JNJ-61186372 (JNJ-372) is an IgGl anti-EGFR/c-Met bispecific antibody, also known as Amivantamab, described in U.S. Pat. No. 9,593,164.
- c-Met exon 14 skipping mutations comprise point mutations, insertions, deletions and complex mutations such as combinations of insertions and deletions which affect splice acceptor or donor sites and induce in-frame exon 14 skipping, resulting in deletion of the juxtamembrane domain of c-Met, a known c-Met negative regulatory domain (see e.g. Descarentries et ak, J Thoracic oncology 13: 1873-1883, 2018), resulting in constitutively active c-Met.
- Over 160 mutations affecting c-Met exon 14 has been described (see e.g.
- C-Met exon 14 skipping mutations can be identified using next-generation sequencing (NGS) of patient samples. Exon 14 skipping mutations may arise de novo or as resistance mutations to prior treatment, such as to 3 rd generation TKIs.
- c-Met exon 14 encodes an amino acid sequence of DLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPE (SEQ ID NO: 21).
- the disclosure provides a method of treating a subject having cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody to the subject having cancer that is positive for c-Met exon 14 skipping mutation.
- EGFR bispecific anti-epidermal growth factor receptor
- c-Met hepatocyte growth factor receptor
- Cancers in which c-Met exon 14 skipping mutations have been identified include lung cancer, gastric cancer, colorectal cancer, and brain cancers, such as non-small cell lung cancer (NSCLC), small cell lung cancer (SCLC), lung adenocarcinoma, and pulmonary sarcomatoid carcinoma (PSC). Any other cancer harboring the c-Met exon skipping mutation may also be treated with the bispecific EGFR/c-Met antibody of the disclosure.
- NSCLC non-small cell lung cancer
- SCLC small cell lung cancer
- PSC pulmonary sarcomatoid carcinoma
- the disclosure also provides a method of treating a subject having lung cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c-Met antibody to the subject having lung cancer that is positive for c-Met exon 14 skipping mutation.
- the disclosure also provides a method of treating a subject having NSCLC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c-Met antibody to the subject having NSCLC that is positive for c-Met exon 14 skipping mutation.
- the disclosure also provides a method of treating a subject having SCLC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having SCLC that is positive for c-Met exon 14 skipping mutation.
- the disclosure also provides a method of treating a subject having lung adenocarcinoma that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c- Met antibody to the subject having lung adenocarcinoma that is positive for c-Met exon 14 skipping mutation.
- the disclosure also provides a method of treating a subject having PSC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having PSC that is positive for c-Met exon 14 skipping mutation.
- the disclosure also provides a method of treating a subject having gastric cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having gastric cancer that is positive for c-Met exon 14 skipping mutation.
- the disclosure also provides a method of treating a subject having colorectal cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having colorectal cancer that is positive for c-Met exon 14 skipping mutation.
- the disclosure also provides a method of treating a subject having brain cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having brain cancer that is positive for c-Met exon 14 skipping mutation.
- the disclosure also provides a method treating a subject having cancer with a bispecific anti-EGFR/c-Met antibody, comprising: providing a biological sample from the subject; determining presence or absence of a c-Met exon 14 skipping mutation in the sample; administering or providing for administration the bispecific anti-EGFR/c-Met antibody to the subject determined to have c-Met exon 14 skipping mutation.
- the biological sample is a blood sample.
- the biological sample is a tumor tissue biopsy
- the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c- Met, wherein the first domain comprises a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6; and the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10, the LCDR2 of SEQ ID NO: 11 and the LCDR3 of SEQ ID NO: 12.
- HCDR1 heavy chain complementarity determining region 1
- LCDR2 of SEQ ID NO: 2 a HCDR3 of SEQ
- the first domain that specifically binds EGFR comprises a heavy chain variable region (VH) of SEQ ID NO: 13 and a light chain variable region (VL) of SEQ ID NO: 14; and the second domain that specifically binds c-Met comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the bispecific anti-EGFR c-Met antibody is an IgGl isotype.
- the bispecific anti-EGFR c-Met antibody comprises a first heavy chain (HC1) of SEQ ID NO: 17, a first light chain (LC1) of SEQ ID NO: 18, a second heavy chain (HC2) of SEQ ID NO: 19 and a second light chain (LC2) of SEQ ID NO: 20.
- the bispecific anti-EGFR c-Met antibody comprises a biantennary glycan structure with a fucose content of about between 1% to about 15%.
- Antibodies with reduced fucose content can be made using different methods reported to lead to the successful expression of relatively high defucosylated antibodies bearing the biantennary complex-type of Fc oligosaccharides such as control of culture osmolality (Konno etal., Cytotechnology 64(:249-65, 2012), application of a variant CHO line Lecl3 as the host cell line (Shields el al, J Biol Chem 277:26733-26740, 2002), application of a variant CHO line EB66 as the host cell line (Olivier el al, MAbs ;2(4), 2010; Epub ahead of print; PMID:20562582), application of a rat hybridoma cell line YB2/0 as the host cell line (Shinkawa et al, J Biol Chem 278:3466-3473, 2003), introduction of small interfering RNA specifically against the a 1,6-fucosyltrasferase ( FUT8)
- the disclosure also provides a method of treating a subject having cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c-Met antibody to the subject having cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR/c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6; and the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10, the LCD
- the disclosure also provides a method of treating a subject having lung cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having lung cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6; and the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10,
- the disclosure also provides a method of treating a subject having NSCLC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having NSCLC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR/c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6; and the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO
- the disclosure also provides a method of treating a subject having SCLC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c-Met antibody to the subject having SCLC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6; and the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10,
- the disclosure also provides a method of treating a subject having lung adenocarcinoma that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c- Met antibody to the subject having lung adenocarcinoma that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6; and the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID
- the disclosure also provides a method of treating a subject having PSC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having PSC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6; and the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10,
- the disclosure also provides a method of treating a subject having gastric cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c-Met antibody to the subject having gastric cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR/c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6; and the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO
- the disclosure also provides a method of treating a subject having colorectal cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having colorectal cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6; and the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of
- the disclosure also provides a method of treating a subject having brain cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having brain cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6; and the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10,
- the disclosure provides a method of treating a subject having cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c-Met antibody to the subject having cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR/c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having lung cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having lung cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having NSCLC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having NSCLC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having SCLC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having SCLC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having lung adenocarcinoma that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c- Met antibody to the subject having lung adenocarcinoma that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR/c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having PSC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c-Met antibody to the subject having PSC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having gastric cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having gastric cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having colorectal cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having colorectal cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having brain cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c-Met antibody to the subject having brain cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR/c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure provides a method of treating a subject having cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody is an IgGl isotype and comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having lung cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having lung cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody is an IgGl isotype and comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having NSCLC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having NSCLC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody is an IgGl isotype and comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having SCLC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having SCLC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR/c-Met antibody is an IgGl isotype and comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having lung adenocarcinoma that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c- Met antibody to the subject having lung adenocarcinoma that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody is an IgGl isotype and comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having gastric cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having gastric cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody is an IgGl isotype and comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having colorectal cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having colorectal cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody is an IgGl isotype and comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the disclosure also provides a method of treating a subject having brain cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having brain cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR/c-Met antibody is an IgGl isotype and comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a VH of SEQ ID NO: 13 and a VL of SEQ ID NO: 14; and the second domain comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the bispecific anti-EGFR/c-Met antibody is an IgGl isotype. Some variation exists within the IgGl constant domain (e.g. well-known allotypes), with variation at positions 214, 356, 358, 422, 431, 435 o 436 (residue numbering according to the EU numbering) (see e.g. IMGT Web resources; IMGT Repertoire (IG and TR); Proteins and alleles; allotypes).
- the bispecific anti-EGFR c-Met antibody may be of any IgGl allotype, such as Glml7, Glm3, Glml, Glm2, Glm27 or Glm28.
- the disclosure also provides a method of treating a subject having cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a HC1 of SEQ ID NO: 17, a LC1 of SEQ ID NO: 18, a HC2 of SEQ ID NO: 19 and a LC2 of SEQ ID NO: 20.
- the disclosure also provides a method of treating a subject having lung cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having lung cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a HC1 of SEQ ID NO: 17, a LC1 of SEQ ID NO: 18, a HC2 of SEQ ID NO: 19 and a LC2 of SEQ ID NO: 20.
- the disclosure also provides a method of treating a subject having NSCLC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having NSCLC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a HC1 of SEQ ID NO: 17, a LC1 of SEQ ID NO: 18, a HC2 of SEQ ID NO: 19 and a LC2 of SEQ ID NO: 20.
- the disclosure also provides a method of treating a subject having SCLC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having SCLC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a HC1 of SEQ ID NO: 17, a LC1 of SEQ ID NO: 18, a HC2 of SEQ ID NO: 19 and a LC2 of SEQ ID NO: 20.
- the disclosure also provides a method of treating a subject having lung adenocarcinoma that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c- Met antibody to the subject having lung adenocarcinoma that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR/c-Met antibody comprises a HC1 of SEQ ID NO: 17, a LC1 of SEQ ID NO: 18, a HC2 of SEQ ID NO: 19 and a LC2 of SEQ ID NO: 20.
- the disclosure also provides a method of treating a subject having PSC that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR/c-Met antibody to the subject having PSC that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a HC1 of SEQ ID NO: 17, a LC1 of SEQ ID NO: 18, a HC2 of SEQ ID NO: 19 and a LC2 of SEQ ID NO: 20.
- the disclosure also provides a method of treating a subject having gastric cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having gastric cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a HC1 of SEQ ID NO: 17, a LC1 of SEQ ID NO: 18, a HC2 of SEQ ID NO: 19 and a LC2 of SEQ ID NO: 20.
- the disclosure also provides a method of treating a subject having colorectal cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having colorectal cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a HC1 of SEQ ID NO: 17, a LC1 of SEQ ID NO: 18, a HC2 of SEQ ID NO: 19 and a LC2 of SEQ ID NO: 20.
- the disclosure also provides a method of treating a subject having brain cancer that is positive for a c-Met exon 14 skipping mutation, comprising administering a therapeutically effective amount of an isolated bispecific anti-EGFR c-Met antibody to the subject having brain cancer that is positive for c-Met exon 14 skipping mutation, wherein the bispecific anti-EGFR c-Met antibody comprises a HC1 of SEQ ID NO: 17, a LC1 of SEQ ID NO: 18, a HC2 of SEQ ID NO: 19 and a LC2 of SEQ ID NO: 20.
- the subject is relapsed or resistant to treatment with one or more prior anti-cancer therapies.
- the subject has acquired the c-Met exon 14 skipping mutation as a result of treatment with one or more prior anti-cancer therapies. In some embodiments, the subject has acquired the c-Met exon 14 skipping mutation as a result of treatment with a kinase inhibitor.
- the subject has acquired the c-Met exon 14 skipping mutation as a result of treatment with an EGFR kinase inhibitor.
- the subject has acquired the c-Met exon 14 skipping mutation as a result of treatment with a c-Met kinase inhibitor.
- the one or more prior anti-cancer therapies comprises one or more chemotherapeutic agents, checkpoint inhibitors, targeted anti-cancer therapies or kinase inhibitors, or any combination thereof.
- the kinase inhibitor is an inhibitor of EGFR, an inhibitor of c-Met, an inhibitor of HER2, an inhibitor of HER3, an inhibitor of HER4, an inhibitor of VEGFR or an inhibitor of AXL.
- the kinase inhibitor is erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, capmatinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitinib.
- the one or more prior anti-cancer therapies comprises carboplatin, paclitaxel, gemcitabine, cisplatin, vinorelbine, docetaxel, palbociclib, crizotinib, PD-(L)1 axis inhibitor, an inhibitor of EGFR, an inhibitor of c-Met, an inhibitor of HER2, an inhibitor of HER3, an inhibitor of HER4, an inhibitor of VEGFR, an inhibitor of AXL, erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, capmatinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitinib, or any combination thereof.
- the subject is resistant or has acquired resistance to an EGFR inhibitor.
- EGFR inhibitors for which cancer may acquire resistance are anti-EGFR antibodies cetuximab (ERBITUX ® ), pantinumumab (VECTIBIX ® ), matuzumab, nimotuzumab, small molecule EGFR inhibitors erlotinib (TARCEVA ® ), gefitinib (IRESSA ® ), EKB-569 (pelitinib, irreversible EGFR TKI), pan-ErbB and other receptor tyrosine kinase inhibitors, lapatinib (EGFR and HER2 inhibitor), pelitinib (EGFR and HER2 inhibitor), vandetanib (ZD6474, ZACTIMA TM , EGFR, VEGFR2 and RET TKI), PF00299804 (dacomitinib, irreversible pan-ErbB TKI) , Cl- 1033 (ir
- EGFR ErbB2, GEVGR andEphB4 inhibitor
- CO-1686 irreversible mutant-selective EGFR TKI
- AZD9291 irreversible mutant-selective EGFR TKI
- HKI-272 neratinib, irreversible EGFR/ErbB2 inhibitor
- Symptoms that may be associated with resistance to an anticancer therapy include a decline or plateau of the well-being of the patient, an increase in the size of a tumor, arrested or slowed decline in growth of a tumor, and/or the spread of cancerous cells in the body from one location to other organs, tissues or cells.
- Reestablishment or worsening of various symptoms associated with cancer may also be an indication that a subject has developed or is susceptible to developing resistance to an anticancer therapy, such as anorexia, cognitive dysfunction, depression, dyspnea, fatigue, hormonal disturbances, neutropenia, pain, peripheral neuropathy, and sexual dysfunction.
- the symptoms associated with cancer may vary according to the type of cancer.
- symptoms associated with cervical cancer may include abnormal bleeding, unusual heavy vaginal discharge, pelvic pain that is not related to the normal menstrual cycle, bladder pain or pain during urination, and bleeding between regular menstrual periods, after sexual intercourse, douching, or pelvic exam.
- Symptoms associated with lung cancer may include persistent cough, coughing up blood, shortness of breath, wheezing chest pain, loss of appetite, losing weight without trying and fatigue.
- Symptoms for liver cancer may include loss of appetite and weight, abdominal pain, especially in the upper right part of abdomen that may extend into the back and shoulder, nausea and vomiting, general weakness and fatigue, an enlarged liver, abdominal swelling (ascites), and a yellow discoloration of the skin and the whites of eyes (jaundice).
- nausea and vomiting general weakness and fatigue
- abdominal swelling ascites
- whites of eyes jaundice
- One skilled in oncology may readily identify symptoms associated with a particular cancer type.
- Exemplary PD-(L)1 axis inhibitors are antibodies that bind PD-1 such as nivolumab (OPDIVO ® ), pembrolimumab (KEYTRUDA ® ), sintilimab, cemiplimab (LIBTAYO ® ), tripolibamab, tislelizumab, spartalizumab, camrelizumab, dostralimab, genolimzumab or cetrelimab, or antibodies that bind PD-L1, such as PD-L1 antibodies are envafolimab, atezolizumab (TECENTRIQ ® ), durvalumab (IMFINZI ® ) and avelumab (BAVENCIO ® ).
- PD-1 such as nivolumab (OPDIVO ® ), pembrolimumab (KEYTRUDA ® ), sintilimab, cemiplim
- Marketed antibodies may be purchased via authorized distributor or pharmacy.
- amino acid sequences structures of the small molecules can be found from US AN and/or INN submissions by the companies of from CAS registry.
- the subject is treatment naive.
- the c-Met exon 14 skipping mutation is a tie novo mutation.
- cancer that is positive for c-Met exon 14 skipping mutation is positive for CDK4 amplification, EGFR amplification, KRAS amplification, MDM2 amplification, TERT amplification, NF1 R2450*; RAD50 L597Vfs*5, MET c.3082 +3A>G, EGFR, wild-type EGFR, an EGFR activating mutation, increased levels of circulating HGF, c-MET amplification or a mutant KRAS, or any combination thereof.
- EGFR activating mutations that may be associated with cancer include point mutations, deletion mutations, insertion mutations, inversions or gene amplifications that lead to an increase in at least one biological activity of EGFR, such as elevated tyrosine kinase activity, formation of receptor homodimers and heterodimers, enhanced ligand binding etc. Mutations can be located in any portion of an EGFR gene or regulatory region associated with an EGFR gene and include mutations in exon 18, 19, 20 or 21 or mutations in the kinase domain. Other examples of EGFR activating mutations are known in the art (see e.g., U.S. Pat. Publ. No. US2005/0272083).
- the EGFR activating mutation comprises L718Q, G719A, G719X (X being any amino acid), L861X (X being any amino acid), L858R, E746K, L747S, E749Q, A750P, A755V, V765M, C797S, L858P or T790M substitution, deletion of E746-A750, deletion of R748-P753, insertion of Ala (A) between M766 and A767, insertion of Ser, Val and Ala (SVA) between S768 and V769, insertion of Asn and Ser (NS) between P772 and H773, insertion of one or more amino acids between D761 and E762, A763 and Y764, Y764 and Y765, M766 and A767, A767 and V768, S768 and V769, V769 and D770, D770 and N771, N771 and P772, P772 and H773, H77
- TKI EGFR tyrosine kinase inhibitors
- Exemplary c-Met activating mutations include point mutations, deletion mutations, insertion mutations, inversions or gene amplifications that lead to an increase in at least one biological activity of a c-Met protein, such as elevated tyrosine kinase activity, formation of receptor homodimers and heterodimers, enhanced ligand binding etc. Mutations can be located in any portion of the c-Met gene or regulatory regions associated with the gene, such as mutations in the kinase domain of c-Met.
- Exemplary c-Met activating mutations are mutations at residue positions N375, V13, V923, R175, V136, L229, S323, R988, S1058/T1010 and E168. Methods for detecting EGFR and c-Met mutations or gene amplifications are well known.
- the mutant KRAS comprises a G12V, G12C, G12A, or G12D substitution, or any combination thereof.
- cancer that is positive for a c-Met exon 14 skipping mutation comprises lung cancer, gastric cancer, colorectal cancer, brain cancer, derived from epithelial cell cancer, breast cancer, ovarian cancer, colorectal cancer, anal cancer, prostate cancer, kidney cancer, bladder cancer, head and neck cancer, pharynx cancer, cancer of the nose, pancreatic cancer, skin cancer, oral cancer, cancer of the tongue, esophageal cancer, vaginal cancer, cervical cancer, cancer of the spleen, testicular cancer, gastric cancer, cancer of the thymus, colon cancer, thyroid cancer, liver cancer, hepatocellular carcinoma (HCC) or sporadic or hereditary papillary renal cell carcinoma (PRCC), or any combination thereof.
- lung cancer gastric cancer, colorectal cancer, brain cancer, derived from epithelial cell cancer, breast cancer, ovarian cancer, colorectal cancer, anal cancer, prostate cancer, kidney cancer, bladder cancer, head and neck cancer, pharynx cancer,
- cancer that is positive for a c-Met exon 14 skipping mutation comprises lung cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises gastric cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises colorectal cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises brain cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises epithelial cell cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises breast cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises ovarian cancer.
- cancer that is positive for a c- Met exon 14 skipping mutation comprises colorectal cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises anal cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises prostate cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises kidney cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises bladder cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises head and neck cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises pharynx cancer.
- cancer that is positive for a c-Met exon 14 skipping mutation comprises cancer of the nose. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises pancreatic cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises skin cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises oral cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises cancer of the tongue. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises esophageal cancer.
- cancer that is positive for a c-Met exon 14 skipping mutation comprises vaginal cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises cervical cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises cancer of the spleen. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises testicular cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises gastric cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises cancer of the thymus.
- cancer that is positive for a c-Met exon 14 skipping mutation comprises colon cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises thyroid cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises liver cancer. In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises hepatocellular carcinoma (HCC). In some embodiments, cancer that is positive for a c-Met exon 14 skipping mutation comprises sporadic or hereditary papillary renal cell carcinoma (PRCC).
- HCC hepatocellular carcinoma
- PRCC hereditary papillary renal cell carcinoma
- NSCLC includes squamous cell carcinoma, adenocarcinoma, and large cell carcinoma.
- cells of the NSCLC have an epithelial phenotype.
- the NSCLC has acquired resistance to treatment with one or more EGFR inhibitors.
- EGFR-TKIs EGFR tyrosine kinase inhibitors
- EGFR gene amplification is also strongly correlated with response after EGFR-TKI treatment (Cappuzzo et al, J Natl Cancer Inst 97:643-55, 2005).
- EGFR exon 20 insertions have been associated with EGFR TKI resistance. Although the majority of NSCLC patients with EGFR mutations initially respond to EGFR TKI therapy, virtually all acquire resistance that prevents a durable response.
- the subject is further administering one or more anti-cancer therapies.
- the one or more anti-cancer therapies comprises chemotherapy, radiation therapy, surgery, a targeted anti-cancer therapy or a kinase inhibitor, or any combination thereof.
- the kinase inhibitor is an inhibitor of EGFR, an inhibitor of c-Met, an inhibitor of HER2, an inhibitor of HER3, an inhibitor of HER4, an inhibitor of VEGFR or an inhibitor of AXL.
- the kinase inhibitor is an inhibitor of EGFR.
- the kinase inhibitor is an inhibitor of c-Met.
- the kinase inhibitor is an inhibitor of HER2.
- the kinase inhibitor is an inhibitor of HER3.
- the kinase inhibitor is an inhibitor of HER4.
- the kinase inhibitor is an inhibitor of VEGFR.
- the kinase inhibitor is an inhibitor of or AXL.
- the kinase inhibitor is erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, capmatinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitinib.
- the kinase inhibitor is erlotinib. In some embodiments, the kinase inhibitor is gefitinib. In some embodiments, the kinase inhibitor is lapatinib. In some embodiments, the kinase inhibitor is vandetanib. In some embodiments, the kinase inhibitor is afatinib. In some embodiments, the kinase inhibitor is osimertinib. In some embodiments, the kinase inhibitor is lazertinib. In some embodiments, the kinase inhibitor is poziotinib. In some embodiments, the kinase inhibitor is criotinib.
- the kinase inhibitor is cabozantinib. In some embodiments, the kinase inhibitor is capmatinib. In some embodiments, the kinase inhibitor is axitinib. In some embodiments, the kinase inhibitor is lenvatinib. In some embodiments, the kinase inhibitor is nintedanib. In some embodiments, the kinase inhibitor is regorafenib. In some embodiments, the kinase inhibitor is pazopanib. In some embodiments, the kinase inhibitor is sorafenib. In some embodiments, the kinase inhibitor is sunitinib.
- Anti-cancer therapies that may be administered in combination with the bispecific anti-EGFR/c-Met antibody in the methods of the disclosure include any one or more of the chemotherapeutic drugs or other anti-cancer therapeutics known to those of skill in the art.
- Chemotherapeutic agents are chemical compounds useful in the treatment of cancer and include growth inhibitory agents or other cytotoxic agents and include alkylating agents, anti-metabolites, anti-microtubule inhibitors, topoisomerase inhibitors, receptor tyrosine kinase inhibitors, angiogenesis inhibitors and the like.
- chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN®); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamine; nitrogen mustards such as chlorambucil, chlomaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine,
- anti-hormonal agents that act to regulate or inhibit hormone action on tumors
- anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4- hydroxytamoxifen, trioxifene, keoxifene, LY 117018, onapristone, and toremifene (FARESTON®); and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- the bispecific anti-EGFR c-Met antibody may be administered in a pharmaceutically acceptable carrier.
- Carrier refers to a diluent, adjuvant, excipient, or vehicle with which the antibody of the invention is administered.
- vehicles may be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- 0.4% saline and 0.3% glycine may be used to formulate the bispecific anti-EGFR c-Met antibody.
- These solutions are sterile and generally free of particulate matter. They may be sterilized by conventional, well- known sterilization techniques (e.g., filtration).
- the carrier may comprise sterile water and other excipients may be added to increase solubility or preservation.
- injectable suspensions or solutions may also be prepared utilizing aqueous carriers along with appropriate additives.
- Suitable vehicles and formulations, inclusive of other human proteins, e.g., human serum albumin, are described, for example, in e.g. Remington: The Science and Practice of Pharmacy, 21 st Edition, Troy, D.B. ed., Lipincott Williams and Wilkins, Philadelphia, PA 2006, Part 5, Pharmaceutical Manufacturing pp 691- 1092, See especially pp. 958-989.
- the mode of administration may be any suitable route that delivers the bispecific anti-EGFR-c-Met antibody to the host, such as parenteral administration, e.g., intradermal, intramuscular, intraperitoneal, intravenous or subcutaneous, pulmonary, transmucosal (oral, intranasal, intravaginal, rectal), using a formulation in a tablet, capsule, solution, powder, gel, particle; and contained in a syringe, an implanted device, osmotic pump, cartridge, micropump; or other means appreciated by the skilled artisan, as well known in the art.
- parenteral administration e.g., intradermal, intramuscular, intraperitoneal, intravenous or subcutaneous, pulmonary, transmucosal (oral, intranasal, intravaginal, rectal), using a formulation in a tablet, capsule, solution, powder, gel, particle; and contained in a syringe, an implanted device, osmotic pump, cartridge
- Site specific administration may be achieved by for example intratumoral, intrarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracerebellar, intracerebroventricular, intracolic, intracervical, intragastric, intrahepatic, intracardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intrapro static, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravascular, intravesical, intralesional, vaginal, rectal, buccal, sublingual, intranasal, or transdermal delivery.
- the bispecific anti-EGFR/c-Met antibody is administered at a dose of between about 140 mg to about 1750 mg. In some embodiments, the bispecific anti-EGFR/c-Met antibody is administered at a dose of between about 140 mg to about 1750 mg.
- the bispecific anti-EGFR c-Met antibody is administered at a dose of about 200 mg, about 210 mg, about 220 mg, about 230 mg, about 240 mg, about 250 mg, about 260 mg, about 270 mg, about 280 mg, about 290 mg, about 300 mg, about
- 1690 mg about 1700 mg, about 1710 mg, about 1720 mg, about 1730 mg, about 1740 mg, about 1750 mg, about 1760 mg, about 1770 mg, about 1780 mg, about 1790 mg, about 1800 mg, about 1810 mg, about 1820 mg, about 1830 mg, about 1840 mg, about 1850 mg, about 1860 mg, about 1870 mg, about 1880 mg, 1890 mg, about 1900 mg, about 1910 mg, about 1920 mg, about 1930 mg, about 1940 mg, about 1950 mg, about 1960 mg, about
- the bispecific anti-EGFR/c-Met antibody is administered at a dose of about 350 mg, about 700 mg, about 1050 mg or about 1400 mg. In some embodiments, the bispecific anti-EGFR/c-Met antibody is administered at a dose of about 350 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 700 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 750 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 800 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 850 mg.
- the bispecific anti-EGFR c-Met antibody is administered at a dose of about 900 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 950 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 1000 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 1050 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 1100 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 1150 mg.
- the bispecific anti-EGFR/c-Met antibody is administered at a dose of about 1200 mg. In some embodiments, the bispecific anti-EGFR/c-Met antibody is administered at a dose of about 1250 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 1300 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 1350 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 1400 mg.
- the bispecific anti-EGFR c-Met antibody is administered once a week. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered about 1050 mg once a week. In some embodiments, the bispecific anti- EGFR c-Met antibody is administered about 1400 mg once a week.
- the bispecific anti-EGFR c-Met antibody is administered once in two weeks. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered about 1050 mg once in two weeks. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered about 1400 mg once in two weeks.
- the bispecific anti-EGFR c-Met antibody is administered twice a week. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered once a week. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered once in two weeks. In some embodiments, the bispecific anti- EGFR c-Met antibody is administered once in three weeks. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered once in four weeks.
- the one or more anti-cancer agents may be administered using recommended doses and dosages of the anti-cancer agent.
- JNJ-372 An exemplary bispecific anti-EGFR c-Met antibody that can be used in the methods of the disclosures is JNJ-372.
- JNJ-372 is characterized by following amino acid sequences:
- bispecific anti-EGFR/c-Met antibodies publicly available may also be used in the methods of the disclosure as long as they demonstrate similar characteristics when compared to JNJ-372 as described inU.S. Pat. No. 9,593,164.
- Bispecific anti-EGFR/c-Met antibodies that may be used in the methods of the disclosure may also be generated by combining EGFR binding VH/VL domains and c-Met binding VH/VL domains that are publicly available and testing the resulting bispecific antibodies for their characteristics as described in U.S. Pat. No. 9,593,164.
- Bispecific anti-EGFR c-Met antibodies used in the methods of the disclosure may be generated for example using Fab arm exchange (or half molecule exchange) between two monospecific bivalent antibodies by introducing substitutions at the heavy chain CH3 interface in each half molecule to favor heterodimer formation of two antibody half molecules having distinct specificity either in vitro in cell-free environment or using coexpression.
- the Fab arm exchange reaction is the result of a disulfide-bond isomerization reaction and dissociation-association of CH3 domains. The heavy chain disulfide bonds in the hinge regions of the parental monospecific antibodies are reduced.
- the resulting free cysteines of one of the parental monospecific antibodies form an inter heavy -chain disulfide bond with cysteine residues of a second parental monospecific antibody molecule and simultaneously CH3 domains of the parental antibodies release and reform by dissociation-association.
- the CH3 domains of the Fab arms may be engineered to favor heterodimerization over homodimerization.
- the resulting product is a bispecific antibody having two Fab arms or half molecules which each bind a distinct epitope, i.e. an epitope on EGFR and an epitope on c-Met.
- the bispecific antibodies of the invention may be generated using the technology described in Int.Pat. Publ. No. WO2011/131746.
- Mutations F405L in one heavy chain and K409R in the other heavy chain may be used in case of IgGl antibodies.
- IgG2 antibodies a wild-type IgG2 and a IgG2 antibody with F405L and R409K substitutions may be used.
- IgG4 antibodies a wild-type IgG4 and a IgG4 antibody with F405L and R409K substitutions may be used.
- first monospecific bivalent antibody and the second monospecific bivalent antibody are engineered to have the aforementioned mutation in the Fc region, the antibodies are incubated together under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide bond isomerization; thereby generating the bispecific antibody by Fab arm exchange.
- the incubation conditions may optimally be restored to non-reducing.
- Exemplary reducing agents that may be used are 2- mercaptoethylamine (2-MEA), dithiothreitol (DTT), dithioerythritol (DTE), glutathione, tris(2-carboxyethyl)phosphine (TCEP), L-cysteine and beta- mercaptoethanol.
- incubation for at least 90 min at a temperature of at least 20°C in the presence of at least 25 mM 2-MEA or in the presence of at least 0.5 mM dithiothreitol at a pH of from 5-8, for example at pH of 7.0 or at pH of 7.4 may be used.
- Bispecific anti-EGFR c-Met antibodies used in the methods of the disclosure may also be generated using designs such as the Knob-in-Hole (Genentech), CrossMAbs (Roche) and the electrostatically -matched (Chugai, Amgen, NovoNordisk, Oncomed), the LUZ-Y (Genentech), the Strand Exchange Engineered Domain body (SEEDbody)(EMD Serono), and the Biclonic (Merus).
- Exemplary CH3 substitution pairs forming a knob and a hole are (expressed as modified position in the first CH3 domain of the first heavy chain/ modified position in the second CH3 domain of the second heavy chain): T366Y/F405A, T366W/F405W, F405W/Y407A, T394W/Y407T, T394S/Y407A, T366W/T394S, F405W/T394S and T366W/T366S L368A Y407V.
- CrossMAb technology in addition to utilizing the “knob-in-hole” strategy to promoter Fab arm exchange utilizes CHI/CL domain swaps in one half arm to ensure correct light chain pairing of the resulting bispecific antibody (see e.g. U.S. Patent No. 8,242,247).
- heterodimerization may be promoted by following substitutions (expressed as modified positions in the first CH3 domain of the first heavy chain/ modified position in the second CH3 domain of the second heavy chain): L351Y F405A Y407V/T394W,
- SEEDbody technology may be utilized to generate bispecific antibodies of the invention.
- SEEDbodies have, in their constant domains, select IgG residues substituted with IgA residues to promote heterodimerization as described in U.S. Patent No. US20070287170.
- Mutations are typically made at the DNA level to a molecule such as the constant domain of the antibody using standard methods.
- An embodiment of the disclosure provides a method of treating a subject having a cancer, comprising administering to the subject a combination therapy, wherein the combination therapy comprises a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFRj/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (I)
- An embodiment of the disclosure also provides a method of treating a subject having EGFR or c-Met expressing cancer, comprising administering to the subject a combination therapy, wherein the combination therapy comprises a therapeutically effective amount of an isolated bispecific anti-EGFR/c-Met antibody and a therapeutically effective amount of a compound of formula (I)
- An embodiment of the disclosure provides a pharmaceutical combination comprising a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFRj/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (I)
- An embodiment of the disclosure provides a pharmaceutical combination comprising a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (I)
- EGFR isolated bispecific anti-epidermal growth factor receptor
- c-Met hepatocyte growth factor receptor
- An embodiment of the disclosure provides a pharmaceutical combination comprising a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFRj/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (I)
- An embodiment of the disclosure provides use of a combination comprising a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFRj/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (I)
- An embodiment of the disclosure provides use of a combination comprising a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFRj/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (I)
- An embodiment of the disclosure provides a pharmaceutical combination comprising a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (I)
- EGFR isolated bispecific anti-epidermal growth factor receptor
- c-Met hepatocyte growth factor receptor
- An embodiment of the disclosure provides a product containing a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (I)
- EGFR isolated bispecific anti-epidermal growth factor receptor
- c-Met hepatocyte growth factor receptor
- An embodiment of the disclosure provides a product containing a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (I)
- EGFR isolated bispecific anti-epidermal growth factor receptor
- c-Met hepatocyte growth factor receptor
- An embodiment of the disclosure provides an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody, in particular a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody, for use in combination with a compound of formula (I), in particular a therapeutically effective amount of a compound of formula (I),
- An embodiment of the disclosure provides an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody, in particular a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody, for use in combination with a compound of formula (I), in particular a therapeutically effective amount of a compound of formula (I),
- the bispecific anti-EGFR/c-Met antibody and the capmatinib compound, or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof may be administered at the same time (e.g., as part of the same pharmaceutical composition, or in separate pharmaceutical compositions) or at different times, as described herein.
- Pharmaceutically acceptable salt forms include pharmaceutically acceptable acidic/anionic or basic/cationic salts.
- Pharmaceutically acceptable acidic/anionic salts include acetate, benzenesulfonate, benzoate, bicarbonate, bitartrate, bromide, calcium edetate, camsylate, carbonate, chloride, citrate, dihydrochloride, edetate, edisylate, estolate, esylate, fumarate, glyceptate, gluconate, glutamate, glycollylarsanilate, hexylresorcinate, hydrobromide, hydrochloride, hydroxynaphthoate, iodide, isethionate, lactate, lactobionate, malate, maleate, malonate, mandelate, mesylate, methylsulfate, mucate, napsylate, nitrate, pamoate, pantothenate, phosphate/diphosphate, polygalactu
- Pharmaceutically acceptable basic/cationic salts include, the sodium, potassium, calcium, magnesium, diethanolamine, N-methyl-D-glucamine, L-lysine, L-arginine, ammonium, ethanolamine, piperazine and triethanolamine salts.
- a pharmaceutically acceptable acid salt is formed by reaction of the free base form of a compound of Formula (I) with a suitable inorganic or organic acid including, but not limited to, hydrobromic, hydrochloric, sulfuric, nitric, phosphoric, succinic, maleic, formic, acetic, propionic, fumaric, citric, tartaric, lactic, benzoic, salicylic, glutamic, aspartic, p-toluenesulfonic, benzenesulfonic, methanesulfonic, ethanesulfonic, naphthalenesulfonic such as 2-naphthalenesulfonic, or hexanoic acid.
- a suitable inorganic or organic acid including, but not limited to, hydrobromic, hydrochloric, sulfuric, nitric, phosphoric, succinic, maleic, formic, acetic, propionic, fumaric, citric, tartaric, lactic, benzo
- a pharmaceutically acceptable acid addition salt of a compound of Formula (I) can comprise or be, for example, a hydrobromide, hydrochloride, sulfate, nitrate, phosphate, succinate, maleate, formarate, acetate, propionate, fumarate, citrate, tartrate, lactate, benzoate, salicylate, glutamate, aspartate, p-toluenesulfonate, benzenesulfonate, methanesulfonate, ethanesulfonate, naphthalenesulfonate (e.g., 2-naphthalenesulfonate) orhexanoate salt.
- the free acid or free base forms of the compound of formula (I) may be prepared from the corresponding base addition salt or acid addition salt form, respectively.
- a compound of the invention in an acid addition salt form may be converted to the corresponding free base form by treating with a suitable base (e.g., ammonium hydroxide solution, sodium hydroxide, and the like).
- a suitable base e.g., ammonium hydroxide solution, sodium hydroxide, and the like.
- a compound of the invention in a base addition salt form may be converted to the corresponding free acid by treating with a suitable acid (e.g., hydrochloric acid, etc.).
- the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is represented by a compound of formula (II)
- the cancer is c-Met expressing cancer.
- the cancer comprises a c-Met exon 14 skipping mutation.
- Examplary c-Met exon 14 skipping mutations include mutations in the c-Met gene wherein at least a portion of exon 14 of c-Met is removed, or a c-Met transcript that is spliced to remove at least a portion of exon 14 of c-Met.
- the portion deleted may include a portion that encodes the negative regulation site Tyr 1003 in the juxtamembrane region of the c-Met protein.
- the exon 14 region of c-Met gene encompasses nucleotides 3284 to 3424 in the full-length nucleotide sequences of GenBank Accession No. NM 000245, or residues 964 to 1009 in the full-length c-Met amino acid sequences of GenBank Accession No. NP 000236.
- Various mutations at the DNA level can result in exon 14 skipping (see, e.g., Kong-Beltran et al. (2006) Cancer Res. 66; Dhanasekharan et al
- the bispecific anti-EGFR/c-Met antibody comprises a first domain that binds EGFR comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 and a second domain that binds c-Met comprising the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10, the LCDR2 of SEQ ID NO: 11 and the LCDR3 of SEQ ID NO: 12.
- the first domain that binds EGFR comprises a heavy chain variable region (VH) of SEQ ID NO: 13 and a light chain variable region (VL) of SEQ ID NO: 14 and the second domain that binds c-Met comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- the bispecific anti-EGFR/c-Met antibody is an IgGl isotype. Some variation exists within the IgGl constant domain (e.g. well-known allotypes), with variation at positions 214, 356, 358, 422, 431, 435 o 436 (residue numbering according to the EU numbering) (see e.g. IMGT Web resources; IMGT Repertoire (IG and TR); Proteins and alleles; allotypes).
- the bispecific anti-EGFR c-Met antibody may be any IgGl allotype, such as Glml7, Glm3, Glml, Glm2, Glm27 or Glm28.
- the bispecific anti-EGFR c-Met antibody comprises the HC1 of SEQ ID NO: 17, the LC1 of SEQ ID NO: 18, the HC2 of SEQ ID NO: 19 and the LC2 of SEQ ID NO: 20.
- the subject has a newly diagnosed cancer.
- the subject has a newly diagnosed c-Met expressing cancer.
- the subject has a newly diagnosed cancer, comprising a c- Met exon 14 skipping mutation.
- the subject is tyrosine kinase inhibitor (TKI) treatment naive.
- TKI tyrosine kinase inhibitor
- the subject is EGFR tyrosine kinase inhibitor (TKI) treatment naive.
- TKI EGFR tyrosine kinase inhibitor
- the subject is resistant or relapsed to treatment with a EGFR TKI.
- the subject is resistant or has acquired resistance to treatment with a prior anti-cancer therapy.
- the prior anti-cancer therapy is chemotherapy, a targeted anti-cancer therapy or a kinase inhibitor.
- the TKI is an inhibitor of EGFR, c-Met, HER2, HER3, HER4, VEGFR or AXL.
- the TKI is erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, poziotinib, criotinib, cabozantinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitinib.
- the cancer is a non-small cell lung cancer (NSCLC), an epithelial cell cancer, a breast cancer, an ovarian cancer, a lung cancer, a lung adenocarcinoma, a squamous ell lung cancer, a small cell lung cancer, a colorectal cancer, an anal cancer, a prostate cancer, a kidney cancer, a bladder cancer, a head and neck cancer, a pharynx cancer, a cancer of the nose, a pancreatic cancer, a skin cancer, an oral cancer, a cancer of the tongue, an esophageal cancer, a vaginal cancer, a cervical cancer, a cancer of the spleen, a testicular cancer, a gastric cancer, a cancer of the thymus, a colon cancer, a thyroid cancer, a liver cancer, a hepatocellular carcinoma (HCC) or sporadic or hereditary papillary renal cell carcinoma (PRCC).
- NSCLC non-small cell
- the cancer is the NSCLC. In some embodiments, the cancer is the epithelial cell cancer. In some embodiments, the cancer is the breast cancer. In some embodiments, the cancer is the ovarian cancer. In some embodiments, the cancer is the lung cancer. In some embodiments, the cancer is the lung adenocarcinoma. In some embodiments, the cancer is the squamous cell lung cancer. In some embodiments, the cancer is the small cell lung cancer. In some embodiments, the cancer is the colorectal cancer. In some embodiments, the cancer is the anal cancer. In some embodiments, the cancer is the prostate cancer. In some embodiments, the cancer is the kidney cancer. In some embodiments, the cancer is the bladder cancer.
- the cancer is the head and neck cancer. In some embodiments, the cancer is the pharynx cancer. In some embodiments, the cancer is the cancer of the nose. In some embodiments, the cancer is the pancreatic cancer. In some embodiments, the cancer is the skin cancer. In some embodiments, the cancer is the oral cancer. In some embodiments, the cancer is the cancer of the tongue. In some embodiments, the cancer is the esophageal cancer. In some embodiments, the cancer is the vaginal cancer. In some embodiments, the cancer is the cervical cancer. In some embodiments, the cancer is the cancer of the spleen. In some embodiments, the cancer is the testicular cancer. In some embodiments, the cancer is the gastric cancer.
- the cancer is the cancer of the thymus. In some embodiments, the cancer is the colon cancer. In some embodiments, the cancer is the thyroid cancer. In some embodiments, the cancer is the liver cancer. In some embodiments, the cancer is the HCC. In some embodiments, the cancer is the PRCC.
- the NSCLC includes squamous cell carcinoma, adenocarcinoma, and large cell carcinoma. In some embodiments, cells of the NSCLC have an epithelial phenotype. In some embodiments, the NSCLC has acquired resistance to treatment with one or more EGFR inhibitors.
- the bispecific anti-EGFR/c-Met antibody is administered at a dose of between about 200 mg and about 2000 mg.
- the bispecific anti-EGFR/c-Met antibody is administered at a dose of between about 350 mg and about 1400 mg.
- the bispecific anti-EGFR c-Met antibody is administered at a dose of about 200 mg, about 210 mg, about 220 mg, about 230 mg, about 240 mg, about 250 mg, about 260 mg, about 270 mg, about 280 mg, about 290 mg, about 300 mg, about 310 mg, about 320 mg, about 330 mg, about 340 mg, about 350 mg, about 360 mg, about 370 mg, about 380 mg, about 390 mg, about 400 mg, about 410 mg, about 420 mg, about 430 mg, about 440 mg, about 450 mg, about 460 mg, about 470 mg, about 480 mg, about 490 mg, about 500 mg, about 510 mg, about 520 mg, about 530 mg, about 540 mg, about 550 mg, about 560 mg, about 570 mg, about 580 mg, about 590 mg, about 600 mg, about 610 mg, about 620 mg, about 630 mg, about 640 mg, about 650 mg, about 660 mg, about 670 mg
- 1690 mg about 1700 mg, about 1710 mg, about 1720 mg, about 1730 mg, about 1740 mg, about 1750 mg, about 1760 mg, about 1770 mg, about 1780 mg, about 1790 mg, about 1800 mg, about 1810 mg, about 1820 mg, about 1830 mg, about 1840 mg, about 1850 mg, about 1860 mg, about 1870 mg, about 1880 mg, 1890 mg, about 1900 mg, about 1910 mg, about 1920 mg, about 1930 mg, about 1940 mg, about 1950 mg, about 1960 mg, about
- the bispecific anti-EGFR/c-Met antibody is administered at a dose of about 350 mg, about 700 mg, about 1050 mg or about 1400 mg. In some embodiments, the bispecific anti-EGFR/c-Met antibody is administered at a dose of about 350 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 700 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 1050 mg. In some embodiments, the bispecific anti-EGFR c-Met antibody is administered at a dose of about 1400 mg.
- the bispecific anti-EGFR c-Met antibody is administered once a week.
- the bispecific anti-EGFR c-Met antibody is administered once in two weeks.
- the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 50 mg and about 500 mg.
- Doses of the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof described herein refer to the amount of free base of the compound of formula (I) in the dose.
- the dose comprises the hydrochloride of capmatinib (compound of formula (II)
- the dose refers to the amount of capmatinib free base (compound of formula (I)).
- the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 50 mg and about 400 mg. In some embodiments, the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 100 mg and about 500 mg. In some embodiments, the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 200 mg and about 450 mg.
- the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 250 mg and about 300 mg. In some embodiments, the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 100 mg and about 400 mg.
- the compound of formula (II) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 50 mg and about 400 mg. In some embodiments, the compound of formula (II) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 100 mg and about 500 mg. In some embodiments, the compound of formula (II) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 200 mg and about 450 mg.
- the compound of formula (II) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 250 mg and about 300 mg. In some embodiments, the compound of formula (II) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of between about 100 mg and about 400 mg.
- the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered at a dose of at least about 50 mg, at least about 100 mg, at least about 150 mg, at least about 200 mg, at least about 250 mg, at least about 300 mg, at least about 350 mg, at least about 400 mg, at least about 450 mg, or at least about 500 mg.
- the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered once a day.
- the compound of formula (I) or solvate, hydrate, tautomer, or a pharmaceutically acceptable salt thereof is administered twice a day.
- the subject is further administered a third anti-cancer therapy.
- the third anti-cancer therapy is chemotherapy, a targeted anti-cancer therapy or a kinase inhibitor.
- Anti-cancer therapies that may be administered in combination with the bispecific anti-EGFR/c-Met antibody and capmatinib in the methods of the disclosure include any one or more of the chemotherapeutic drugs or other anti-cancer therapeutics known to those of skill in the art.
- Chemotherapeutic agents are chemical compounds useful in the treatment of cancer and include growth inhibitory agents or other cytotoxic agents and include alkylating agents, anti-metabolites, anti-microtubule inhibitors, topoisomerase inhibitors, receptor tyrosine kinase inhibitors, angiogenesis inhibitors and the like.
- chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN®); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamine; nitrogen mustards such as chlorambucil, chlomaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine,
- anti-hormonal agents that act to regulate or inhibit hormone action on tumors
- anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4- hydroxytamoxifen, trioxifene, keoxifene, LY 117018, onapristone, and toremifene (FARESTON®); and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- the bispecific anti-EGFR c-Met antibody is administered prior to administration of the compound of formula (I) or solvate, hydrate, tautomer or a pharmaceutically acceptable salt thereof.
- the bispecific anti-EGFR c-Met antibody is administered prior to administration of the compound of formula (II) or solvate, hydrate, or tautomer thereof.
- the bispecific anti-EGFR c-Met antibody is administered after administration of the compound of formula (I) or solvate, hydrate, tautomer or a pharmaceutically acceptable salt thereof.
- the bispecific anti-EGFR c-Met antibody is administered after administration of the compound of formula (II) or solvate, hydrate, or tautomer thereof.
- the bispecific anti-EGFR c-Met antibody is administered one or more times after administering the compound of formula (I) or solvate, hydrate, tautomer or a pharmaceutically acceptable salt thereof. In some embodiments, the bispecific anti-EGFR/c-Met antibody is administered one or more times after administering the compound of formula (II) or solvate, hydrate, or tautomer thereof.
- the bispecific anti-EGFR/c-Met antibody is administered two, three, four, five, six, seven, eight, nine, ten or more times after administering the compound of formula (I) or solvate, hydrate, tautomer or a pharmaceutically acceptable salt thereof.
- the bispecific anti-EGFR c-Met antibody is administered two, three, four, five, six, seven, eight, nine, ten or more times after administering the compound of formula (II) or solvate, hydrate, or tautomer thereof.
- the bispecific anti-EGFR c-Met antibody is administered intermittently after administering the compound of formula (I) or solvate, hydrate, tautomer or a pharmaceutically acceptable salt thereof.
- the bispecific anti-EGFR c-Met antibody is administered intermittently after administering the compound of formula (II) or solvate, hydrate, or tautomer thereof.
- the length of time between administrations of the bispecific anti-EGFR c-Met antibody and the compound of formula (I) or solvate, hydrate, tautomer or a pharmaceutically acceptable salt thereof, or formula (II) or solvate, hydrate, or tautomer thereof, or the third anti-cancer therapy may be a few minutes, such as about 1, 2, 5, 10, 30 or 60 minutes or several hours, such as about 2, 4, 6, 10, 12, 24 or 36 hours, or such as about 2, 4, 7, 14, 21,
- the bispecific anti-EGFR c-Met antibody and the compound of formula (I) or solvate, hydrate, tautomer or a pharmaceutically acceptable salt thereof or the third anticancer agent may be administered as pharmaceutical compositions.
- the bispecific anti-EGFR c-Met antibody and the compound of formula (II) or solvate, hydrate, or tautomer thereof or the third anti-cancer agent may be administered as pharmaceutical compositions.
- the bispecific anti-EGFR c-Met antibody may be formulated into a pharmaceutical composition comprising the bispecific anti-EGFR c-Met antibody and a pharmaceutically acceptable carrier.
- the pharmaceutically acceptable carrier may be one or more diluents, adjuvants, excipients, vehicles and the like.
- vehicles may be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- 0.4% saline and 0.3% glycine may be used to formulate the bispecific anti- EGFR c-Met antibody.
- These solutions are sterile and generally free of particulate matter. They may be sterilized by conventional, well-known sterilization techniques (e.g., filtration).
- the bispecific anti-EGFR/c-Met antibody is administered by an intravenous injection. In some embodiments, the bispecific anti-EGFR/c-Met antibody is administered by a subcutaneous injection.
- the compound of formula (I), or solvate, hydrate, tautomer or a pharmaceutically acceptable salt thereof, or the compound of formula (II) or solvate, hydrate, or tautomer thereof is administered as an oral preparation, such as for example a solid oral preparation, such as a powder, capsule and tablet.
- suitable carriers and additives include starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like.
- Solid oral preparations may also be coated with substances such as sugars or be enteric -coated to modulate major site of absorption.
- the carrier may comprise sterile water and other excipients may be added to increase solubility or preservation.
- injectable suspensions or solutions may also be prepared utilizing aqueous carriers along with appropriate additives.
- Suitable vehicles and formulations, inclusive of other human proteins, e.g., human semm albumin, are described, for example, in e.g. Remington: The Science and Practice of Pharmacy, 21 st Edition, Troy, D.B. ed., Lipincott Williams and Wilkins, Philadelphia, PA 2006, Part 5, Pharmaceutical Manufacturing pp 691-1092, See especially pp. 958-989.
- compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, stabilizing, thickening, lubricating and coloring agents, etc.
- concentration of the bispecific anti-EGFR c-Met antibody in the pharmaceutical formulation may vary, from less than about 0.5%, usually to at least about 1% to as much as 15%, 20%, 30%, 40% or 50% by weight and may be selected primarily based on required dose, fluid volumes, viscosities, etc., according to the particular mode of administration selected.
- compositions comprising solid forms may contain about 0.1 mg to about 2000 mg, such as about 1 mg, about 5 mg, about 10 mg, about 25 mg, about 50 mg, about 100 mg, about 150 mg, about 200 mg, about 300 mg, about 500 mg about 600 mg or about 1000 mg of active ingredient.
- the mode of administration may be any suitable route that delivers the antibody to the host, such as parenteral administration, e.g., intradermal, intramuscular, intraperitoneal, intravenous or subcutaneous, pulmonary, transmucosal (oral, intranasal, intravaginal, rectal), using a formulation in a tablet, capsule, solution, powder, gel, particle; and contained in a syringe, an implanted device, osmotic pump, cartridge, micropump; or other means appreciated by the skilled artisan, as well known in the art.
- parenteral administration e.g., intradermal, intramuscular, intraperitoneal, intravenous or subcutaneous
- pulmonary transmucosal
- oral intranasal, intravaginal, rectal
- Site specific administration may be achieved by for example intratumoral, intrarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracerebellar, intracerebroventricular, intracolic, intracervical, intragastric, intrahepatic, intracardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravascular, intravesical, intralesional, vaginal, rectal, buccal, sublingual, intranasal, or transdermal delivery.
- a method of treating a subject having cancer that is positive for a c-Met exon 14 skipping mutation comprising administering a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody to the subject having cancer that is positive for c-Met exon 14 skipping mutation.
- EGFR bispecific anti-epidermal growth factor receptor
- c-Met hepatocyte growth factor receptor
- a method of treating a subject having cancer with a bispecific anti-EGFR/c-Met antibody comprising: a) providing a biological sample from the subject; b) determining presence or absence of a c-Met exon 14 skipping mutation in the sample; c) administering or providing for administration the bispecific anti-EGFR/c-Met antibody to the subject determined to have c-Met exon 14 skipping mutation.
- the bispecific anti-EGFR c-Met antibody comprises a first domain that specifically binds EGFR and a second domain that specifically binds c-Met, wherein the first domain comprises a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, aHCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 a second domain that binds c-Met, wherein the second domain comprises the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10, the LCDR2 of SEQ ID NO: 11 and the LCDR3 of SEQ ID NO: 12.
- HCDR1 heavy chain complementarity determining region 1
- Embodiment 3 wherein the first domain that specifically binds EGFR comprises a heavy chain variable region (VH) of SEQ ID NO: 13 and a light chain variable region (VL) of SEQ ID NO: 14, and the second domain that specifically binds c- Met comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- VH heavy chain variable region
- VL light chain variable region
- the bispecific anti-EGFR/c- Met antibody comprises a first heavy chain (HC1) of SEQ ID NO: 17, a first light chain (LC1) of SEQ ID NO: 18, a second heavy chain (HC2) of SEQ ID NO: 19 and a second light chain (LC2) of SEQ ID NO: 20.
- the bispecific anti-EGFR/c- Met antibody comprises a biantennary glycan structure with a fucose content of about between 1% to about 15%.
- Embodiment 8 The method of Embodiment 8, wherein the one or more prior anti-cancer therapies comprises one or more chemotherapeutic agents, checkpoint inhibitors, targeted anticancer therapies or kinase inhibitors, or any combination thereof.
- Embodiment 8 wherein the one or more prior anti-cancer thearpies comprises carboplatin, paclitaxel, gemcitabine, cisplatin, vinorelbine, docetaxel, palbociclib, crizotinib, PD-(L)1 axis inhibitor, an inhibitor of EGFR, an inhibitor of c-Met, an inhibitor of HER2, an inhibitor of HER3, an inhibitor of HER4, an inhibitor of VEGFR, an inhibitor of AXL, erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, capmatinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitin
- cancer that is positive for c-Met exon 14 skipping mutation is positive for CDK4 amplification, EGFR amplification, KRAS amplification, MDM2 amplification, TERT amplification, NFl R2450*; RAD50 L597Vfs*5, MET c.3082 +3 A>G, EGFR, wild-type EGFR, an EGFR activating mutation, increased levels of circulating HGF, c-MET amplification or a mutant KRAS, or any combination thereof.
- Embodiment 12 wherein the EGFR activating mutation comprises L718Q, G719A, G719X (X being any amino acid), L861X (X being any amino acid), L858R, E746K, L747S, E749Q, A750P, A755V, V765M, C797S, L858P or T790M substitution, deletion of E746-A750, deletion of R748-P753, insertion of Ala (A) between M766 and A767, insertion of Ser, Val and Ala (SVA) between S768 and V769, insertion of Asn and Ser (NS) between P772 and H773, insertion of one or more amino acids between D761 and E762, A763 and Y764, Y764 and Y765, M766 and A767, A767 and V768, S768 and V769, V769 and D770, D770 and N771, N771 and P772, P77
- the cancer is lung cancer, gastric cancer, colorectal cancer, brain cancer, cancer derived from epithelial cells, breast cancer, ovarian cancer, colorectal cancer, anal cancer, prostate cancer, kidney cancer, bladder cancer, head and neck cancer, pharynx cancer, cancer of the nose, pancreatic cancer, skin cancer, oral cancer, cancer of the tongue, esophageal cancer, vaginal cancer, cervical cancer, cancer of the spleen, testicular cancer, gastric cancer, cancer of the thymus, colon cancer, thyroid cancer, liver cancer, hepatocellular carcinoma (HCC) or sporadic or hereditary papillary renal cell carcinoma (PRCC), or any combination thereof.
- HCC hepatocellular carcinoma
- PRCC hereditary papillary renal cell carcinoma
- lung cancer is non-small cell lung cancer (NSCLC), small cell lung cancer (SCLC) or lung adenocarcinoma, pulmonary sarcomatoid carcinoma or any combination thereof.
- NSCLC non-small cell lung cancer
- SCLC small cell lung cancer
- lung adenocarcinoma pulmonary sarcomatoid carcinoma or any combination thereof.
- Embodiment 18 The method of Embodiment 17, wherein the one or more anti-cancer therapies comprises chemotherapy, radiation therapy, surgery, a targeted anti-cancer therapy or a kinase inhibitor, or any combination thereof.
- the kinase inhibitor is an inhibitor of EGFR, an inhibitor of c-Met, an inhibitor of HER2, an inhibitor of HER3, an inhibitor of HER4, an inhibitor of VEGFR or an inhibitor of AXL.
- Embodiment 19 The method of Embodiment 19, wherein the kinase inhibitor is erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, capmatinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitinib. 21) The method of any one of Embodiments 1-20, wherein the c-Met exon 14 skipping mutation is a de novo mutation.
- a method of treating a subject having cancer that is positive for a c-Met exon 14 skipping mutation comprising administering to the subject a combination therapy, wherein the combination therapy comprises a therapeutically effective amount of an isolated bispecific anti-epidermal growth factor receptor (EGFR)/hepatocyte growth factor receptor (c-Met) antibody and a therapeutically effective amount of a compound of formula (II)
- EGFR isolated bispecific anti-epidermal growth factor receptor
- c-Met hepatocyte growth factor receptor
- the bispecific anti-EGFR/c-Met antibody comprises a first domain that binds EGFR comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 and a second domain that binds c-Met comprising the HCDR1 of SEQ ID NO: 7, the HCDR2 of SEQ ID NO: 8, the HCDR3 of SEQ ID NO: 9, the LCDR1 of SEQ ID NO: 10, the LCDR2 of SEQ ID NO: 11 and the LCDR3 of SEQ ID NO: 12.
- Embodiment 28 The method of Embodiment 27, wherein the first domain that binds EGFR comprises a heavy chain variable region (VH) of SEQ ID NO: 13 and a light chain variable region (VL) of SEQ ID NO: 14 and the second domain that binds c-Met comprises the VH of SEQ ID NO: 15 and the VL of SEQ ID NO: 16.
- VH heavy chain variable region
- VL light chain variable region
- the bispecific anti- EGFR/c-Met antibody comprises a first heavy chain (HC1) of SEQ ID NO: 17, a first light chain (LC1) of SEQ ID NO: 18, a second heavy chain (HC2) of SEQ ID NO: 19 and a second light chain (LC2) of SEQ ID NO: 20.
- Embodiment 34 The method of Embodiment 33, wherein the one or more prior anti-cancer therapies comprises one or more chemotherapeutic agents, checkpoint inhibitors, targeted anti-cancer therapies or kinase inhibitors, or any combination thereof.
- Embodiment 35 The method of Embodiment 33, wherein the one or more prior anti-cancer thearpies comprises carboplatin, paclitaxel, gemcitabine, cisplatin, vinorelbine, docetaxel, palbociclib, crizotinib, PD-(L)1 axis inhibitor, an inhibitor of EGFR, an inhibitor of c-Met, an inhibitor of HER2, an inhibitor of HER3, an inhibitor of HER4, an inhibitor of VEGFR, an inhibitor of AXL, erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitini
- cancer that is positive for c-Met exon 14 skipping mutation is positive for CDK4 amplification, EGFR amplification, KRAS amplification, MDM2 amplification, TERT amplification, NF1 R2450*; RAD50 L597Vfs*5, MET c.3082 +3 A>G, EGFR, wild-type EGFR, an EGFR activating mutation, increased levels of circulating HGF, c-MET amplification or a mutant KRAS, or any combination thereof.
- Embodiment 38 The method of Embodiment 37, wherein the EGFR activating mutation comprises L718Q, G719A, G719X (X being any amino acid), L861X (X being any amino acid), L858R, E746K, L747S, E749Q, A750P, A755V, V765M, C797S, L858P or T790M substitution, deletion of E746-A750, deletion of R748-P753, insertion of Ala (A) between M766 and A767, insertion of Ser, Val and Ala (SVA) between S768 and V769, insertion of Asn and Ser (NS) between P772 and H773, insertion of one or more amino acids between D761 and E762, A763 and Y764, Y764 and Y765, M766 and A767, A767 and V768, S768 and V769, V769 and D770, D770 and N771, N771 and
- the cancer is lung cancer, gastric cancer, colorectal cancer, brain cancer, cancer derived from epithelial cells, breast cancer, ovarian cancer, colorectal cancer, anal cancer, prostate cancer, kidney cancer, bladder cancer, head and neck cancer, pharynx cancer, cancer of the nose, pancreatic cancer, skin cancer, oral cancer, cancer of the tongue, esophageal cancer, vaginal cancer, cervical cancer, cancer of the spleen, testicular cancer, gastric cancer, cancer of the thymus, colon cancer, thyroid cancer, liver cancer, hepatocellular carcinoma (HCC) or sporadic or hereditary papillary renal cell carcinoma (PRCC), or any combination thereof.
- HCC hepatocellular carcinoma
- PRCC hereditary papillary renal cell carcinoma
- lung cancer is non-small cell lung cancer (NSCLC), small cell lung cancer (SCLC) or lung adenocarcinoma, pulmonary sarcomatoid carcinoma or any combination thereof.
- NSCLC non-small cell lung cancer
- SCLC small cell lung cancer
- lung adenocarcinoma pulmonary sarcomatoid carcinoma or any combination thereof.
- Embodiment 43 The method of Embodiment 42, wherein the one or more anti-cancer therapies comprises chemotherapy, radiation therapy, surgery, a targeted anti-cancer therapy or a kinase inhibitor, or any combination thereof.
- the kinase inhibitor is an inhibitor of EGFR, an inhibitor of c-Met, an inhibitor of HER2, an inhibitor of HER3, an inhibitor of HER4, an inhibitor of VEGFR or an inhibitor of AXL.
- kinase inhibitor is erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, lazertinib, poziotinib, criotinib, cabozantinib, capmatinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib or sunitinib.
- Example 1 JNJ-372 was effective in c-Met driven PDX models
- JNJ-372 Efficacy of JNJ-372 was tested in a PDX model harboring c-Met exon 14 skipping mutation. As comparator, erlotinib and cetuximab were used. For these experiments, JNJ- 372 was expressed in wild-type CHO cells and hence exhibited fucose content characteristics of a wild-type CHO cell.
- Tumor fragments from stock mice inoculated with selected primary human NSCLC tissues were harvested and used for inoculation into BALB/c nude mice. Each mouse was inoculated subcutaneously at the right flank with primary human NSCLC model (LU2503) fragment (passage 5, 2-4 mm in diameter) for tumor development. The treatment was started when the average tumor size reached about 151.5 mm 3 . Mice were allocated randomly into four experimental groups according to their tumor sizes. Each group consisted of 10 mice, 5 mice per cage. The day was denoted as day 0. The test articles were administrated to the tumor-bearing mice from day 0 through day 25. according to predetermined regimen shown in Table 1. Table 1.
- the tumor size was then used for calculations of both T-C and T/C values.
- T-C was calculated with T as the time (in days) required for the mean tumor size of the treatment group to reach a predetermined size (e.g., 1000 mm 3 ), and C was the time (in days) for the mean tumor size of the control group to reach the same size.
- T/C value (in percent) was an indication of anti-tumor effectiveness; T and C were the mean volume of the treated and control groups, respectively, on a given day.
- the study was terminated when the scheduled dosing was completed and the mean tumor burden in the vehicle treated control group reaches a value of 2000 mm 3 .
- the differences between the mean values of tumor size for comparing groups were analyzed for significance using SPSS software. P ⁇ 0.05 was considered to be statistically significant.
- Tumor sizes (expressed as mean + SEM) within the treatment groups at different time points during treatment are shown in Table 2. Tumor growth inhibition is summarized in Table 3. The T-C was calculated as tumors reached the predetermined size (1000 mm 3 ). FIG. 1 shows the tumor volume overtime. Table 2.
- JNJ-372 treatment with lOmg/kg, BIW x 4 produced significant anti-tumor response compared with vehicle treatment (P ⁇ 0.0001).
- JNJ-372 treatment at lOmg/kg, BIW x 4, produced a mean tumor size of 48.35 mm 3 and its T-C could not be calculated because of the shrinkage of tumors.
- JNJ-372 at lOmg/kg, BIW x 4 produced significant anti-tumor activity against the primary human NSCLC tumor xenograft model LU2503 in this study.
- JNJ-372 used in clinical studies was produced in a cell line resulting in antibody fucose content of below 15%.
- JNJ-372 Eligible patients with metastatic NSCLC received escalating doses (from 140 mg to 1750 mg) of JNJ-372 in Part 1 or at the RP2D in Part 2 expansion cohorts.
- JNJ-372 was administered intravenously (IV) in 28-day cycles on days 1, 2, 8, 15 and 22 of cycle 1 and days 1 and 15 during subsequent cycles.
- Disease response was evaluated every 6 weeks by investigator assessment according to RECIST v. 1.1 criteria.
- Patient 1 A 76-year-old with heavily pre-treated metastatic adenosquamous NSCLC with a MET exon 14 skipping mutation was first diagnosed with metastatic disease. Following multiple chemotherapy regimens (carboplatin and paclitaxel, carboplatin and gemcitabine, cisplatin and vinorelbine, docetaxel), local radiation and nivolumab, next generation sequencing (NGS) revealed MET exl4 deletion; NF1 R2450; CDK4 amplification; MDM2 amplification; EPHB1 amplification; FRS2 amplification; RAD50 N598fs*4. The patient received palbociclib on trial without response followed by crizotinib for 11 months with stable disease as best response.
- NGS next generation sequencing
- Post crizotinib biopsy of the left axillary lymph node revealed metastatic lung adenosquamous carcinoma and next- generation sequencing (HopeSeq) demonstrated CDK4 amplification; EGFR amplification; KRAS amplification; MET exl4 deletion, MET c.3082 +3A>G; MDM2 amplification; NF1 R2450*; RAD50 L597Vfs*5; TF.RT amplification; PD-L1 5%.
- the patient started JNJ-372 at 1050 mg in the Phase 1 portion of the study.
- FIG. 2 shows a CT scan that indicated partial response at 6 weeks and 12 weeks post treatment.
- Example 3 JNJ-372 was efficacious in the inhibition of c-Met driven NSCLC PDX tumor growth in LU2503.
- LU2503 tumor fragments from stock tumor bearing mice were harvested and used for inoculation into BALB/c nude mice. Each mouse was inoculated subcutaneously in the right rear flank with PDX LU2503 tumor fragments (approximately 2-3 mm in diameter) for tumor development.
- the tumor growth was measured twice weekly. Once the tumor volume reached approximately 200 mm3, animals were randomly allocated to relevant study groups with 8 mice each group. The randomization was performed according to the tumor size of each group and the day of randomization was denoted as day 0. The treatments were started on the same day of randomization per study design in Table 4.
- the study endpoints were to compare the tumor growth in each group at the end of treatments and the subsequent tumor outgrowth after dosing stopped.
- Tumor sizes (expressed as mean + SEM) within the treatment groups at different time points during treatment are shown in Table 5 and the tumor growth curves over time are shown in FIG. 3A.
- TGI% Mean tumor volume ⁇ Standard Error of Mean (SEM).
- Tumor growth inhibition is summarized in Table 6.
- T 13 or 0
- c P value were calculated by performing Conover’s non-parametric many-to-one comparison test.
- both JNJ-372 at lOmg/kg, BIW x 3 and capmatinib at lOmg/kg, BID x 21 produced significant anti-tumor activity (108.44% and 109.78% TGI respectively) against the primary LU2503 human NSCLC tumor xenograft in this study.
- all 8 capmatinib-treated animals showed faster tumor regrowth comparing to JNJ-372-treated animals (6 out of 8 animals showed no measurable tumors till study end).
- Example 4 JNJ-372 in combination with MET-TKI (capmatinib) showed deeper and more durable tumor inhibition in LU2503.
- a follow up study in LU2503 included the combination treatment of JNJ-372 and capmatinib to see whether there is any additional benefit when JNJ-372 is combined with MET-TKI.
- Tumor fragments from stock mice (passage R18P2) were subcutaneously implanted into the right rear flank of B ALB/c nude mice for tumor propagation.
- Treatments were started in the efficacy study according to the following design (Table 7) when the average tumor size reached about 150-200 mm 3 .
- Animals were randomly allocated into four experimental groups according to their tumor sizes with 8 mice each group. The tumor size was measured and body weight monitored twice per week asdescribed in Example 3. Tumor sizes (expressed as mean + SEM) within the treatment groups at different time points during treatment are shown in Table 8, the tumor growth curve over time is shown in FIG. 4A, and the body weight change was graphed in
- FIG. 4B Table 7. i.p. ⁇ . intraperitoneal; p.o. : oral administration; BIW: bi-weekly; BID: twice a day Table 8.
- a Data represent Mean tumor volume ⁇ SEM; BIW: bi-weekly; BID: twice a day
- the isotype and vehicle control group was terminated when the average tumor size reached 1400 mm3 on day 14.
- Statistical analysis was performed using the same methods as in Example 3.
- T 14 or 0
- c P value were calculated by performing Conover’s non-parametric many-to-one comparison test.
- JNJ-372 and capmatinib produced longer and more durable response compared to mono-therapy in this study. 2 out of 8 animals in JNJ-372 group regrew around day 70 and all animals in the combo group remained tumor-free till study end (over 120 days).
- the protein levels were quantified using Image J software and normalized to loading control b-tubulin in FIG 6A-6B and FIG 7A-7C Table 10.
- JNJ-372 caused total EGFR and MET receptor downmodulation.
- JNJ-372/capmatinib combo group decreased both EGFR and MET receptor level further.
- Similar synergistic effect in the phospho-EGFR and phospho-MET signaling inhibition was also observed in the combination group.
- the more robust PD marker inhibition in the combination treatment is consistent with the observed efficacy and warrant further investigation.
- Example 5 JNJ-372 was efficacious in the inhibition of tumor growth in DFCI-440 MET exonl4 skipping NSCLC PDX model.
- the tumor growth was measured twice weekly. Once the tumor volume reached 150 - 250 mm3, animals were randomly allocated to relevant study groups with 8 mice each group. The day of randomization was denoted as day 0; treatments were started on day 0 and followed dosing schedule in Table 11.
- LFI low fucose isotype
- HPMC hydroxypropyl-methylcellulose
- i.p. intraperitoneal
- p.o. oral administration
- the study endpoints were to compare the tumor growth in each group at the end of treatments and the subsequent tumor outgrowth after dosing stopped.
- both JNJ-372 and capmatinib as single agents significantly inhibited DFCI-440 tumor growth and caused these tumors to regress.
- the tumors in mice treated with JNJ-372 or capmatinib as single agents resumed growth.
- Treatment with the combination of JNJ-372 + capmatinib also effectively inhibited tumor growth and resulted in tumor regression, however, the combination treatment eliminated completely the tumors in 8 out of 8 mice, even after cessation of treatment.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Analytical Chemistry (AREA)
- Pathology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Urology & Nephrology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Oncology (AREA)
- Hospice & Palliative Care (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Cell Biology (AREA)
- General Engineering & Computer Science (AREA)
- Endocrinology (AREA)
- Mycology (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PH1/2022/552076A PH12022552076A1 (en) | 2020-02-12 | 2021-02-12 | TREATMENT OF PATIENTS HAVING c-MET EXON 14 SKIPPING MUTATIONS |
| CN202180014425.6A CN115087449A (zh) | 2020-02-12 | 2021-02-12 | 具有c-MET外显子14跳跃突变的患者的治疗 |
| KR1020227031382A KR20220140794A (ko) | 2020-02-12 | 2021-02-12 | c-MET 엑손 14 스킵핑 돌연변이를 갖는 환자의 치료 |
| AU2021220009A AU2021220009A1 (en) | 2020-02-12 | 2021-02-12 | Treatment of patients having c-Met exon 14 skipping mutations |
| CA3170675A CA3170675A1 (en) | 2020-02-12 | 2021-02-12 | Treatment of patients having c-met exon 14 skipping mutations |
| IL295516A IL295516A (en) | 2020-02-12 | 2021-02-12 | Treatment of patients with exon 14 c-met skipping mutations |
| MX2022009906A MX2022009906A (es) | 2020-02-12 | 2021-02-12 | Tratamiento de pacientes que tienen mutaciones de omisión del exón 14 de c-met. |
| JP2022548572A JP7783182B2 (ja) | 2020-02-12 | 2021-02-12 | c-METエクソン14スキッピング変異を有する患者の治療 |
| EP21754569.8A EP4103190A4 (en) | 2020-02-12 | 2021-02-12 | Treatment of patients having c-met exon 14 skipping mutations |
| BR112022015140A BR112022015140A2 (pt) | 2020-02-12 | 2021-02-12 | Tratamento de pacientes que têm mutações de salto do éxon 14 de c-met |
| JOP/2022/0184A JOP20220184A1 (ar) | 2020-02-12 | 2022-08-11 | علاج مصابي السرطان ممن لديهم طفرات تخطي c-Met إكسون14 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202062975406P | 2020-02-12 | 2020-02-12 | |
| US62/975,406 | 2020-02-12 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021161262A1 true WO2021161262A1 (en) | 2021-08-19 |
Family
ID=77272416
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2021/051203 Ceased WO2021161262A1 (en) | 2020-02-12 | 2021-02-12 | TREATMENT OF PATIENTS HAVING c-MET EXON 14 SKIPPING MUTATIONS |
Country Status (13)
| Country | Link |
|---|---|
| US (1) | US12215160B2 (https=) |
| EP (1) | EP4103190A4 (https=) |
| JP (1) | JP7783182B2 (https=) |
| KR (1) | KR20220140794A (https=) |
| CN (1) | CN115087449A (https=) |
| AU (1) | AU2021220009A1 (https=) |
| BR (1) | BR112022015140A2 (https=) |
| CA (1) | CA3170675A1 (https=) |
| IL (1) | IL295516A (https=) |
| JO (1) | JOP20220184A1 (https=) |
| MX (1) | MX2022009906A (https=) |
| PH (1) | PH12022552076A1 (https=) |
| WO (1) | WO2021161262A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023105479A1 (en) * | 2021-12-09 | 2023-06-15 | Janssen Biotech, Inc. | Use of amivantamab to treat colorectal cancer |
| US11879013B2 (en) | 2019-05-14 | 2024-01-23 | Janssen Biotech, Inc. | Combination therapies with bispecific anti-EGFR/c-Met antibodies and third generation EGFR tyrosine kinase inhibitors |
| US12215160B2 (en) | 2020-02-12 | 2025-02-04 | Janssen Biotech, Inc. | Treatment of patients having c-met exon 14 skipping mutations |
| US12599606B2 (en) | 2019-05-14 | 2026-04-14 | Janssen Biotech, Inc. | Therapies with 3rd generation EGFR tyrosine kinase inhibitors |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20240151848A (ko) * | 2022-03-07 | 2024-10-18 | 메뤼스 엔.페. | Egfr 및 cmet에 결합하는 항체를 사용한 치료 |
| CN115354079A (zh) * | 2022-09-05 | 2022-11-18 | 复旦大学附属中山医院 | 一种用于检测egfr靶向药物治疗适用性的试剂盒 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140141000A1 (en) * | 2012-11-21 | 2014-05-22 | Janssen Biotech, Inc. | Bispecific EGFR/C-Met Antibodies |
| US20180057595A1 (en) * | 2015-03-16 | 2018-03-01 | Celldex Therapeutics, Inc. | Anti-MET Antibodies and Methods of Use Thereof |
| US20190371432A1 (en) * | 2017-05-19 | 2019-12-05 | Guardant Health, Inc. | Methods and systems for detecting insertions and deletions |
Family Cites Families (64)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0281604B1 (en) | 1986-09-02 | 1993-03-31 | Enzon Labs Inc. | Single polypeptide chain binding molecules |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| ES2156149T3 (es) | 1992-12-04 | 2001-06-16 | Medical Res Council | Proteinas de union multivalente y multiespecificas, su fabricacion y su uso. |
| AUPO591797A0 (en) | 1997-03-27 | 1997-04-24 | Commonwealth Scientific And Industrial Research Organisation | High avidity polyvalent and polyspecific reagents |
| US7083784B2 (en) | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| US7595378B2 (en) | 2001-06-13 | 2009-09-29 | Genmab A/S | Human monoclonal antibodies to epidermal growth factor receptor (EGFR) |
| FR2858235B1 (fr) | 2003-07-31 | 2006-02-17 | Lab Francais Du Fractionnement | Utilisation d'anticorps optimises en adcc pour traiter les patients faibles repondeurs |
| HN2004000285A (es) | 2003-08-04 | 2006-04-27 | Pfizer Prod Inc | ANTICUERPOS DIRIGIDOS A c-MET |
| US7767792B2 (en) | 2004-02-20 | 2010-08-03 | Ludwig Institute For Cancer Research Ltd. | Antibodies to EGF receptor epitope peptides |
| ES2425749T3 (es) | 2004-03-31 | 2013-10-17 | The General Hospital Corporation | Método para determinar la respuesta del cáncer a tratamientos dirigidos al receptor del factor de crecimiento epidérmico |
| EP3042964A1 (en) | 2004-06-04 | 2016-07-13 | Genentech, Inc. | Egfr mutations |
| WO2006028936A2 (en) | 2004-09-02 | 2006-03-16 | Genentech, Inc. | Heteromultimeric molecules |
| CN102580084B (zh) | 2005-01-21 | 2016-11-23 | 健泰科生物技术公司 | Her抗体的固定剂量给药 |
| EP2505591A1 (en) | 2005-02-11 | 2012-10-03 | Memorial Sloan-Kettering Cancer Center | Methods and compositions for detecting a drug resistant EGFR mutant |
| MX2007009963A (es) | 2005-02-24 | 2007-09-26 | Amgen Inc | Mutaciones del receptor del factor de crecimiento epidermico. |
| NZ561211A (en) | 2005-03-25 | 2011-03-31 | Genentech Inc | Methods and compositions for modulating hyperstabilized C-met |
| AU2006232287B2 (en) | 2005-03-31 | 2011-10-06 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| PT1999154E (pt) | 2006-03-24 | 2013-01-24 | Merck Patent Gmbh | Domínios proteicos heterodiméricos modificados |
| JP2009541275A (ja) | 2006-06-22 | 2009-11-26 | ノボ・ノルデイスク・エー/エス | 二重特異性抗体の生産 |
| US20080226635A1 (en) | 2006-12-22 | 2008-09-18 | Hans Koll | Antibodies against insulin-like growth factor I receptor and uses thereof |
| AU2008239594B2 (en) | 2007-04-13 | 2013-10-24 | Beth Israel Deaconess Medical Center | Methods for treating cancer resistant to ErbB therapeutics |
| KR20100058509A (ko) | 2007-07-31 | 2010-06-03 | 메디뮨 엘엘씨 | 다중특이적 에피토프 결합 단백질 및 이의 용도 |
| US7892770B2 (en) | 2007-08-24 | 2011-02-22 | Van Andel Research Institute | Monoclonal antibody which binds cMet (HGFR) in formalin-fixed and paraffin-embedded tissues and related methods |
| AU2008343589A1 (en) | 2007-12-19 | 2009-07-09 | Centocor Ortho Biotech Inc. | Design and generation of human de novo pIX phage display libraries via fusion to pIX or pVII, vectors, antibodies and methods |
| US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| US8227577B2 (en) | 2007-12-21 | 2012-07-24 | Hoffman-La Roche Inc. | Bivalent, bispecific antibodies |
| US8242247B2 (en) | 2007-12-21 | 2012-08-14 | Hoffmann-La Roche Inc. | Bivalent, bispecific antibodies |
| US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| HRP20241208T1 (hr) | 2010-04-20 | 2024-11-22 | Genmab A/S | Heterodimerni proteini koji sadrže fc fragment protutijela i postupci za njihovu proizvodnju |
| US8962808B2 (en) | 2010-05-05 | 2015-02-24 | The Research Foundation For The State University Of New York | EGFR-related polypeptides and methods of use |
| ES2758994T3 (es) | 2010-11-05 | 2020-05-07 | Zymeworks Inc | Diseño anticuerpo heterodimérico estable con mutaciones en el dominio Fc |
| ES2860748T3 (es) | 2011-01-24 | 2021-10-05 | Gilead Sciences Inc | Anticuerpos selectivos para células que presentan EGFR con alta densidad |
| BR112013023918A2 (pt) | 2011-03-25 | 2016-12-13 | Glenmark Pharmaceuticals Sa | imunoglobulina hetero-dimérica ou fragmento hetero-dimérico da mesma, método para produzir uma imunoglobulina hetero-dimérica ou fragmento hetero-dimérico da mesma, método para construir uma interface proteína-proteína de um domínio de uma proteína de múltiplos domínios e uso de um domínio doador de um primeiro e de um segundo membro de uma super-família de imunoglobulina de ocorrência natural |
| KR20130036993A (ko) | 2011-10-05 | 2013-04-15 | 삼성전자주식회사 | c-Met의 SEMA 도메인 내의 에피토프에 특이적으로 결합하는 항체 |
| RU2654567C2 (ru) | 2011-10-11 | 2018-05-21 | Дженентек, Инк. | Улучшенная сборка биспецифических антител |
| BR112014010580B1 (pt) | 2011-11-04 | 2021-01-12 | Zymeworks, Inc. | constructo de fc heteromultimérico isolado, composição, uso de um constructo de fc heteromultimérico isolado, composição de ácido nucléico e método para expressar o constructo de fc heteromultimérico isolado |
| US20170275367A1 (en) | 2012-11-21 | 2017-09-28 | Janssen Biotech, Inc. | Bispecific EGFR/C-Met Antibodies |
| WO2015043614A1 (en) | 2013-09-26 | 2015-04-02 | Biontech Ag | Methods and compositions for prediction of therapeutic efficacy of cancer treatments and cancer prognosis |
| CN106456749B (zh) | 2014-03-11 | 2021-03-30 | 小利兰·斯坦福大学托管委员会 | 抗SIRPα抗体和双特异性巨噬细胞增强型抗体 |
| WO2015188777A1 (en) | 2014-06-12 | 2015-12-17 | Shanghai Fochon Pharmaceutical Co Ltd | Certain protein kinase inhibitors |
| HUE054848T2 (hu) | 2014-10-13 | 2021-09-28 | Yuhan Corp | Vegyületek és készítmények EGFR mutáns kináz aktivitás módosítására |
| EP3221358B1 (en) | 2014-11-18 | 2021-07-21 | Janssen Pharmaceutica, N.V. | Cd47 antibodies, methods, and uses |
| SMT202100230T1 (it) | 2015-10-23 | 2021-07-12 | Fundacio Inst De Recerca Biomedica Irb Barcelona | Molecole di legame che inibiscono la crescita tumorale |
| EP3383435A4 (en) | 2015-11-30 | 2019-07-10 | Medimmune, LLC | OPTIMIZED RATES OF AMINO ACIDS AND SUGARS AS AMORPHOUS STABILIZING COMPOUNDS IN PHARMACEUTICAL COMPOSITIONS HAVING HIGH CONCENTRATIONS IN PROTEIN-BASED THERAPEUTICS |
| US10813933B2 (en) | 2016-05-17 | 2020-10-27 | Japanese Foundation For Cancer Research | Therapeutic agent for lung cancer that has acquired EGFR-TKI resistance |
| CN116333130A (zh) | 2016-05-24 | 2023-06-27 | 英斯梅德股份有限公司 | 抗体及其制备方法 |
| GB201611123D0 (en) | 2016-06-27 | 2016-08-10 | Euremab Srl | Anti met antibodiesand uses thereof |
| HUE054571T2 (hu) | 2016-09-14 | 2021-09-28 | Merck Patent Gmbh | Hatékony tumorgátlásra szolgáló C-MET elleni ellenanyagok és ellenanyag-drog konjugátumaik |
| KR102771603B1 (ko) | 2016-11-17 | 2025-02-24 | 더 보드 오브 리젠츠 오브 더 유니버시티 오브 텍사스 시스템 | Egfr 또는 her2 엑손 20 돌연변이를 갖는 암 세포에 대한 항종양 활성을 갖는 화합물 |
| CA3054381A1 (en) | 2017-02-22 | 2018-08-30 | University Of Saskatchewan | Egfr-binding agents and uses thereof |
| AR111469A1 (es) | 2017-04-21 | 2019-07-17 | Yuhan Corp | Sal de un compuesto del derivado de aminopiridina, una forma cristalina de la misma, y un proceso para preparar la misma |
| WO2019022486A1 (en) | 2017-07-28 | 2019-01-31 | Yuhan Corporation | NOVEL INTERMEDIATES USEFUL FOR SYNTHESIZING AMINOPYRIMIDINE DERIVATIVES, PROCESS FOR PREPARING THE SAME, AND PROCESS FOR PREPARING AMINOPYRIMIDINE DERIVATIVES THEREWITH |
| MY201038A (en) | 2017-07-28 | 2024-01-31 | Yuhan Corp | Intermediates useful for the synthesis of a selective inhibitor against protein kinase and processes for preparing the same |
| SG11201913517UA (en) | 2017-07-28 | 2020-02-27 | Yuhan Corp | Improved process for preparing aminopyrimidine derivatives |
| WO2020055643A2 (en) | 2018-09-04 | 2020-03-19 | Rain Therapeutics Inc. | Compounds, compositions and methods for treating or preventing her-driven cancers |
| KR20200043618A (ko) | 2018-10-18 | 2020-04-28 | 주식회사유한양행 | 아미노피리미딘 유도체 또는 이의 염을 포함하는 경구투여용 약학 조성물 |
| BR112021016149A2 (pt) | 2019-02-26 | 2021-10-13 | Janssen Biotech, Inc. | Terapias de combinação e estratificação de pacientes com anticorpos biespecíficos anti-egfr/c-met |
| MX2021011948A (es) | 2019-03-29 | 2022-01-04 | Univ Texas | Compuestos con actividad antitumoral contra células cancerígenas que llevan inserciones de exon 20 effr o her2. |
| CA3132816A1 (en) | 2019-04-17 | 2020-10-22 | Board Of Regents, The University Of Texas System | Compounds with anti-tumor activity against cancer cells bearing tyrosine kinase inhibitor resistant egfr mutations |
| EP3956035A4 (en) | 2019-04-17 | 2023-01-25 | Board of Regents, The University of Texas System | ANTI-CANCER LINKS WITH TYROSINE KINASE RESISTANT EGFR MUTATIONS |
| US11850248B2 (en) | 2019-05-14 | 2023-12-26 | Yuhan Corporation | Therapies with 3rd generation EGFR tyrosine kinase inhibitors |
| US11879013B2 (en) | 2019-05-14 | 2024-01-23 | Janssen Biotech, Inc. | Combination therapies with bispecific anti-EGFR/c-Met antibodies and third generation EGFR tyrosine kinase inhibitors |
| JP7783182B2 (ja) | 2020-02-12 | 2025-12-09 | ヤンセン バイオテツク,インコーポレーテツド | c-METエクソン14スキッピング変異を有する患者の治療 |
-
2021
- 2021-02-12 JP JP2022548572A patent/JP7783182B2/ja active Active
- 2021-02-12 PH PH1/2022/552076A patent/PH12022552076A1/en unknown
- 2021-02-12 WO PCT/IB2021/051203 patent/WO2021161262A1/en not_active Ceased
- 2021-02-12 BR BR112022015140A patent/BR112022015140A2/pt unknown
- 2021-02-12 CA CA3170675A patent/CA3170675A1/en active Pending
- 2021-02-12 KR KR1020227031382A patent/KR20220140794A/ko active Pending
- 2021-02-12 AU AU2021220009A patent/AU2021220009A1/en active Pending
- 2021-02-12 IL IL295516A patent/IL295516A/en unknown
- 2021-02-12 EP EP21754569.8A patent/EP4103190A4/en active Pending
- 2021-02-12 US US17/174,386 patent/US12215160B2/en active Active
- 2021-02-12 CN CN202180014425.6A patent/CN115087449A/zh active Pending
- 2021-02-12 MX MX2022009906A patent/MX2022009906A/es unknown
-
2022
- 2022-08-11 JO JOP/2022/0184A patent/JOP20220184A1/ar unknown
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140141000A1 (en) * | 2012-11-21 | 2014-05-22 | Janssen Biotech, Inc. | Bispecific EGFR/C-Met Antibodies |
| US20180057595A1 (en) * | 2015-03-16 | 2018-03-01 | Celldex Therapeutics, Inc. | Anti-MET Antibodies and Methods of Use Thereof |
| US20190371432A1 (en) * | 2017-05-19 | 2019-12-05 | Guardant Health, Inc. | Methods and systems for detecting insertions and deletions |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4103190A4 * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11879013B2 (en) | 2019-05-14 | 2024-01-23 | Janssen Biotech, Inc. | Combination therapies with bispecific anti-EGFR/c-Met antibodies and third generation EGFR tyrosine kinase inhibitors |
| US12448455B2 (en) | 2019-05-14 | 2025-10-21 | Janssen Biotech, Inc. | Combination therapies with bispecific anti-EGFR/c-met antibodies and third generation EGFR tyrosine kinase inhibitors |
| US12599606B2 (en) | 2019-05-14 | 2026-04-14 | Janssen Biotech, Inc. | Therapies with 3rd generation EGFR tyrosine kinase inhibitors |
| US12215160B2 (en) | 2020-02-12 | 2025-02-04 | Janssen Biotech, Inc. | Treatment of patients having c-met exon 14 skipping mutations |
| WO2023105479A1 (en) * | 2021-12-09 | 2023-06-15 | Janssen Biotech, Inc. | Use of amivantamab to treat colorectal cancer |
Also Published As
| Publication number | Publication date |
|---|---|
| BR112022015140A2 (pt) | 2022-10-11 |
| EP4103190A1 (en) | 2022-12-21 |
| PH12022552076A1 (en) | 2023-11-29 |
| JOP20220184A1 (ar) | 2022-08-11 |
| US12215160B2 (en) | 2025-02-04 |
| CA3170675A1 (en) | 2021-08-19 |
| JP7783182B2 (ja) | 2025-12-09 |
| IL295516A (en) | 2022-10-01 |
| KR20220140794A (ko) | 2022-10-18 |
| CN115087449A (zh) | 2022-09-20 |
| AU2021220009A1 (en) | 2022-10-06 |
| JP2023513297A (ja) | 2023-03-30 |
| MX2022009906A (es) | 2022-11-14 |
| EP4103190A4 (en) | 2024-07-03 |
| US20210253717A1 (en) | 2021-08-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12448455B2 (en) | Combination therapies with bispecific anti-EGFR/c-met antibodies and third generation EGFR tyrosine kinase inhibitors | |
| US12215160B2 (en) | Treatment of patients having c-met exon 14 skipping mutations | |
| US12599606B2 (en) | Therapies with 3rd generation EGFR tyrosine kinase inhibitors | |
| US12528869B2 (en) | Treatment of non-small cell lung cancer with EGFR mutations | |
| IL324821A (en) | Methods for treating non-small cell lung cancer (NSCLC) | |
| CA3140360A1 (en) | Combination therapies with bispecific anti-egfr/c-met antibodies and 3rd generation egfr tyrosine kinase inhibitors | |
| CA3220465A1 (en) | Methods for identifying cancer patients for combination treatment | |
| AU2024337472A1 (en) | Methods of treating non-small cell lung cancer | |
| US20220298248A1 (en) | Treatment of Cancers Lacking EGFR- Activating Mutations | |
| EA050376B1 (ru) | ЛЕЧЕНИЕ ПАЦИЕНТОВ, ИМЕЮЩИХ МУТАЦИИ, ВЫЗЫВАЮЩИЕ ПРОПУСК ЭКЗОНА 14 В c-Met | |
| HK40081424A (en) | Treatment of patients having c-met exon 14 skipping mutations | |
| CA3228880A1 (en) | Methods of treating non-small cell lung cancer | |
| WO2026038160A1 (en) | Methods for reducing infusion-related reactions in patients treated with egfr/met bispecific antibodies | |
| EA053046B1 (ru) | Комбинированные терапии с использованием биспецифических антител к egfr/c-met и 3-го поколения ингибиторов тирозинкиназы egfr | |
| EA046908B1 (ru) | Комбинированные терапии с использованием биспецифических антител к egfr/c-met и 3-го поколения ингибиторов тирозинкиназы egfr |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21754569 Country of ref document: EP Kind code of ref document: A1 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022015140 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2022548572 Country of ref document: JP Kind code of ref document: A Ref document number: 3170675 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2022000686 Country of ref document: DZ |
|
| ENP | Entry into the national phase |
Ref document number: 20227031382 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021754569 Country of ref document: EP Effective date: 20220912 |
|
| ENP | Entry into the national phase |
Ref document number: 2021220009 Country of ref document: AU Date of ref document: 20210212 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112022015140 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220729 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522440128 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522440128 Country of ref document: SA |
|
| WWR | Wipo information: refused in national office |
Ref document number: 522440128 Country of ref document: SA |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 792152 Country of ref document: NZ |