Classifications

• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
  • C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P35/00—Antineoplastic agents
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
  • C07K14/70503—Immunoglobulin superfamily
  • C07K14/7051—T-cell receptor (TcR)-CD3 complex
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
  • C07K16/3046—Stomach, Intestines
• • G—PHYSICS
  • G01—MEASURING; TESTING
  • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
  • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
  • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
  • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
  • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
  • G01N33/573—Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
• • G—PHYSICS
  • G01—MEASURING; TESTING
  • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
  • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
  • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
  • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
  • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
  • G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
  • G01N33/5753—Immunoassay; Biospecific binding assay; Materials therefor for cancer of the stomach or small intestine
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
  • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
  • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
  • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
  • C07K2317/52—Constant or Fc region; Isotype
  • C07K2317/524—CH2 domain
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/72—Increased effector function due to an Fc-modification
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
  • C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
  • C07K2317/734—Complement-dependent cytotoxicity [CDC]
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
  • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
• • G—PHYSICS
  • G01—MEASURING; TESTING
  • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
  • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
  • G01N2333/90—Enzymes; Proenzymes
  • G01N2333/914—Hydrolases (3)
  • G01N2333/916—Hydrolases (3) acting on ester bonds (3.1), e.g. phosphatases (3.1.3), phospholipases C or phospholipases D (3.1.4)
• • G—PHYSICS
  • G01—MEASURING; TESTING
  • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
  • G01N2800/00—Detection or diagnosis of diseases
  • G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

• a chimeric molecule comprising an antigen-binding molecule as defined herein and a heterologous moiety.
• Disclosed herein is a method for reducing the expression or activity of ALPPL2 in a cancer cell, the method comprising contacting the cancer cell with an antigen-binding molecule or a chimeric molecule as defined herein.
• Disclosed herein is a method for reducing or inhibiting proliferation, survival and viability of a tumor in a subject, the method comprising administering an antigen- binding molecule or a chimeric molecule as defined herein to the subject.
• Disclosed herein is a method of identifying a subject who is likely to be responsive to treatment with an anti-ALPPL2 antibody, the method comprising detecting ALPPL2 in a sample obtained from the subject, wherein an increased level of ALPPL2 indicates that the subject is likely to be responsive to treatment with the ALPPL2 antibody.
• Figure 6 shows the cross-reactivity of select clones produced from rabbit B cells supernatant to rhesus macaque ortholog identified through FACS screen (A).
• Recombinant humanized C4 and C36 clones binds to CHO cells over-expressed rhesus macaque ortholog but not WT CHO by FACS analysis (B).
• FIG. 8 shows ADCC induction by humanized clones.
• ADCC induction as measured in coculture of high-expressing gastric cancer cell line MKN1 with Jurkats CD16A reporter cells (top row, left), and coculture of low-expressing gastric cancer cell line MKN74 with Jurkats CD16A reporter cells (top row, right).
• Potentiation of ADCC by C4 as measured by CellTiter-Glo assay of gastric cancer cell lines in coculture with primary NK cells (middle row, left), and coculture of ovarian and pancreatic cancer cell lines with Jurkats CD16A reporter cells (middle row, right).
• ADCC enhancement by Fc engineering of humanized C4 as measured in coculture of MKN74 with Jurkats CD16A reporter cells (bottom row).
• Figure 10 shows potent killing of different cancer cell lines by T-cell engagers derived from the humanized clones, as measured by xCELLigence real-time cell analysis of the cancer cells in coculture with expanded human T-cells.
• C4 consistently demonstrated pM killing of gastric, ovarian and pancreatic cancer cell lines, regardless of target expression level.
• ADCC induction by chimerised clones as measured by co-culture of MKN74 with Jurkats CD16A reporter cells is shown (C).
• ELISA shows chimerized C53 and C78 cross-reacted to CHO cells overexpressing rhesus macaque ortholog identified through FACS (D).
• Humanized C53 shows the ALPPL2 specificity by ELISA (E) and co-culture of N87 with Jurkats CD16A reporter cells show that ADCC induction activity (F) is maintained after humanization.
• Humanized C53 demonstrated nM binding affinity towards ALPPL, but not ALPP determined by Biolayer Interferometry, whereas humanized C36 demonstrated similar binding affinity towards ALPPL2 and ALPP (G).
• Humanized C53 has comparable binding affinity as commercial antibody (catalogue number: eBioScience #14-9870-82), and weaker binding affinity as compared to humanized C4 and C36 (B).
• Humanized C36, C4 and C53 show no binding to the naive and CD3/CD28 beads + IL-2 activated human PBMCs (CD4+/CD8+ T cell, B cell, CD1 lb-t- myeloid Mf cells) (C).
• Humanized C36, C4 and C53 shows no binding to the T cell, B cells and myeloid Mf cells (D).
• the present disclosure teaches antigen-binding molecules that specifically binds ALPPL2 and/or ALPP, but not ALPL or ALPI.
• the antigen-binding molecules may bind to ALPPL2 and/or ALPP or a cell expressing ALPPL2 and/or ALPP with an affinity of between about 14 pm to about 10 nM.
• an antigen-binding molecule that specifically binds ALPPL2 and/or but not ALPL or ALPI, comprising: (a) a heavy chain variable region (V H ) comprising VHCDR1, VHCDR2 and VHCDR3 amino acid sequences; and (b) a light chain variable region (V L ) comprising VLCDR1, VLCDR2 and VLCDR3 amino acid sequences; wherein the combination of VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 and VLCDR3 amino acid sequences are shown in any of the rows in Table 1.
• Alkaline phosphatase, placental-like 2 is a member of the alkaline phosphatase (AP) family, consisting of two closely related isoforms expressed in placental trophoblasts (ALPPL2 and ALPP), and two widely expressed members ALPL (tissue-nonspecific, liver/bone/kidney) and ALPI (intestinal).
• the antigen-binding molecule specifically binds to ALPPL2 and/or ALPP.
• the antigen-binding molecule specifically binds to human ALPPL2 and/or human ALPP.
• the antigen-binding molecules have enhanced efficacy due to the high affinity towards ALPPL2 and/or ALPP.
• Table 3 provides some examples of V H , V L sequences of humanized clones
• the antigen-binding molecules of the present invention may be in isolated, purified, synthetic or recombinant form. Suitable antigen-binding molecules may be selected from antibodies and their antigen-binding fragments, including monoclonal antibodies (MAbs), chimeric antibodies, humanized antibodies, human antibodies, and antigen- binding fragments of such antibodies.
• the antigen-binding molecules may be multivalent (e.g., bivalent) or monovalent.
• the antigen-binding molecules comprise an Fc domain.
• the antigen-binding molecules lack an Fc domain.
• the antigen-binding molecules are monovalent antigen-binding molecules (e.g., Fab, scFab, Fab’, scFv, one-armed antibodies, etc.).
• Each light chain comprises a light chain variable region (which may be abbreviated as LCVR or V L ) and a light chain constant region.
• the light chain constant region comprises one domain (CiT).
• the V H and V L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR).
• CDRs complementarity determining regions
• FR framework regions
• Each V H and V L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
• CDRs complementarity determining regions
• CDR1, CDR2, and CDR3 refers to the amino acid residues of an antibody variable domain the presence of which are necessary for antigen-binding.
• Each variable domain typically has three CDR regions identified as CDR1, CDR2 and CDR3.
• Each complementarity determining region may comprise amino acid residues from a “complementarity determining region” as defined for example by Rabat (i.e., about residues 24-34 (LI), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (HI), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain; Rabat et at, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.
• Rabat i.e., about residues 24-34 (LI), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (HI), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain
• Rabat et at, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.
• a complementarity determining region can include amino acids from both a CDR region defined according to Rabat and a hypervariable loop.
• a “chimeric” molecule is one which comprises one or more unrelated types of components or contain two or more chemically distinct regions which can be conjugated to each other, fused, linked, translated, attached via a linker, chemically synthesized, expressed from a nucleic acid sequence, etc.
• a peptide and a nucleic acid sequence a peptide and a detectable label, unrelated peptide sequences, and the like.
• the chimeric molecule comprises amino acid sequences of different origin
• the chimeric molecule includes (1) polypeptide sequences that are not found together in nature (i.e., at least one of the amino acid sequences is heterologous with respect to at least one of its other amino acid sequences), or (2) amino acid sequences that are not naturally adjoined.
• a “chimeric" antibody” as used herein refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
• antigens include, but are not limited to, viral antigens, bacterial antigens, fungal antigens, protozoa and other parasitic antigens, tumor antigens, antigens involved in autoimmune disease, allergy and graft rejection, toxins, and other miscellaneous antigens.
• an “antigen-binding site” refers to the site, i.e., one or more amino acid residues, of an antigenbinding molecule which provides interaction with the antigen.
• the antigen binding site of an antibody comprises amino acid residues from the complementarity determining regions (CDRs).
• CDRs complementarity determining regions
• a native immunoglobulin molecule typically has two antigen binding sites, a Fab molecule typically has a single antigen binding site.
• An antigen-binding site of an antigen-binding molecule described herein typically binds specifically to an antigen and more particularly to an epitope of the antigen.
• antigen-binding fragment As used interchangeably herein to refer to a part of an antigen-binding molecule that participates in antigen-binding. These terms include any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex.
• Non-limiting examples of antigen-binding fragments include: (i) Fab fragments; (ii) F(ab’)2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single-chain Fv (scFv) molecules; (vi) dAb fragments; and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g. , an isolated complementarity determining region (CDR) such as a CDR3 peptide), or a constrained FR3-CDR3-FR4 peptide.
• CDR complementarity determining region
• an antigen-binding fragment of an antibody will typically comprise at least one variable domain.
• the variable domain may be of any size or amino acid composition and will generally comprise at least one CDR which is adjacent to or in frame with one or more framework sequences.
• the V H and V L domains may be situated relative to one another in any suitable arrangement.
• the variable region may be dimeric and contain V H -V H , V H -V L or V L -V L dimers.
• the antigen-binding fragment of an antibody may contain a monomeric V H or V L domain.
• a multispecific antigen-binding molecule will typically comprise at least two different variable domains, wherein each variable domain is capable of specifically binding to a separate antigen or to a different epitope on the same antigen.
• Any multispecific antigen-binding molecule format, including bispecific antigen- binding molecule formats, may be adapted for use in the context of an antigen-binding fragment of an antibody of the present disclosure using routine techniques available in the art.
• variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antigen-binding molecule to antigen.
• the variable domains of the heavy chain and light chain (V H and V L , respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). See, e.g., Kindt et al., Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007).
• a single V H or V L domain may be sufficient to confer antigen-binding specificity.
• constant domains or “constant region” as used herein denotes the sum of the domains of an antibody other than the variable region.
• the constant region is not directly involved in binding of an antigen, but exhibits various immune effector functions.
• the phrase “specifically binds” or “specific binding” refers to a binding reaction between two molecules that is at least two times the background and more typically more than 10 to 100 times background molecular associations under physiological conditions.
• detectable binding agents that are proteins
• specific binding is determinative of the presence of the protein, in a heterogeneous population of proteins and other biologies.
• the specified antigen-binding molecule binds to a particular antigenic determinant, thereby identifying its presence.
• Specific binding to an antigenic determinant under such conditions requires an antigen-binding molecule that is selected for its specificity to that determinant. This selection may be achieved by subtracting out antigen-binding molecules that cross-react with other molecules.
• immunoassay formats may be used to select antigen-binding molecules (e.g., immunoglobulins) [ such that they are specifically immunoreactive with a particular antigen.
• solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988) for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity).
• Methods of determining binding affinity and specificity are also well known in the art (see, for example, Harlow and Lane, supra); Friefelder, “Physical Biochemistry: Applications to biochemistry and molecular biology” (W.H. Freeman and Co. 1976)).
• the antigen-binding molecule specifically binds to a cell expressing ALPPL2 with an affinity of between about 14 pm to about 10 nM.
• modified antibody includes synthetic forms of antibodies which are altered such that they are not naturally occurring, e.g., antibodies that comprise at least two heavy chain portions but not two complete heavy chains (such as, domain deleted antibodies or minibodies); multispecific forms of antibodies (e.g., bispecific, trispecific, etc.) altered to bind to two or more different antigens or to different epitopes on a single antigen); heavy chain molecules joined to scFv molecules and the like. ScFv molecules are known in the art and are described, e.g., in U.S. Pat. No. 5,892,019.
• modified antibody includes multivalent forms of antibodies (e.g., tri valent, tetravalent, etc., antibodies that bind to three or more copies of the same antigen).
• the antigen-binding molecule specifically binds to rhesus macaque ALPPL2.
• the rhesus macaque ALPPL2 may have a sequence as shown in Genbank ID XP_011726419.1.
• the antigen-binding molecule is an antibody or antigen-binding fragment thereof or a chimeric antigen receptor (CAR).
• DIQMTQSPSSLSASVGDRVTITCQAG (SEQ ID NO: 299) ii) a V H FR2 having at least 90% sequence identity to WYQQKPGKVPK (SEQ ID NO: 299)
• the antibody or antigen-binding fragment thereof comprises a CL amino acid sequence having at least 90% (including at least 91% to 100% and all integer percentages therebetween) to: RT V A APS VFIFPPSDEQLKSGT AS VV CLLNNFYPREAKV QWKVDN ALQSGN S QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG EC (SEQ ID NO: 320).
• the antibody has an isotype selected from the group consisting of IgGl, IgG2, IgG3, and IgG4.
• the antibody is an IgGl antibody.
• the antibody may have antibody-dependent cell-mediated cytotoxicity (ADCC) activity and can induce NK cell killing.
• the heavy chain constant region can be a wild-type human Fc region, or a human Fc region that includes one or more amino acid substitutions.
• the antibodies can have mutations that stabilize the disulfide bond between the two heavy chains of an immunoglobulin, such as mutations in the hinge region of IgG4, as disclosed in the art (e.g., Angal et al., 1993. Mol. Immunol., 30:105-08).
• the heavy chain constant region can also have substitutions that modify the properties of the antigen-binding molecule (e.g., decrease one or more of: Fc receptor binding, antigen-binding molecule glycosylation, deamidation, binding to complement, or methionine oxidation).
• the antigen-binding molecules may have mutations such as those described in U.S. Pat. Nos. 5,624,821 and 5,648,260.
• the antigen-binding molecule is modified to reduce or eliminate effector function.
• the antigen-binding molecule of the present invention is a monovalent antigen-binding molecule.
• Non-limiting monovalent antigen-binding molecules include: a Fab fragment consisting of V L , V H , CL and CHI domains; a Fab’ fragment consisting of V L , V H , CL and CHI domains, as well as a portion of a CH2 domain; an Fd fragment consisting of V H and CHI domains; an Fv fragment consisting of V L and V H domains of a single arm of an antibody; a single-chain antibody molecule (e.g., scFab and scFv); a single domain antibody (dAb) fragment (Ward et al., 1989 Nature 341:544-546), which consists of a V H domain; and a one-armed antibody, such as described in US20080063641 (Genentech) or other monovalent antibody, e.g., such as described in W02007048037 (Amgen).
• the antigen-binding molecule comprises a CH2-C H 3 sequence of having at least 70% sequence identity to an amino acid sequence of SEQ ID NO: 321, SEQ ID NO: 322 or SEQ ID NO: 323.
• the antigen-binding molecule is a multivalent antigen-binding molecule, non-limiting examples of which include: immunoglobulins, F(ab’)2, tandem scFv (taFv or scFv2), scFv-Fc, diabody, dAb2/ V H H2, minibodies, ZIP miniantibodies, barnase-barstar dimer, knobs-into-holes derivatives, SEED-IgG, heteroFc-scFv, Fab- scFv, Fab)2/sc(Fab)2, scFv-(TNFa)3, scFv-Jun/Fos, Fab'-Jun/Fos, tribody, trimerbody, tribi-minibody, barnase-barstar trimer, collabody, DNL-F(ab)3, SCFV3-C H 1/CL, Fab- SCFV2, IgG-scFab, IgG-sc
• the multivalent antigen-binding molecule is selected from IgG-like antibodies (e.g., triomab/quadroma, Trion Pharma/Fresenius Biotech; knobs-into-holes, Genentech; CrossMAbs, Roche; electrostatically matched antibodies, AMGEN; LUZ- Y, Genentech; strand exchange engineered domain (SEED) body, EMD Serono; biolonic, Merus; and Fab-exchanged antibodies, Genmab), symmetric IgG-like antibodies (e.g., dual targeting (DT)-Ig, GSK/Domantis; two-in-one antibody, Genentech; crosslinked MAbs, karmanos cancer center; MAb2, F-star; and Coy X-body, Coy X/Pfizer), IgG fusions (e.g., dual variable domain (DVD)-Ig, Abbott; IgG-like bispecific antibodies, Eli Lilly; Ts2Ab, Medi
• the antibody is a bispecific or trispecific antibody. In one embodiment, the antibody is a bispecific antibody.
• the bispecific antibody may be one which comprises a first antigen-binding site that specifically binds ALPPL2 and a second antigen- binding site that specifically binds CD3. In one embodiment, the bispecific antibody is capable of binding to the cancer cell and recruit immune effector cells (e.g. T-cells) to kill the cancer cell.
• immune effector cells e.g. T-cells
• Antigen binding polypeptides that specifically binds CD3 are well known in the art.
• bispecific antibodies of tire invention are formed using a "protuberance-into-cavity” strategy, also referred to as "knobs into holes” that serves to engineer an interface between a first and second polypeptide for hetero-oligomerization.
• the preferred interface comprises at least a part of the CH3 domain of an antibody constant domain.
• the "knobs into holes” mutations in the CH3 domain of an Fe sequence has been reported to greatly reduce the formation of homodimers (See, for example, Merchant et al., 1998, Nature Biotechnology, 16:677-681).
• "Protuberances” are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g. tyrosine or tryptophan).
• Compensatory "cavities" of identical or similar size to the protuberances are optionally created on the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine).
• a suitably positioned and dimensioned protuberance or cavity exists at the interface of either the first or second polypeptide, it is only necessary to engineer a corresponding cavity or protuberance, respectively, at the adjacent interface.
• the protuberance and cavity can be made by synthetic means such as altering the nucleic acid encoding the polypeptides or by peptide synthesis.
• knobs into holes see U.S, Patents 5,731,168; 5,807,706; 5,821,333,
• a general method of preparing a heteromuitimer using the "protuberance -into-cavity" strategy comprises expressing, in one or separate host cells, a polynucleotide encoding a first polypeptide that has been altered from an original polynucleotide to encode a protuberance, and a second polynucleotide encoding a second polypeptide that has been altered from the original polynucleotide to encode the cavity.
• the polypeptides are expressed, either in a common host cell with recovery of the heteromuitimer from the host cell culture, or in separate host cells, with recovery and purification, followed by formation of the heteromuitimer.
• the heteromuitimer formed is a multimeric antibody, for example a bispecific antibody.
• a chimeric molecule comprising an antigen-binding molecule as defined herein and a heterologous moiety.
• the heterologous moiety is a detectable moiety, a half-life extending moiety, or a therapeutic moiety.
• Detectable moieties contemplated by the present invention include for example any species known in the art that is appropriate for diagnostic detection, including in vitro detection and in vivo imaging.
• the detectable moiety may be, for example, a fluorophore, a radionuclide reporter, a metal-containing nanoparticle or microparticle, an ultrasound contrast agent (e.g ., a nanobubble or microbubble) or an optical imaging dye. This also includes contrast particles visible in magnetic resonance imaging (MRI) and magnetic particle imaging (MPI).
• MRI magnetic resonance imaging
• MPI magnetic particle imaging
• Metal-containing nanoparticles or microparticles may be detected using optical imaging, including MRI, which is typically used with paramagnetic nanoparticles or microparticles, and MPI, which is generally used with superparamagnetic particles.
• Ultrasound contrast agents can be detected using ultrasound imaging including contrast-enhanced ultrasound (CEU).
• luciferin 2,3- dihydrophthalazinediones, malate dehydrogenase, urease, peroxidase such as horseradish peroxidase (HRPO), alkaline phosphatase, b-galaetosidase, giucoamyiase, lysozyme, saccharide oxidases (e.g., glucose oxidase, galactose oxidase, and glucose-6- phosphate dehydrogenase), heterocyclic oxidases (such as unease and xanthine oxidase), lactoperoxidase, microperoxidase, and the like.
• HRPO horseradish peroxidase
• alkaline phosphatase b-galaetosidase
• giucoamyiase g., lysozyme
• saccharide oxidases e.g., glucose oxidase, gal
• enzyme-substrate combinations include, for example:
• ⁇ -D-galactosidase ( ⁇ -D-Gal) with a chromogenic substrate (e.g., p-nitrophenyl- ⁇ -D- gaiactosidase) or fluorogenic substrate 4-methylumbeiliferyi- ⁇ -D-gaiactosidase.
• a chromogenic substrate e.g., p-nitrophenyl- ⁇ -D- gaiactosidase
• fluorogenic substrate 4-methylumbeiliferyi- ⁇ -D-gaiactosidase.
• the chimeric molecule comprises at least one heterologous moiety that is a “half-life extending moiety”.
• Half-life extending moieties can comprise, for example, (i) XTEN polypeptides; (ii) Fc; (iii) albumin, (iv) albumin binding polypeptide or fatty acid, (v) the C-terminal peptide (CTP) of the 13 subunit of human chorionic gonadotropin, (vi) PAS; (vii) HAP; (viii) transferrin; (ix) polyethylene glycol (PEG); (x) hydroxyethyl starch (HES), (xi) polysialic acids (PSAs); (xii) a clearance receptor or fragment thereof which blocks binding of the chimeric molecule to a clearance receptor; (xiii) low complexity peptides; (xiv) or any combinations thereof.
• the half-life extending moiety comprises an Fc region. In other embodiments, the half-life extending moiety comprises two Fc regions fused by a linker.
• Exemplary heterologous moieties also include, e.g., FcRn binding moieties (e.g., complete Fc regions or portions thereof which bind to FcRn), single chain Fc regions (scFc regions, e.g., as described in U.S. Publ. No. 20080260738, WO 2008/012543 and WO 2008/1439545), or processable scFc regions.
• At least one heterologous moiety is a therapeutic moiety.
• the therapeutic moiety is selected from an anti-cancer moiety (e.g., cytostatic/toxic, and/or anti-proliferative drugs), an immunotherapeutic moiety and an anti-inflammatory moiety.
• the therapeutic agent is useful in the treatment of cancer.
• anti-cancer agents include chemotherapeutic agents, representative examples of which include antitubulin agents, auristatins, DNA minor groove binders, DNA replication inhibitors, alkylating agents (e.g., platinum complexes such as r/'s-platin, mono(platinum), bis(platinum) and tri- nuclear platinum complexes and carboplatin), anthracyclines, antibiotics, antifolates, antimetabolites, calmodulin inhibitors, chemotherapy sensitizers, duocarmycins, etoposides, fluorinated pyrimidines, ionophores, lexitropsins, maytansinoids, nitrosoureas, platinols, pore-forming compounds, purine antimetabolites, puromycins, radiation sensitizers, rapamycins, steroids, taxanes, topoisomerase inhibitors, vinca alkaloids, or the like.
• alkylating agents e.g., platinum complexes
• the therapeutic moiety is an auristatin such as monomethyl auristatin F (MMAF) or monomethyl auristatin E (MMAE).
• auristatin such as monomethyl auristatin F (MMAF) or monomethyl auristatin E (MMAE).
• Disclosed herein is an isolated polynucleotide comprising a nucleic acid sequence encoding the antigen-binding molecule as defined herein, or the chimeric molecule as defined herein.
• polynucleotide or “nucleic acid” are used interchangeably herein to refer to a polymer of nucleotides, which can be mRNA, RNA, cRNA, cDNA or DNA.
• the term typically refers to polymeric form of nucleotides of at least 10 bases in length, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide.
• the term includes single and double stranded forms of DNA.
• Also disclosed herein is a vector that comprises a nucleic acid encoding the antigen- binding molecule as described herein.
• vector is meant a nucleic acid molecule, preferably a DNA molecule derived, for example, from a plasmid, bacteriophage, or virus, into which a nucleic acid sequence may be inserted or cloned.
• a vector preferably contains one or more unique restriction sites and may be capable of autonomous replication in a defined host cell including a target cell or tissue or a progenitor cell or tissue thereof, or be integrable with the genome of the defined host such that the cloned sequence is reproducible.
• the vector may be an autonomously replicating vector, i.e., a vector that exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a linear or closed circular plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome.
• the vector may contain any means for assuring self-replication.
• the vector may be one which, when introduced into the host cell, is integrated into the genome and replicated together with the chromosome(s) into which it has been integrated.
• a vector system may comprise a single vector or plasmid, two or more vectors or plasmids, which together contain the total DNA to be introduced into the genome of the host cell, or a transposon.
• the choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced.
• the vector may also include a selection marker such as an antibiotic resistance gene that can be used for selection of suitable transformants. Examples of such resistance genes are well known to those of skill in the art.
• a construct comprising a nucleic acid sequence encoding the antigen- binding molecule as defined herein, or the chimeric molecule as defined herein in operable connection with one or more control sequences.
• constructs refers to a recombinant genetic molecule including one or more isolated nucleic acid sequences from different sources.
• constructs are chimeric molecules in which two or more nucleic acid sequences of different origin are assembled into a single nucleic acid molecule and include any construct that contains (1) nucleic acid sequences, including regulatory and coding sequences that are not found together in nature (i.e., at least one of the nucleotide sequences is heterologous with respect to at least one of its other nucleotide sequences), or (2) sequences encoding parts of functional RNA molecules or proteins not naturally adjoined, or (3) parts of promoters that are not naturally adjoined.
• constructs include any recombinant nucleic acid molecule such as a plasmid, cosmid, virus, autonomously replicating polynucleotide molecule, phage, or linear or circular single stranded or double stranded DNA or RNA nucleic acid molecule, derived from any source, capable of genomic integration or autonomous replication, comprising a nucleic acid molecule where one or more nucleic acid molecules have been operably linked.
• Constructs of the present invention will generally include the necessary elements to direct expression of a nucleic acid sequence of interest that is also contained in the construct, such as, for example, a target nucleic acid sequence or a modulator nucleic acid sequence.
• Such elements may include control elements or regulatory sequences such as a promoter that is operably linked to (so as to direct transcription of) the nucleic acid sequence of interest, and often includes a polyadenylation sequence as well.
• the construct may be contained within a vector.
• the vector may include, for example, one or more selectable markers, one or more origins of replication, such as prokaryotic and eukaryotic origins, at least one multiple cloning site, and/or elements to facilitate stable integration of the construct into the genome of a host cell.
• Two or more constructs can be contained within a single nucleic acid molecule, such as a single vector, or can be containing within two or more separate nucleic acid molecules, such as two or more separate vectors.
• An “expression construct” generally includes at least a control sequence operably linked to a nucleotide sequence of interest. In this manner, for example, promoters in operable connection with the nucleotide sequences to be expressed are provided in expression constructs for expression in an organism or part thereof including a host cell.
• conventional compositions and methods for preparing and using constructs and host cells are well known to one skilled in the art, see for example, Molecular Cloning: A Laboratory Manual, 3rd edition Volumes 1, 2, and 3. J. F. Sambrook, D. W. Russell, and N. Irwin, Cold Spring Flarbor Laboratory Press, 2000.
• control element means a nucleic acid sequence (e.g., DNA) necessary for expression of an operably linked coding sequence in a particular host cell.
• control sequences that are suitable for prokaryotic cells for example, include a promoter, and optionally a cis- acting sequence such as an operator sequence and a ribosome binding site.
• Control sequences that are suitable for eukaryotic cells include transcriptional control sequences such as promoters, polyadenylation signals, transcriptional enhancers, translational control sequences such as translational enhancers and internal ribosome binding sites (IRES), nucleic acid sequences that modulate mRNA stability, as well as targeting sequences that target a product encoded by a transcribed polynucleotide to an intracellular compartment within a cell or to the extracellular environment.
• transcriptional control sequences such as promoters, polyadenylation signals, transcriptional enhancers, translational control sequences such as translational enhancers and internal ribosome binding sites (IRES), nucleic acid sequences that modulate mRNA stability, as well as targeting sequences that target a product encoded by a transcribed polynucleotide to an intracellular compartment within a cell or to the extracellular environment.
• host refers to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
• Host cells include “transformants” and “transformed cells”, which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
• a host cell is any type of cellular system that can be used to generate the antigen-binding molecules of the present invention.
• Host cells include cultured cells, e.g., mammalian cultured cells, such as CHO cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
• mammalian cultured cells such as CHO cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
• pharmaceutically acceptable carrier a pharmaceutical vehicle comprised of a material that is not biologically or otherwise undesirable, i.e., the material may be administered to a subject along with the selected active agent without causing any or a substantial adverse reaction.
• Carriers may include excipients and other additives such as diluents, detergents, coloring agents, wetting or emulsifying agents, pH buffering agents, preservatives, and the like.
• the pharmaceutical compositions may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, liposomes and suppositories.
• liquid solutions e.g., injectable and infusible solutions
• dispersions or suspensions e.g., dispersions or suspensions, liposomes and suppositories.
• the preferred form depends on the intended mode of administration and therapeutic application.
• Suitable pharmaceutical compositions may be administered intravenously, subcutaneously or intramuscularly.
• the compositions are in the form of injectable or infusible solutions.
• a preferred mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular).
• the pharmaceutical composition is administered by intravenous infusion or injection.
• the pharmaceutical composition is administered by intramuscular or subcutaneous injection.
• Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
• non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
• Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
• pharmaceutically acceptable carriers include, but are not limited to, 0.01-0.1M and preferably 0.05M phosphate buffer or 0.8% saline.
• Intravenous vehicles include sodium phosphate solutions, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
• Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like.
• Preservatives and other additives can also be present such as for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
• an agent of the present disclosure may be conjugated to a vehicle for cellular delivery.
• the agent may be encapsulated in a suitable vehicle to either aid in the delivery of the agent to target cells, to increase the stability of the agent, or to minimize potential toxicity of the agent.
• a variety of vehicles are suitable for delivering an agent of the present disclosure.
• suitable structured fluid delivery systems may include nanoparticles, liposomes, microemulsions, micelles, dendrimers and other phospholipid-containing systems.
• Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
• An antigen-binding molecule of the present disclosure can be administered on multiple occasions. Intervals between single dosages can be daily, weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of modified polypeptide or antigen in the patient. Alternatively, the antigen-binding molecule can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the polypeptide in the patient.
• Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutically acceptable carrier.
• the specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
• dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
• a method for reducing the expression or activity of ALPPL2 in a cell such as a cancer cell.
• a method for reducing the expression or activity of ALPPL2 in a cancer cell comprising contacting the cancer cell with an antigen-binding molecule, a chimeric molecule, a polynucleotide, a construct, a vector, a host cell or a pharmaceutical composition as defined herein.
• Disclosed herein is a method for reducing the expression or activity of ALPPL2 in a cancer cell, the method comprising contacting the cancer cell with an antigen-binding molecule as defined herein or a chimeric molecule as defined herein.
• cancer examples include, but are not limited to, breast cancer, prostate or testicular cancer, ovarian cancer, cervical cancer, pancreatic cancer, colorectal cancer, lung cancer, hepatocellular cancer, gastric cancer, liver cancer, bladder cancer, cancer of the urinary tract, thyroid cancer, renal cancer, carcinoma, melanoma, brain cancer, non-small cell lung cancer, squamous cell cancer of the head and neck, endometrial cancer, multiple myeloma, rectal cancer, mesothelioma, endometrial cancer and esophageal cancer.
• the cancer is colorectal, endometrial, gastric, mesothelioma, ovarian, pancreatic or testicular cancer.
• a method for reducing or inhibiting proliferation, survival and viability of a tumor in a subject comprising administering an antigen- binding molecule, a chimeric molecule, a polynucleotide, a construct, a vector, a host cell or a pharmaceutical composition as defined herein to the subject.
• the methods as disclosed herein may comprises the administration of a “therapeutically effective amount” of an agent (e.g. an antigen-binding molecule, a chimeric molecule, a polynucleotide, a construct, a vector, a host cell or a pharmaceutical composition) to a subject.
• an agent e.g. an antigen-binding molecule, a chimeric molecule, a polynucleotide, a construct, a vector, a host cell or a pharmaceutical composition
• therapeutically effective amount includes within its meaning a non-toxic but sufficient amount of an agent or compound to provide the desired therapeutic effect. The exact amount required will vary from subject to subject depending on factors such as the species being treated, the age and general condition of the subject, the severity of the condition being treated, the particular agent being administered and the mode of administration and so forth. Thus, it is not possible to specify an exact “effective amount”. However, for any given case, an appropriate “effective amount” may be determined by one of ordinary skill in the art using only routine experimentation
• a method of treating cancer in a subject comprising administering an antigen-binding molecule, a chimeric molecule, a polynucleotide, a construct, a vector, a host cell or a pharmaceutical composition as defined herein to the subject
• Disclosed herein is a method of treating cancer in a subject, wherein the method comprises administering an antigen-binding molecule as defined herein or a chimeric molecule as defined herein to the subject.
• an antigen-binding molecule as defined herein or a chimeric molecule as defined herein for use in the treatment of cancer is disclosed.
• an antigen-binding molecule a chimeric molecule, a polynucleotide, a construct, a vector, a host cell or a pharmaceutical composition in the manufacture of a medicament for the treatment of a subject in need.
• the subject may be a subject suffering from cancer.
• the cancer is a solid cancer.
• kits for detecting cancer comprising an antigen-binding molecule or a chimeric molecule as defined herein
• Disclosed herein is a method of determining the likelihood of a cancer in a subject, wherein the method comprises detecting ALPPL2 in a sample obtained from the subject, wherein an increased level of ALPPL2 in the sample as compared to a reference indicates the likelihood of cancer in the subject.
• the method comprises detecting ALPPL2 with an antigen-binding molecule as defined herein or a chimeric molecule as defined herein.
• Disclosed herein is a method of treating a cancer in a subject, wherein the method comprises a) detecting ALPPL2 in a sample obtained from the subject, wherein an increased level of ALPPL2 in the sample as compared to a reference indicates an increased likelihood of cancer in the subject; and b) treating a subject found to have an increased likelihood of cancer.
• the method comprises detecting ALPPL2 with an antigen-binding molecule as defined herein or a chimeric molecule as defined herein.
• the method comprises treating the subject with an antigen-binding molecule as defined herein or a chimeric molecule as defined herein.
• Disclosed herein is a method of identifying a subject who is likely to be responsive to treatment with an anti-ALPPL2 antibody, the method comprising detecting ALPPL2 in a sample obtained from the subject, wherein an increased level of ALPPL2 indicates that the subject is likely to be responsive to treatment with the ALPPL2 antibody.
• the method comprises detecting ALPPL2 with an antigen-binding molecule as defined herein or a chimeric molecule as defined herein.
• Disclosed herein is a method of identifying and treating a subject who is likely to be responsive to treatment with an anti-ALPPL2 antibody, the method comprising a) detecting ALPPL2 in a sample obtained from the subject, wherein an increased level of ALPPL2 indicates that the subject is likely to be responsive to treatment with the ALPPL2 antibody; and b) treating the subject found likely to be responsive to treatment with the ALPPL2 antibody.
• an agent includes a plurality of agents, including mixtures thereof.
• about is meant a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that varies by as much 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 % to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.
• Target ID and Background Gastric cancer is an East Asia prevalent disease, in which 79% of patients are diagnosed at stage IV with a five-year survival rate is less than 5%.
• a novel cell surface biomarker, ALPPL2 was identified as a target for therapeutic antibodies and companion diagnostics. Biomarker identification was performed on RNA-sequencing data from 19 gastric cancer patients through rigorous bioinformatics analysis.
• ALPPL2 protein expression was validated in 6 gastric cancer cell lines using a commercial anti-ALPPL2 antibody in immunohistochemical staining. Strong membraneous staining was observed in gastric cancer cell lines overexpressing ALPPL2 mRNA while no obvious staining was seen in cell lines which do not overexpress ALPPL2 transcript. Clinical prevalence was also assessed by immunohistochemical staining of 2 gastric tumour microarrays. A total of 198 tumour cores of various stages of the disease and different regions of the stomach were stained. The results indicate that 32 out of 198 cases showed ALPPL2 membranous staining which amounts to 16%. No obvious membranous staining was observed in both adjacent matched and unmatched normal tissues.
• Antibodies against human ALPPL2 were generated by immunizing rabbits with the antigen.
• the rabbit antibodies were isolated by cloning the antibody genes directly from rabbit single B cells.
• the gene was synthesized and cloned into the expression vector for recombinant antibody production.
• the surface plasmon reasonance data in Figure 4 shows that the antibody disclosed in prior art exhibits non-specific binding to ALPI but not the antibodies of the present invention.
• the IHC activity of the antibodies was evaluated (Figure 5). Antigen retrieval by Proteinase-K digestion, but not heat mediated antigen retrieval, enabled detection. C36, C45 and Cl 30 enabled detection in ALPPL2 +ve cell lines (SCH) and formalin fixed paraffin embedded (FFPE) human tumor tissues by IHC. This shows that the antibodies may have diagnostic applications in patient stratification and therapeutic applications for the treatment of ALPPL2/ALPP +ve tumors, including gastric cancer, ovarian cancer, colorectal cancer, pancreatic cancer, endometrial cancer, mesothelioma and testicular cancer. C36 shows negative staining in all normal tissues except placenta, suggesting ALPPL/ALPP has no/low expression in normal tissues. This is also indicative the optimal therapeutic window of these antibodies in the clinic.
• the antibodies were further evaluated for cross-reactivity to non-human primate orthologs (Figure 6). Select clones showed reactivity to rhesus macaque ortholog.
• Select clones (C4, C15, 031, 02, 08, C36 andC53) were humanized by grafting the CDRs to a human IgGl framework. These humanized clones were shown to retain high ALPP/ALPPL2 affinity using surface plasmon reasonance ( Figure 7). Surface plasmon resonance was studied using Biacore T200. Ligands (e.g. ALPPL2 or ALPP) were immobilized on biosensors CM5 chips captured with the streptavidin. Ligands-loaded sensors were then incubated with different concentrations of analyte (recombinant expressed humanized antibody clones) to measure affinity.
• analyte recombinant expressed humanized antibody clones
• the therapeutic efficacy of the humanized clones was tested by first evaluating antibody-dependent cellular toxicity by co-culture of reporter or primary NK cells with cancer cell lines (Figure 8).
• C4 resulted in the most potent ADCC induction in both gastric cancer cell lines with high and low target expression, when compared to the other clones.
• the potency of C4 was confirmed in a co-culture assay of primary NK cells with different gastric cancer cell lines.
• C4 achieved near complete killing of a high expressing cell line, and showed potency (maximum % kill and EC50) that was proportional to the target expression level.
• C4 was also tested in a reporter assay and induction of ADCC with different ovarian and pancreatic cancer cell lines was confirmed.
• the Fc region of humanized C4 was further engineered to enhance ADCC.
• Reporter assay confirmed more the humanized C4 with engineered Fc more potently induced ADCC with a gastric cancer cell liner
• Chimerized and humanized C53 clone demonstrated binding specificity towards AFPPF2 but not AFPP ( Figure 12).
• Chimerized C53 is also cross-reactive towards rhesus macaque ortholog.
• Binding affinity of humanized C53 as compared to humanized C36 to AFPPF and AFPP was performed using Biolayer Interferometry.
• biotinylated ligands i.e. ALPPL2 or ALPP
• Ligands-loaded sensors were then incubated with different concentrations of analyte (recombinantly expressed humanized antibody clones) in the buffer.
• Humanized C53 antibody demonstrated nM binding affinity towards ALPPL but not ALPP as determined Biolayer Interferometry
• humanized C36 demonstrated similar binding affinity towards ALPPL2 and ALPP.

Landscapes

• Health & Medical Sciences (AREA)
• Life Sciences & Earth Sciences (AREA)
• Chemical & Material Sciences (AREA)
• Immunology (AREA)
• Engineering & Computer Science (AREA)
• Molecular Biology (AREA)
• General Health & Medical Sciences (AREA)
• Medicinal Chemistry (AREA)
• Organic Chemistry (AREA)
• Hematology (AREA)
• Urology & Nephrology (AREA)
• Biomedical Technology (AREA)
• Biochemistry (AREA)
• Cell Biology (AREA)
• Biotechnology (AREA)
• Analytical Chemistry (AREA)
• Physics & Mathematics (AREA)
• Food Science & Technology (AREA)
• General Physics & Mathematics (AREA)
• Pathology (AREA)
• Microbiology (AREA)
• Biophysics (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Genetics & Genomics (AREA)
• Public Health (AREA)
• Veterinary Medicine (AREA)
• Animal Behavior & Ethology (AREA)
• Chemical Kinetics & Catalysis (AREA)
• General Chemical & Material Sciences (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• Pharmacology & Pharmacy (AREA)
• Gastroenterology & Hepatology (AREA)
• Toxicology (AREA)
• Zoology (AREA)
• Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
• Peptides Or Proteins (AREA)
• Medicines Containing Material From Animals Or Micro-Organisms (AREA)
• Micro-Organisms Or Cultivation Processes Thereof (AREA)
• Medicinal Preparation (AREA)
• Preparation Of Compounds By Using Micro-Organisms (AREA)

Priority Applications (18)

Applications Claiming Priority (2)

Publications (1)

Family

ID=77199411

Family Applications (1)

Country Status (19)

Cited By (1)

Citations (1)

Family Cites Families (5)

• 2021
  • 2021-02-05 US US17/798,025 patent/US20230080224A1/en active Pending
  • 2021-02-05 JP JP2022548123A patent/JP2023512827A/ja active Pending
  • 2021-02-05 IL IL295291A patent/IL295291A/en unknown
  • 2021-02-05 MX MX2022009709A patent/MX2022009709A/es unknown
  • 2021-02-05 AU AU2021217919A patent/AU2021217919A1/en active Pending
  • 2021-02-05 PH PH1/2022/552038A patent/PH12022552038A1/en unknown
  • 2021-02-05 PE PE2022001547A patent/PE20221781A1/es unknown
  • 2021-02-05 CR CR20220441A patent/CR20220441A/es unknown
  • 2021-02-05 CN CN202180017750.8A patent/CN115380050A/zh active Pending
  • 2021-02-05 BR BR112022015540A patent/BR112022015540A2/pt unknown
  • 2021-02-05 WO PCT/SG2021/050061 patent/WO2021158178A1/en not_active Ceased
  • 2021-02-05 KR KR1020227030781A patent/KR20220139930A/ko active Pending
  • 2021-02-05 EP EP21751256.5A patent/EP4100443A4/en active Pending
  • 2021-02-05 CA CA3170141A patent/CA3170141A1/en active Pending
• 2022
  • 2022-07-28 JO JOP/2022/0175A patent/JOP20220175A1/ar unknown
  • 2022-08-05 CL CL2022002114A patent/CL2022002114A1/es unknown
  • 2022-08-05 DO DO2022000159A patent/DOP2022000159A/es unknown
  • 2022-08-08 EC ECSENADI202261867A patent/ECSP22061867A/es unknown
  • 2022-08-23 CO CONC2022/0011944A patent/CO2022011944A2/es unknown
• 2024
  • 2024-07-09 CL CL2024002074A patent/CL2024002074A1/es unknown
  • 2024-07-09 CL CL2024002073A patent/CL2024002073A1/es unknown
• 2025
  • 2025-06-06 DO DO2025000135A patent/DOP2025000135A/es unknown
  • 2025-10-14 JP JP2025172731A patent/JP2026027248A/ja active Pending

Patent Citations (1)

Non-Patent Citations (4)

Also Published As

Similar Documents

Legal Events