WO2021156832A1 - Use of mirna-485 inhibitors for treating amyotrophic lateral sclerosis (als) - Google Patents

Use of mirna-485 inhibitors for treating amyotrophic lateral sclerosis (als) Download PDF

Info

Publication number
WO2021156832A1
WO2021156832A1 PCT/IB2021/050975 IB2021050975W WO2021156832A1 WO 2021156832 A1 WO2021156832 A1 WO 2021156832A1 IB 2021050975 W IB2021050975 W IB 2021050975W WO 2021156832 A1 WO2021156832 A1 WO 2021156832A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
mir
nucleotides
aspects
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2021/050975
Other languages
English (en)
French (fr)
Inventor
Jin-Hyeob RYU
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biorchestra Co Ltd
Original Assignee
Biorchestra Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Biorchestra Co Ltd filed Critical Biorchestra Co Ltd
Priority to AU2021215407A priority Critical patent/AU2021215407A1/en
Priority to MX2022009451A priority patent/MX2022009451A/es
Priority to KR1020227030526A priority patent/KR20220154105A/ko
Priority to EP21751058.5A priority patent/EP4100068A4/en
Priority to CN202180026758.0A priority patent/CN115461086A/zh
Priority to US17/760,342 priority patent/US20230131083A1/en
Priority to CA3166603A priority patent/CA3166603A1/en
Priority to JP2022547888A priority patent/JP2023513189A/ja
Publication of WO2021156832A1 publication Critical patent/WO2021156832A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/41641,3-Diazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/455Nicotinic acids, e.g. niacin; Derivatives thereof, e.g. esters, amides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/7125Nucleic acids or oligonucleotides having modified internucleoside linkage, i.e. other than 3'-5' phosphodiesters
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/10Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • A61K47/183Amino acids, e.g. glycine, EDTA or aspartame
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/22Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/30Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
    • A61K47/32Macromolecular compounds obtained by reactions only involving carbon-to-carbon unsaturated bonds, e.g. carbomers, poly(meth)acrylates, or polyvinyl pyrrolidone
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/10Dispersions; Emulsions
    • A61K9/107Emulsions ; Emulsion preconcentrates; Micelles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/10Dispersions; Emulsions
    • A61K9/107Emulsions ; Emulsion preconcentrates; Micelles
    • A61K9/1075Microemulsions or submicron emulsions; Preconcentrates or solids thereof; Micelles, e.g. made of phospholipids or block copolymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/51Nanocapsules; Nanoparticles
    • A61K9/5107Excipients; Inactive ingredients
    • A61K9/513Organic macromolecular compounds; Dendrimers
    • A61K9/5146Organic macromolecular compounds; Dendrimers obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyethylene glycol, polyamines, polyanhydrides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/88Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation using microencapsulation, e.g. using amphiphile liposome vesicle
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0089Oxidoreductases (1.) acting on superoxide as acceptor (1.15)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y115/00Oxidoreductases acting on superoxide as acceptor (1.15)
    • C12Y115/01Oxidoreductases acting on superoxide as acceptor (1.15) with NAD or NADP as acceptor (1.15.1)
    • C12Y115/01001Superoxide dismutase (1.15.1.1)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/60Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/11Antisense
    • C12N2310/113Antisense targeting other non-coding nucleic acids, e.g. antagomirs
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/14Type of nucleic acid interfering nucleic acids [NA]
    • C12N2310/141MicroRNAs, miRNAs

Definitions

  • the present disclosure provides the use of a miR-485 inhibitor (e.g, polynucleotide encoding a nucleotide molecule comprising at least one miR-485 binding site) for the treatment of amyotrophic lateral sclerosis (ALS).
  • a miR-485 inhibitor e.g, polynucleotide encoding a nucleotide molecule comprising at least one miR-485 binding site
  • ALS amyotrophic lateral sclerosis
  • Sirtulin 1 also known as NAD-dependent deacetylase sirtuin-1 is an enzyme that in humans is encoded by the SIRT1 gene. It belongs to a family of nicotinamide adenine dinucleotide (NAD)-dependent histone deacetylases and can deacetylate a variety of substrates. Rahman, S., etal, Cell Communication and Signaling 9 :11 (2011). Accordingly, sirtulin 1 has been described as playing a role in a broad range of physiological functions, including control of gene expression, metabolism, and aging. And, abnormal sirtulin activity has been associated with certain human diseases (e.g, neurodegenerative diseases such as ALS).
  • ALS neurodegenerative diseases
  • ALS Amyotrophic lateral sclerosis
  • MND motor neuron disease
  • Lou Gehrig's disease is a progressive neurodegenerative disease that affects nerve cells (particularly those that control voluntary muscle movement) in the brain and the spinal cord. Symptoms can include stiff muscles, muscle twitching, gradual weakness due to decrease in muscle size, and eventual loss of the ability to walk, use their hands, speak, swallow, and breathe.
  • Recent population-based studies have suggested that ALS affects between 4.1 and 8.4 per 100,000 persons worldwide. And, on average, the life expectancy of ALS patients after diagnosis is about 3 to 5 years. The exact cause of ALS is unknown, and there are currently no cures available.
  • the currently available treatments e.g ., mechanical ventilation, feeding tubes, physical and speech therapy
  • ALS amyotrophic lateral sclerosis
  • the miRNA inhibitor increases a level of a SIRT1 protein and/or a SIRT1 gene in the subject.
  • the subject has an ALS associated with a decreased level of a SIRT1 protein and/or a SIRT1 gene.
  • the miRNA inhibitor induces autophagy and/or treats or prevents inflammation.
  • the miRNA inhibitor increases a level of a CD36 protein and/or a
  • the subject has an ALS associated with a decreased level of a CD36 protein and/or a CD36 gene.
  • the miRNA inhibitor increases a level of a PGC-1 ⁇ protein and/or a PGC-1 ⁇ gene in the subject.
  • the subject has an ALS associated with a decreased level of a PGC-1 ⁇ protein and/or a PGC-1 ⁇ gene.
  • a miR-485 inhibitor that can be used in the above methods induces neurogenesis.
  • inducing neurogenesis comprises an increased proliferation, differentiation, migration, and/or survival of neural stem cells and/or progenitor cells.
  • inducing neurogenesis comprises an increased number of neural stem cells and/or progenitor cells.
  • inducing neurogenesis comprises an increased axon, dendrite, and/or synapse development.
  • a miR-485 inhibitor induces phagocytosis.
  • Also provided herein is a method of treating a disease or condition associated with an abnormal level of a SIRT1 protein and/or a SIRT1 gene in a subject in need thereof comprising administering to the subject a compound that inhibits miR-485 (miRNA inhibitor), wherein the miRNA inhibitor increases the level of the SIRT1 protein and/or SIRT1 gene. Also provided herein is a method of treating a disease or condition associated with an abnormal level of a CD36 protein and/or a CD36 gene in a subject in need thereof comprising administering to the subject a compound that inhibits miR-485 (miRNA inhibitor), wherein the miRNA inhibitor increases the level of the CD36 protein and/or CD36 gene.
  • Also provided herein is a method of treating a disease or condition associated with an abnormal level of a PGC-la protein and/or a PGC-la gene in a subject in need thereof comprising administering to the subject a compound that inhibits miR-485 (miRNA inhibitor), wherein the miRNA inhibitor increases the level of the PGC-la protein and/or PGC-la gene.
  • miRNA inhibitor miR-485
  • the miRNA inhibitor inhibits miR485-3p.
  • the miR485-3p comprises 5'-GUCAUACACGGCUCUCCUCUCU-3' (SEQ ID NO: 1).
  • the miRNA inhibitor comprises a nucleotide sequence comprising 5'-UGUAUGA-3' (SEQ ID NO: 2) and wherein the miRNA inhibitor comprises about 6 to about 30 nucleotides in length.
  • the miRNA inhibitor increases transcription of an SIRT1 gene and/or expression of a SIRT1 protein.
  • the miRNA inhibitor comprises at least 1 nucleotide, at least 2 nucleotides, at least 3 nucleotides, at least 4 nucleotides, at least 5 nucleotides, at least 6 nucleotides, at least 7 nucleotides, at least 8 nucleotides, at least 9 nucleotides, at least 10 nucleotides, at least 11 nucleotides, at least 12 nucleotides, at least 13 nucleotides, at least 14 nucleotides, at least 15 nucleotides, at least 16 nucleotides, at least 17 nucleotides, at least 18 nucleotides, at least 19 nucleotides, or at least 20 nucleotides at the 5' of the nucleotide sequence.
  • the miRNA inhibitor comprises at least 1 nucleotide, at least 2 nucleotides, at least 3 nucleotides, at least 4 nucleotides, at least 5 nucleotides, at least 6 nucleotides, at least 7 nucleotides, at least 8 nucleotides, at least 9 nucleotides, at least 10 nucleotides, at least 11 nucleotides, at least 12 nucleotides, at least 13 nucleotides, at least 14 nucleotides, at least 15 nucleotides, at least 16 nucleotides, at least 17 nucleotides, at least 18 nucleotides, at least 19 nucleotides, or at least 20 nucleotides at the 3' of the nucleotide sequence.
  • the miRNA inhibitor has a sequence selected from the group consisting of: 5'-UGUAUGA-3' (SEQ ID NO: 2), 5'-GUGUAUGA-3' (SEQ ID NO: 3), 5'- CGUGUAUGA-3' (SEQ ID NO: 4), 5'-CCGUGUAUGA-3' (SEQ ID NO: 5), 5'- GCCGUGUAUGA-3' (SEQ ID NO: 6), 5'-AGCCGUGUAUGA-3' (SEQ ID NO: 7), 5'- GAGCCGUGUAUGA-3' (SEQ ID NO: 8), 5'-AGAGCCGUGUAUGA-3' (SEQ ID NO: 9), 5'- GAGAGCCGUGUAUGA-3' (SEQ ID NO: 10), 5'-GGAGAGCCGUGUAUGA-3' (SEQ ID NO: 11), 5'-AGGAGAGCCGUGUAUGA-3' (SEQ ID NO: 12), 5'-
  • GAGGAGAGCCGUGUAUGA-3' (SEQ ID NO: 13), 5'-AGAGGAGAGCCGUGUAUGA-3' (SEQ ID NO: 14), 5'-GAG AGG AG AGC C GU GU AU G A-3' (SEQ ID NO: 15); 5'- UGUAUGAC-3' (SEQ ID NO: 16), 5'-GUGUAUGAC-3' (SEQ ID NO: 17), 5'- CGUGUAUGAC-3' (SEQ ID NO: 18), 5'-CCGUGUAUGAC-3' (SEQ ID NO: 19), 5'- GCCGUGUAUGAC-3' (SEQ ID NO: 20), 5'-AGCCGUGUAUGAC-3' (SEQ ID NO: 21), 5'- GAGCCGUGUAUGAC-3' (SEQ ID NO: 22), 5'-AGAGCCGUGUAUGAC-3' (SEQ ID NO: 23), 5'-GAGAGCCGUGUAUGAC-3' (SEQ ID NO: 24), 5'-GGAGAGCC
  • the miRNA inhibitor has a sequence selected from the group consisting of: 5'-TGTATGA-3' (SEQ ID NO: 62), 5'-GTGTATGA-3' (SEQ ID NO: 63), 5'- CGTGTATGA-3' (SEQ ID NO: 64), 5'-CCGTGTATGA-3' (SEQ ID NO: 65), 5'- GCCGTGTATGA-3' (SEQ ID NO: 66), 5'-AGCCGTGTATGA-3' (SEQ ID NO: 67), 5'- GAGCCGTGTATGA-3' (SEQ ID NO: 68), 5'-AGAGCCGTGTATGA-3' (SEQ ID NO: 69), 5'-GAGAGCCGTGTATGA-3' (SEQ ID NO: 70), 5'-GGAGAGCCGTGTATGA-3' (SEQ ID NO: 71), 5'-AGGAGAGCCGTGTATGA-3' (SEQ ID NO: 72), 5'-
  • GAGGAGAGCCGTGTATGA-3 ' (SEQ ID NO: 73), 5 ' - AG AGG AG AGC C GT GT AT G A- 3 ' (SEQ ID NO: 74), 5 ' -GAGAGGAGAGCC GT GT AT GA-3 ' (SEQ ID NO: 75); 5'- TGTATGAC-3' (SEQ ID NO: 76), 5'-GTGTATGAC-3' (SEQ ID NO: 77), 5'- CGTGTATGAC-3' (SEQ ID NO: 78), 5'-CCGTGTATGAC-3' (SEQ ID NO: 79), 5'- GCCGTGTATGAC-3' (SEQ ID NO: 80), 5'-AGCCGTGTATGAC-3' (SEQ ID NO: 81), 5'- GAGCCGTGTATGAC-3' (SEQ ID NO: 82), 5'-AGAGCCGTGTATGAC-3' (SEQ ID NO: 83), 5'-GAGAGCCGTGTATGAC-3' (S
  • the sequence of the miRNA inhibitor is at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or at least about 95% sequence identity to 5'- AGAGAGGAGAGCCGUGUAUGAC -3' (SEQ ID NO: 30) or 5'- AG AG AGG AG AGC C GT GT AT G AC -3' (SEQ ID NO: 90).
  • the miRNA inhibitor has a sequence that has at least 90% similarity to 5'- AGAGAGGAGAGCCGUGUAUGAC -3' (SEQ ID NO: 30) or 5'- AG AG AGG AG AGC C GT GT AT G AC -3' (SEQ ID NO: 90).
  • the miRNA inhibitor comprises the nucleotide sequence 5'- AGAGAGGAGAGCCGUGUAUGAC -3' (SEQ ID NO: 30) or 5'-
  • the miRNA inhibitor comprises the nucleotide sequence 5'- AGAGAGGAGAGCCGUGUAUGAC -3' (SEQ ID NO: 30) or 5'-
  • the miRNA inhibitor comprises the nucleotide sequence 5'- AGAGAGGAGAGCCGUGUAUGAC -3' (SEQ ID NO: 30).
  • the miRNA inhibitor comprises at least one modified nucleotide.
  • the at least one modified nucleotide is a locked nucleic acid (LNA), an unlocked nucleic acid (UNA), an arabino nucleic acid (ABA), a bridged nucleic acid (BNA), and/or a peptide nucleic acid (PNA).
  • LNA locked nucleic acid
  • UNA unlocked nucleic acid
  • ABA arabino nucleic acid
  • BNA bridged nucleic acid
  • PNA peptide nucleic acid
  • the miRNA inhibitor comprises a backbone modification.
  • the backbone modification is a phosphorodiamidate morpholino oligomer (PMO) and/or phosphorothioate (PS) modification.
  • the miRNA inhibitor is delivered in a delivery agent.
  • the delivery agent is a micelle, an exosome, a lipid nanoparticle, an extracellular vesicle, or a synthetic vesicle.
  • the miRNA inhibitor is delivered by a viral vector.
  • the viral vector is an AAV, an adenovirus, a retrovirus, or a lentivirus.
  • the viral vector is an AAV that has a serotype of AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or any combination thereof.
  • the miRNA inhibitor is delivered with a delivery agent.
  • the delivery agent comprises a lipidoid, a liposome, a lipoplex, a lipid nanoparticle, a polymeric compound, a peptide, a protein, a cell, a nanoparticle mimic, a nanotube, or a conjugate.
  • the delivery agent comprises a cationic carrier unit comprising
  • WP is a water-soluble biopolymer moiety
  • CC is a positively charged carrier moiety
  • AM is an adjuvant moiety
  • L1 and L2 are independently optional linkers, and wherein when mixed with a nucleic acid at an ionic ratio of about 1 : 1, the cationic carrier unit forms a micelle.
  • the miRNA inhibitor interacts with the cationic carrier unit via an ionic bond.
  • the water-soluble polymer comprises poly(alkylene glycols), poly(oxyethylated polyol), poly(olefmic alcohol), poly(vinylpyrrolidone), poly(hydroxyalkylmethacrylamide), poly(hydroxyalkylmethacrylate), poly(saccharides), poly(a-hydroxy acid), poly(vinyl alcohol), polyglycerol, polyphosphazene, polyoxazolines (“POZ”) poly(N-acryloylmorpholine), or any combinations thereof.
  • the water- soluble polymer comprises polyethylene glycol (“PEG”), polyglycerol, or poly(propylene glycol) (“PPG").
  • the water-soluble polymer comprises:
  • n is 1-1000.
  • the n is at least about 110, at least about 111, at least about 112, at least about 113, at least about 114, at least about 115, at least about 116, at least about 117, at least about 118, at least about 119, at least about 120, at least about 121, at least about 122, at least about 123, at least about 124, at least about 125, at least about 126, at least about 127, at least about 128, at least about 129, at least about 130, at least about 131, at least about 132, at least about 133, at least about 134, at least about 135, at least about 136, at least about 137, at least about 138, at least about 139, at least about 140, or at least about 141.
  • the n is about 80 to about 90, about 90 to about 100, about 100 to about 110, about 110 to about 120, about 120 to about 130, about 140 to about 150, about 150 to
  • the water-soluble polymer is linear, branched, or dendritic.
  • the cationic carrier moiety comprises one or more basic amino acids.
  • the cationic carrier moiety comprises at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least 11, at least 12, at least 13, at least 14, at last 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 31, at least 32, at least 33, at least 34, at least 35, at least 36, at least 37, at least 38, at least 39, at least 40, at least 41, at least 42, at least 43, at least 44, at least 45, at least 46, at least 47, at least 48, at least 49, or at least 50 basic amino acids.
  • the cationic carrier moiety comprises about 30 to about 50 basic amino acids.
  • the basic amino acid comprises arginine, lysine, histidine, or any combination thereof.
  • the cationic carrier moiety comprises about 40 lysine monomers.
  • the adjuvant moiety is capable of modulating an immune response, an inflammatory response, and/or a tissue microenvironment.
  • the adjuvant moiety comprises an imidazole derivative, an amino acid, a vitamin, or any combination thereof.
  • the adjuvant moiety comprises:
  • each of G1 and G2 is H, an aromatic ring, or 1-10 alkyl, or G1 and G2 together form an aromatic ring, and wherein n is 1-10.
  • the adjuvant moiety comprises nitroimidazole.
  • the adjuvant moiety comprises metronidazole, tinidazole, nimorazole, dimetridazole, pretomanid, omidazole, megazol, azanidazole, benznidazole, or any combination thereof.
  • the adjuvant moiety comprises an amino acid.
  • the adjuvant moiety comprises
  • each of Z1 and Z2 is H or OH.
  • the adjuvant moiety comprises a vitamin.
  • the vitamin comprises a cyclic ring or cyclic hetero atom ring and a carboxyl group or hydroxyl group.
  • the vitamin comprises:
  • each of Y1 and Y2 is C, N, O, or S, and wherein n is 1 or 2.
  • the vitamin is selected from the group consisting of vitamin A, vitamin B 1, vitamin B2, vitamin B3, vitamin B6, vitamin B7, vitamin B9, vitamin B 12, vitamin C, vitamin D2, vitamin D3, vitamin E, vitamin M, vitamin H, and any combination thereof.
  • the vitamin can be vitamin B3.
  • the adjuvant moiety comprises at least about two, at least about three, at least about four, at least about five, at least about six, at least about seven, at least about eight, at least about nine, at least about ten, at least about 11, at least about 12, at least about 13, at least about 14, at least about 15, at least about 16, at least about 17, at least about 18, at least about 19, or at least about 20 vitamin B3. In certain aspects, the adjuvant moiety comprises about 10 vitamin B3.
  • the delivery agent comprises about a water-soluble biopolymer moiety with about 120 to about 130 PEG units, a cationic carrier moiety comprising a poly- lysine with about 30 to about 40 lysines, and an adjuvant moiety with about 5 to about 10 vitamin B3.
  • the delivery agent is associated with the miRNA inhibitor, thereby forming a micelle.
  • the association can be a covalent bond, a non-covalent bond, or an ionic bond.
  • the cationic carrier unit and the miRNA inhibitor in the micelle is mixed in a solution so that the ionic ratio of the positive charges of the cationic carrier unit and the negative charges of the miRNA inhibitor is about 1 : 1.
  • the cationic carrier unit is capable of protecting the miRNA inhibitor from enzymatic degradation.
  • the ALS that can be treated with the present disclosure comprises sporadic ALS, familial ALS, or both.
  • the miRNA inhibitor delays ALS onset.
  • the miRNA inhibitor improves muscle strength in the subject.
  • the delivery agent is a micelle.
  • the micelle comprises (i) about 100 to about 200 PEG units, (ii) about 30 to about 40 lysines, each with an amine group, (iii) about 15 to about 20 lysines, each with a thiol group, and (iv) about 30 to about 40 lysines, each linked to vitamin B3.
  • the micelle comprises (i) about 120 to about 130 PEG units, (ii) about 32 lysines, each with an amine group, (iii) about 16 lysines, each with a thiol group, and (iv) about 32 lysines, each linked to vitamin B3.
  • a targeting moiety is further linked to the PEG units.
  • the targeting moiety is a LAT 1 targeting ligand.
  • the targeting moiety is pennyl alanine.
  • FIG. 1 shows an exemplary architecture of a carrier unit of the present disclosure.
  • the example presented includes a cationic carrier moiety, which can interact electrostatically with anionic payloads, e.g., nucleic acids such as antisense oligonucleotides targeting a gene, e.g, miRNA (antimirs).
  • anionic payloads e.g., nucleic acids such as antisense oligonucleotides targeting a gene, e.g, miRNA (antimirs).
  • AM can be located between WP and CC.
  • the CC and AM components are portrayed in a linear arrangement for simplicity. However, as described herein, in some aspects, CC and AM can be arranged in a scaffold fashion.
  • FIGs. 2A and 2B provide comparison of PGC-1 ⁇ protein and/or IL-I ⁇ protein expression in wild-type (WT) and ALS (SOD1-G93A) mice.
  • FIG. 2 A shows the expression of both PGC-la and IL-I ⁇ proteins in the spinal cord tissue (lumbar region).
  • FIG. 2B shows the expression of PGC-1 ⁇ protein in skeletal muscle.
  • FIGs. 3A, 3B, and 3C provide comparison of disease onset and survival in ALS mice treated with miR-485 inhibitor "(1)" or PBS "(2).”
  • FIG. 3A provides the percentage of mice that do not show disease onset after being treated with miR-485 inhibitor.
  • FIG. 3B provides the average of the days that the disease onset occurred in the mice treated with miR- 485 inhibitor.
  • FIG. 3C provides a comparison of the survival curve.
  • FIG. 4 provides a comparison of muscle strength of ALS mice treated with miR-
  • FIGs. 5A and 5B show that the administration of a miR-485 inhibitor has no observable effect on body weight of male and female rats, respectively.
  • male and female rats received one of the following doses of the miR-485 inhibitor: (i) 0 mg/kg (G1), (ii) 3.75 mg/kg (G2), (iii) 7.5 mg/kg (G3), and (iv) 15 mg/kg (G4).
  • Body weight was measured at days 0, 3, 7, and 14 post miR-485 inhibitor administration.
  • FIGs. 6A and 6B show that the administration of miR-485 inhibitor has no effect on mortality in male and female rats, respectively.
  • male and female rats received one of the following doses of the miR-485 inhibitor: (i) 0 mg/kg (G1), (ii) 3.75 mg/kg (G2), (iii) 7.5 mg/kg (G3), and (iv) 15 mg/kg (G4).
  • Mortality of the animals was measured daily from days 0 to 14 days post miR-485 inhibitor administration.
  • FIGs. 7A and 7B show that the administration of a miR-485 inhibitor has no lasting clinical adverse effects when administered to male and female rats, respectively.
  • male and female rats received one of the following doses of the miR-485 inhibitor: (i) 0 mg/kg (G1), (ii) 3.75 mg/kg (G2), (iii) 7.5 mg/kg (G3), and (iv) 15 mg/kg (G4).
  • the adverse effects measured included the following: (i) NOA (no observable abnormalities), (ii) congestion (tail), (iii) edema (face), (iv) edema (forelimb), and (v) edema (hind limb).
  • Adverse effects were measured at 0 hour, 0.5 hour, 1 hour, 2 hours, 4 hours, 6 hours, 1 day, 3 days, 5 days, 8 days, 11 days, and 14 days post miR-485 inhibitor administration.
  • FIGs. 8A and 8B show that the administration of a miR-485 inhibitor has no observable pathological abnormalities in male and female rats, respectively.
  • male and female rats received one of the following doses of the miR-485 inhibitor: (i) 0 mg/kg (G1), (ii) 3.75 mg/kg (G2), (iii) 7.5 mg/kg (G3), and (iv) 15 mg/kg (G4).
  • FIGs. 9A, 9B, 9C, 9D, 9E, 9F, 9G, 9H, and 91 show the therapeutic effects of miR-
  • FIG. 9A provides a schematic of the experimental design.
  • FIG. 9B provides a comparison of disease onset in mice treated with the miR-485 inhibitor compared to the control animals.
  • FIG. 9C provides a comparison of rotarod latency (time it took the animals to fall off the Rotarod-treadmill) for ALS mice treated with PBS ("1") or the miR-485 inhibitor ("2") at different time points (i.e., 107, 114, 119, 121 and 123 days post-birth).
  • FIG. 9A provides a schematic of the experimental design.
  • FIG. 9B provides a comparison of disease onset in mice treated with the miR-485 inhibitor compared to the control animals.
  • FIG. 9C provides a comparison of rotarod latency (time it took the animals to fall off the Rotarod-treadmill) for ALS mice treated with PBS ("1") or the miR-485 inhibitor ("2”) at different time points (i.e., 107, 114, 119, 121 and
  • FIG. 9D provides a comparison of the latency to when the animals fall from the wired cage for ALS mice treated with PBS ("1") or miR-485 inhibitor ("2") at different time points (i.e., 107, 114, 119, 121 and 123 days post-birth).
  • FIGs. 9E and 9F provide comparison of the number of footslips (FIG. 9E) and the time it took to cross the length of the beam (FIG. 9F) for ALS mouse treated with PBS ("1") or miR-485 inhibitor ("2").
  • the foot slip data was measured at 110 days post-birth.
  • the beam cross time was measured at five different time points (i.e., 107 114, 119, 121 and 123 days post-birth).
  • FIG. 9G shows the average body weight as a function of time of ALS mice treated with either the miR-485 inhibitor (square) or PBS control (circle).
  • FIG. 9H provides a comparison of body weight loss as a percentage of the peak body weight in the animals from the different treatment groups.
  • FIG. 91 provides a survival curve for ALS animals treated with the miR-485 inhibitor (square) or PBS control (circle).
  • FIGs. 10A, 10B, 10C, and 10D show the effect of the miR-485 inhibitor on NSC-
  • FIG. 10A provides Western blot analysis showing the effect of the miR-485 inhibitor on SOD1 aggregation.
  • FIG. 10B provides immunofluorescence analysis of the effect on SOD1 aggregation. The first three columns (from left to right) show the results for NSC-34 cells transfected with the wild-type SOD1 and treated with (i) PBS control (top row), (ii) 50 nM of miR-485 inhibitor (middle row), or (iii) 100 nM of miR-485 inhibitor (bottom row).
  • the last three columns show the results for NSC-34 cells transfected with SOD1G93A construct and treated with (i) PBS control (top row), (ii) 50 nM of miR-485 inhibitor (middle row), or (iii) 100 nM of miR-485 inhibitor (bottom row).
  • the 1 st and 4 th columns show GFP expression alone.
  • the 2 nd and 4 th columns show the expression of LC3B alone.
  • the 3 rd and 6 th columns show an overlay of GFP and LC3B expression.
  • the white arrows indicate SOD1G93 A aggregation in the NSC-34 cells transfected with SOD1G93 A and treated with the miR-485 inhibitor.
  • FIG. 10C provides Western blot analysis of the effect of miR-485 inhibitor on SIRT1 and PGC-1 ⁇ protein expression.
  • FIG. 10D provides Western blot analysis of the effect on cleaved caspase 3 protein expression.
  • the present disclosure is directed to the use of a miR-485 inhibitor, comprising a nucleotide sequence encoding a nucleotide molecule that comprises at least one miR-485 binding site, wherein the nucleotide molecule does not encode a protein.
  • the miRNA binding site or sites can bind to endogenous miR-485, which inhibits and/or reduces the expression level of an endogenous SIRT1 protein and/or a SIRT1 gene.
  • the binding of endogenous miR-485 to the miRNA binding site or sites can inhibit and/or reduce the expression level of an endogenous CD36 protein and/or a CD36 gene.
  • the binding of endogenous miR-485 to the miRNA binding site or sites can inhibit and/or reduce the expression level of an endogenous PGC-1 ⁇ .
  • the binding of endogenous miR-485 to the miRNA binding site or sites can inhibit and/or reduce the expression level of an endogenous NRG1 protein and/or a NRG1 gene.
  • the binding of endogenous miR-485 to the miRNA binding site or sites can inhibit and/or reduce the expression level of an endogenous STMN2 protein and/or a STMN2 gene.
  • the binding of endogenous miR-485 to the miRNA binding site or sites can inhibit and/or reduce the expression level of an endogenous NRXN1 protein and/or a NRXN1 gene.
  • the present disclosure is directed to a method of increasing a level of a SIRT1 protein and/or SIRT1 gene in a subject in need thereof comprising administering an miR-485 inhibitor to the subject.
  • increasing the level of a SIRT1 protein and/or SIRT1 gene in a subject can be useful in treating a disease or condition associated with reduced levels of a SIRT1 protein and/or a SIRT1 gene.
  • the present disclosure is directed to a method of increasing a level of a CD36 protein and/or CD36 gene in a subject in need thereof comprising administering an miR-485 inhibitor to the subject.
  • increasing the level of a CD36 protein and/or CD36 gene in a subject can be useful in treating a disease or condition associated with reduced levels of a CD36 protein and/or a CD36 gene.
  • the present disclosure is directed to a method of increasing a level of a PGC-1 ⁇ protein and/or PGC-1 ⁇ gene in a subject in need thereof comprising administering an miR-485 inhibitor to the subject.
  • increasing the level of a PGC- la protein and/or PGC-1 ⁇ gene in a subject can be useful in treating a disease or condition associated with reduced levels of a PGC-1 ⁇ protein and/or a PGC-1 ⁇ gene.
  • the present disclosure is directed to a method of increasing a level of a NRG1 protein and/or NRG1 gene in a subject in need thereof comprising administering an miR-485 inhibitor to the subject.
  • increasing the level of a NRG1 protein and/or NRG1 gene in a subject can be useful in treating a disease or condition associated with reduced levels of a NRG1 protein and/or a NRG1 gene.
  • the present disclosure is directed to a method of increasing a level of a STMN2 protein and/or STMN2 gene in a subject in need thereof comprising administering an miR-485 inhibitor to the subject.
  • increasing the level of a STMN2 protein and/or STMN2 gene in a subject can be useful in treating a disease or condition associated with reduced levels of a STMN2 protein and/or a STMN2 gene.
  • the present disclosure is directed to a method of increasing a level of a NRXN1 protein and/or NRXN1 gene in a subject in need thereof comprising administering an miR-485 inhibitor to the subject.
  • a disease or condition that can be treated with the present disclosure is amyotrophic lateral sclerosis (ALS).
  • ALS amyotrophic lateral sclerosis
  • a or “an” entity refers to one or more of that entity; for example, "a nucleotide sequence,” is understood to represent one or more nucleotide sequences.
  • the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
  • the claims can be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as “solely,” “only” and the like in connection with the recitation of claim elements, or use of a negative limitation.
  • Nucleotides are referred to by their commonly accepted single-letter codes. Unless otherwise indicated, nucleotide sequences are written left to right in 5' to 3' orientation. Nucleotides are referred to herein by their commonly known one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Accordingly, 'a' represents adenine, 'c' represents cytosine, 'g' represents guanine, 't' represents thymine, and 'u' represents uracil.
  • Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission.
  • AAV adeno-associated virus
  • AAV includes but is not limited to, AAV type 1, AAV type 2, AAV type 3 (including types 3 A and 3B), AAV type 4, AAV type 5, AAV type 6, AAV type 7, AAV type 8, AAV type 9, AAV type 10, AAV type 11, AAV type 12, AAV type 13, AAVrh.74, snake AAV, avian AAV, bovine AAV, canine AAV, equine AAV, ovine AAV, goat AAV, shrimp AAV, those AAV serotypes and clades disclosed by Gao et al. ( J . Virol. 75:6381 (2004)) and Moris et al. ⁇ Virol.
  • an "AAV” includes a derivative of a known AAV. In some aspects, an "AAV” includes a modified or an artificial AAV.
  • administration refers to introducing a composition, such as a miRNA inhibitor of the present disclosure, into a subject via a pharmaceutically acceptable route.
  • the introduction of a composition, such as a micelle comprising a miRNA inhibitor of the present disclosure, into a subject is by any suitable route, including intratumorally, orally, pulmonarily, intranasally, parenterally (intravenously, intra-arterially, intramuscularly, intraperitoneally, or subcutaneously), rectally, intralymphatically, intrathecally, periocularly or topically.
  • Administration includes self-administration and the administration by another.
  • a suitable route of administration allows the composition or the agent to perform its intended function. For example, if a suitable route is intravenous, the composition is administered by introducing the composition or agent into a vein of the subject.
  • the term “associated with” refers to a close relationship between two or more entities or properties.
  • a disease or condition that can be treated with the present disclosure e.g, disease or condition associated with an abnormal level of a SIRT1 protein and/or SIRT1 gene
  • the term “associated with” refers to an increased likelihood that a subject suffers from the disease or condition when the subject exhibits an abnormal expression of the protein and/or gene.
  • the abnormal expression of the protein and/or gene causes the disease or condition.
  • the abnormal expression does not necessarily cause but is correlated with the disease or condition.
  • Non-limiting examples of suitable methods that can be used to determine whether a subject exhibits an abnormal expression of a protein and/or gene associated with a disease or condition are provided elsewherein the present disclosure.
  • the term “approximately,” as applied to one or more values of interest refers to a value that is similar to a stated reference value. In certain aspects, the term “approximately” refers to a range of values that fall within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
  • Nucleotides or amino acids that are relatively conserved are those that are conserved amongst more related sequences than nucleotides or amino acids appearing elsewhere in the sequences.
  • two or more sequences are said to be “highly conserved” if they are at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some aspects, two or more sequences are said to be “highly conserved” if they are about 70% identical, about 80% identical, about 90% identical, about 95%, about 98%, or about 99% identical to one another. In some aspects, two or more sequences are said to be "conserved” if they are at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another.
  • two or more sequences are said to be "conserved” if they are about 30% identical, about 40% identical, about 50% identical, about 60% identical, about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another. Conservation of sequence can apply to the entire length of a polynucleotide or polypeptide or can apply to a portion, region or feature thereof.
  • derived from refers to a component that is isolated from or made using a specified molecule or organism, or information (e.g ., amino acid or nucleic acid sequence) from the specified molecule or organism.
  • a nucleic acid sequence that is derived from a second nucleic acid sequence can include a nucleotide sequence that is identical or substantially similar to the nucleotide sequence of the second nucleic acid sequence.
  • the derived species can be obtained by, for example, naturally occurring mutagenesis, artificial directed mutagenesis or artificial random mutagenesis.
  • the mutagenesis used to derive nucleotides or polypeptides can be intentionally directed or intentionally random, or a mixture of each.
  • the mutagenesis of a nucleotide or polypeptide to create a different nucleotide or polypeptide derived from the first can be a random event (e.g ., caused by polymerase infidelity) and the identification of the derived nucleotide or polypeptide can be made by appropriate screening methods, e.g., as discussed herein.
  • a nucleotide or amino acid sequence that is derived from a second nucleotide or amino acid sequence has a sequence identity of at least about 50%, at least about 51%, at least about 52%, at least about 53%, at least about 54%, at least about 55%, at least about 56%, at least about 57%, at least about 58%, at least about 59%, at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 8
  • a "coding region” or “coding sequence” is a portion of polynucleotide which consists of codons translatable into amino acids. Although a “stop codon” (TAG, TGA, or TAA) is typically not translated into an amino acid, it can be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, and the like, are not part of a coding region.
  • a coding region typically determined by a start codon at the 5' terminus, encoding the amino terminus of the resultant polypeptide, and a translation stop codon at the 3' terminus, encoding the carboxyl terminus of the resulting polypeptide.
  • nucleobase sequence (i.e., each comprising a nucleobase sequence), or between an oligomer and a target gene, that are related with one another by Watson-Crick base-pairing rules.
  • nucleobase sequence "T-G-A (3' ⁇ 5')," is complementary to the nucleobase sequence "A-C-T (3' ⁇ 5').”
  • Complementarity can be "partial,” in which less than all of the nucleobases of a given nucleobase sequence are matched to the other nucleobase sequence according to base pairing rules.
  • complementarity between a given nucleobase sequence and the other nucleobase sequence can be about 70%, about 75%, about 80%, about 85%, about 90%, or about 95%.
  • the term "complementary" refers to at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% match or complementarity to a target nucleic acid sequence (e.g ., miR-485 nucleic acid sequence).
  • nucleobase sequences there can be “complete” or “perfect” (100%) complementarity between a given nucleobase sequence and the other nucleobase sequence to continue the example.
  • degree of complementarity between nucleobase sequences has significant effects on the efficiency and strength of hybridization between the sequences.
  • downstream refers to a nucleotide sequence that is located 3' to a reference nucleotide sequence.
  • downstream nucleotide sequences relate to sequences that follow the starting point of transcription. For example, the translation initiation codon of a gene is located downstream of the start site of transcription.
  • excipient and “carrier” are used interchangeably and refer to an inert substance added to a pharmaceutical composition to further facilitate administration of a compound, e.g., a miRNA inhibitor of the present disclosure.
  • RNA or a polypeptide refers to a process by which a polynucleotide produces a gene product, e.g., RNA or a polypeptide. It includes without limitation transcription of the polynucleotide into micro RNA binding site, small hairpin RNA (shRNA), small interfering RNA (siRNA), or any other RNA product. It includes, without limitation, transcription of the polynucleotide into messenger RNA (mRNA), and the translation of mRNA into a polypeptide. Expression produces a "gene product.”
  • a gene product can be, e.g, a nucleic acid, such as an RNA produced by transcription of a gene.
  • a gene product can be either a nucleic acid, RNA or miRNA produced by the transcription of a gene, or a polypeptide which is translated from a transcript.
  • Gene products described herein further include nucleic acids with post transcriptional modifications, e.g, polyadenylation or splicing, or polypeptides with post translational modifications, e.g, phosphorylation, methylation, glycosylation, the addition of lipids, association with other protein subunits, or proteolytic cleavage.
  • homology refers to the overall relatedness between polymeric molecules, e.g. between nucleic acid molecules. Generally, the term “homology” implies an evolutionary relationship between two molecules. Thus, two molecules that are homologous will have a common evolutionary ancestor. In the context of the present disclosure, the term homology encompasses both to identity and similarity.
  • polymeric molecules are considered to be "homologous" to one another if at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% of the monomers in the molecule are identical (exactly the same monomer) or are similar (conservative substitutions).
  • the term "homologous” necessarily refers to a comparison between at least two sequences (e.g, polynucleotide sequences).
  • substitutions are conducted at the nucleic acid level, i.e., substituting an amino acid residue with an alternative amino acid residue is conducted by substituting the codon encoding the first amino acid with a codon encoding the second amino acid.
  • identity refers to the overall monomer conservation between polymeric molecules, e.g, between polynucleotide molecules.
  • Calculation of the percent identity of two polypeptide or polynucleotide sequences can be performed by aligning the two sequences for optimal comparison purposes (e.g, gaps can be introduced in one or both of a first and a second polypeptide or polynucleotide sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes).
  • the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence.
  • the amino acids at corresponding amino acid positions, or bases in the case of polynucleotides, are then compared.
  • Suitable software programs that can be used to align different sequences are available from various sources.
  • One suitable program to determine percent sequence identity is bl2seq, part of the BLAST suite of program available from the U.S. government's National Center for Biotechnology Information BLAST web site (blast.ncbi.nlm.nih.gov).
  • B12seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm.
  • BLASTN is used to compare nucleic acid sequences
  • BLASTP is used to compare amino acid sequences.
  • Sequence alignments can be conducted using methods known in the art such as
  • MAFFT Clustal (ClustalW, Clustal X or Clustal Omega), MUSCLE, etc.
  • Different regions within a single polynucleotide or polypeptide target sequence that aligns with a polynucleotide or polypeptide reference sequence can each have their own percent sequence identity. It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 80.11, 80.12, 80.13, and 80.14 are rounded down to 80.1, while 80.15, 80.16, 80.17, 80.18, and 80.19 are rounded up to 80.2. It also is noted that the length value will always be an integer.
  • %ID 100 x (Y/Z), where Y is the number of amino acid residues (or nucleobases) scored as identical matches in the alignment of the first and second sequences (as aligned by visual inspection or a particular sequence alignment program) and Z is the total number of residues in the second sequence. If the length of a first sequence is longer than the second sequence, the percent identity of the first sequence to the second sequence will be higher than the percent identity of the second sequence to the first sequence.
  • sequence alignments can be generated by integrating sequence data with data from heterogeneous sources such as structural data (e.g., crystallographic protein structures), functional data (e.g., location of mutations), or phylogenetic data.
  • a suitable program that integrates heterogeneous data to generate a multiple sequence alignment is T-Coffee, available at worldwideweb.tcoffee.org, and alternatively available, e.g, from the EBI. It will also be appreciated that the final alignment used to calculate percent sequence identity can be curated either automatically or manually.
  • isolating or purifying as used herein is the process of removing, partially removing (e.g, a fraction) of a composition of the present disclosure, e.g., a miRNA inhibitor of the present disclosure from a sample containing contaminants.
  • an isolated composition has no detectable undesired activity or, alternatively, the level or amount of the undesired activity is at or below an acceptable level or amount.
  • an isolated composition has an amount and/or concentration of desired composition of the present disclosure, at or above an acceptable amount and/or concentration and/or activity.
  • the isolated composition is enriched as compared to the starting material from which the composition is obtained.
  • This enrichment can be by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.9%, at least about 99.99%, at least about 99.999%, at least about 99.9999%, or greater than 99.9999% as compared to the starting material.
  • isolated preparations are substantially free of residual biological products.
  • the isolated preparations are 100% free, at least about 99% free, at least about 98% free, at least about 97% free, at least about 96% free, at least about 95% free, at least about 94% free, at least about 93% free, at least about 92% free, at least about 91% free, or at least about 90% free of any contaminating biological matter.
  • Residual biological products can include abiotic materials (including chemicals) or unwanted nucleic acids, proteins, lipids, or metabolites.
  • the term "linked” as used herein refers to a first amino acid sequence or polynucleotide sequence covalently or non-covalently joined to a second amino acid sequence or polynucleotide sequence, respectively.
  • the first amino acid or polynucleotide sequence can be directly joined or juxtaposed to the second amino acid or polynucleotide sequence or alternatively an intervening sequence can covalently join the first sequence to the second sequence.
  • the term "linked” means not only a fusion of a first polynucleotide sequence to a second polynucleotide sequence at the 5'-end or the 3'-end, but also includes insertion of the whole first polynucleotide sequence (or the second polynucleotide sequence) into any two nucleotides in the second polynucleotide sequence (or the first polynucleotide sequence, respectively).
  • the first polynucleotide sequence can be linked to a second polynucleotide sequence by a phosphodiester bond or a linker.
  • the linker can be, e.g., a polynucleotide.
  • a “miRNA inhibitor,” as used herein, refers to a compound that can decrease, alter, and/or modulate miRNA expression, function, and/or activity.
  • the miRNA inhibitor can be a polynucleotide sequence that is at least partially complementary to the target miRNA nucleic acid sequence, such that the miRNA inhibitor hybridizes to the target miRNA sequence.
  • a miR-485 inhibitor of the present disclosure comprises a nucleotide sequence encoding a nucleotide molecule that is at least partially complementary to the target miR-485 nucleic acid sequence, such that the miR-485 inhibitor hybridizes to the miR-485 sequence.
  • the hybridization of the miR-485 to the miR-485 sequence decreases, alters, and/or modulates the expression, function, and/or activity of miR-485 (e.g, hybridization results in an increase in the expression of SIRT1 protein and/or SIRT1 gene).
  • miRNA refers to a microRNA molecule found in eukaryotes that is involved in RNA-based gene regulation. The term will be used to refer to the single-stranded RNA molecule processed from a precursor.
  • antisense oligomers can also be used to describe the microRNA molecules of the present disclosure. Names of miRNAs and their sequences related to the present disclosure are provided herein.
  • MicroRNAs recognize and bind to target mRNAs through imperfect base pairing leading to destabilization or translational inhibition of the target mRNA and thereby downregulate target gene expression.
  • targeting miRNAs via molecules comprising a miRNA binding site can reduce or inhibit the miRNA- induced translational inhibition leading to an upregulation of the target gene.
  • mismatch refers to one or more nucleobases (whether contiguous or separate) in an oligomer nucleobase sequence (e.g ., miR-485 inhibitor) that are not matched to a target nucleic acid sequence (e.g., miR-485) according to base pairing rules. While perfect complementarity is often desired, in some aspects, one or more (e.g, 6, 5, 4, 3, 2, or 1 mismatches) can occur with respect to the target nucleic acid sequence. Variations at any location within the oligomer are included.
  • antisense oligomers of the disclosure include variations in nucleobase sequence near the termini, variations in the interior, and if present are typically within about 6, 5, 4, 3, 2, or 1 subunit of the 5' and/or 3' terminus. In some aspects, one, two, or three nucleobases can be removed and still provide on-target binding.
  • the terms “modulate,” “modify,” and grammatical variants thereof, generally refer when applied to a specific concentration, level, expression, function or behavior, to the ability to alter, by increasing or decreasing, e.g, directly or indirectly promoting/stimulating/up-regulating or interfering with/inhibiting/down-regulating the specific concentration, level, expression, function or behavior, such as, e.g, to act as an antagonist or agonist.
  • a modulator can increase and/or decrease a certain concentration, level, activity or function relative to a control, or relative to the average level of activity that would generally be expected or relative to a control level of activity.
  • a miRNA inhibitor disclosed herein e.g, a miR-485 inhibitor
  • Nucleic acid refers to the phosphate ester polymeric form of ribonucleosides (adenosine, guanosine, uridine or cytidine; "RNA molecules”) or deoxyribonucleosides (deoxyadenosine, deoxyguanosine, deoxythymidine, or deoxycytidine; "DNA molecules”), or any phosphoester analogs thereof, such as phosphorothioates and thioesters, in either single stranded form, or a double-stranded helix.
  • RNA molecules phosphate ester polymeric form of ribonucleosides
  • deoxyribonucleosides deoxyadenosine, deoxyguanosine, deoxythymidine, or deoxycytidine
  • DNA molecules or any phosphoester analogs thereof, such as phosphorothioates and thioesters, in either single stranded form, or a double-stranded
  • Single stranded nucleic acid sequences refer to single-stranded DNA (ssDNA) or single- stranded RNA (ssRNA). Double stranded DNA-DNA, DNA-RNA and RNA-RNA helices are possible.
  • nucleic acid molecule and in particular DNA or RNA molecule, refers only to the primary and secondary structure of the molecule, and does not limit it to any particular tertiary forms. Thus, this term includes double-stranded DNA found, inter alia , in linear or circular DNA molecules (e.g restriction fragments), plasmids, supercoiled DNA and chromosomes.
  • a "recombinant DNA molecule” is a DNA molecule that has undergone a molecular biological manipulation.
  • DNA includes, but is not limited to, cDNA, genomic DNA, plasmid DNA, synthetic DNA, and semi-synthetic DNA.
  • a "nucleic acid composition" of the disclosure comprises one or more nucleic acids as described herein.
  • pharmaceutically acceptable carrier encompass any of the agents approved by a regulatory agency of the U.S. Federal government or listed in the U.S. Pharmacopeia for use in animals, including humans, as well as any carrier or diluent that does not cause the production of undesirable physiological effects to a degree that prohibits administration of the composition to a subject and does not abrogate the biological activity and properties of the administered compound. Included are excipients and carriers that are useful in preparing a pharmaceutical composition and are generally safe, non-toxic, and desirable.
  • the term "pharmaceutical composition” refers to one or more of the compounds described herein, such as, e.g., a miRNA inhibitor of the present disclosure, mixed or intermingled with, or suspended in one or more other chemical components, such as pharmaceutically acceptable carriers and excipients.
  • a pharmaceutical composition is to facilitate administration of preparations comprising a miRNA inhibitor of the present disclosure to a subject.
  • polynucleotide refers to polymers of nucleotides of any length, including ribonucleotides, deoxyribonucleotides, analogs thereof, or mixtures thereof.
  • the term refers to the primary structure of the molecule.
  • the term includes triple-, double- and single-stranded deoxyribonucleic acid ("DNA”), as well as triple-, double- and single-stranded ribonucleic acid (“RNA”). It also includes modified, for example by alkylation, and/or by capping, and unmodified forms of the polynucleotide.
  • polynucleotide includes polydeoxyribonucleotides
  • polyribonucleotides containing D-ribose
  • D-ribose polyribonucleotides
  • tRNA tRNA
  • rRNA shRNA
  • siRNA siRNA
  • miRNA miRNA
  • mRNA spliced or unspliced
  • other polymers containing normucleotidic backbones for example, polyamide (e.g, peptide nucleic acids "PNAs") and polymorpholino polymers, and other synthetic sequence-specific nucleic acid polymers providing that the polymers contain nucleobases in a configuration which allows for base pairing and base stacking, such as is found in DNA and RNA.
  • PNAs peptide nucleic acids
  • a polynucleotide can be, e.g, an oligonucleotide, such as an antisense oligonucleotide.
  • the oligonucleotide is an RNA.
  • the RNA is a synthetic RNA.
  • the synthetic RNA comprises at least one unnatural nucleobase.
  • all nucleobases of a certain class have been replaced with unnatural nucleobases (e.g, all uridines in a polynucleotide disclosed herein can be replaced with an unnatural nucleobase, e.g, 5-methoxyuridine).
  • polypeptide “peptide,” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length, e.g. , that are encoded by the SIRT1 gene.
  • the polymer can comprise modified amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids such as homocysteine, ornithine, p- acetylphenylalanine, D-amino acids, and creatine
  • amino acid including, for example, unnatural amino acids such as homocysteine, ornithine, p- acetylphenylalanine, D-amino acids, and creatine
  • polypeptide refers to proteins, polypeptides, and peptides of any size, structure, or function.
  • Polypeptides include gene products, naturally occurring polypeptides, synthetic polypeptides, homologs, orthologs, paralogs, fragments and other equivalents, variants, and analogs of the foregoing.
  • a polypeptide can be a single polypeptide or can be a multi -molecular complex such as a dimer, trimer or tetramer. They can also comprise single chain or multichain polypeptides. Most commonly disulfide linkages are found in multichain polypeptides.
  • the term polypeptide can also apply to amino acid polymers in which one or more amino acid residues are an artificial chemical analogue of a corresponding naturally occurring amino acid.
  • a "peptide" can be less than or equal to about 50 amino acids long, e.g., about 5, about 10, about 15, about 20, about 25, about 30, about 35, about 40, about 45, or about 50 amino acids long.
  • prevent refers partially or completely delaying onset of an disease, disorder and/or condition; partially or completely delaying onset of one or more symptoms, features, or clinical manifestations of a particular disease, disorder, and/or condition; partially or completely delaying onset of one or more symptoms, features, or manifestations of a particular disease, disorder, and/or condition; partially or completely delaying progression from a particular disease, disorder and/or condition; and/or decreasing the risk of developing pathology associated with the disease, disorder, and/or condition. In some aspects, preventing an outcome is achieved through prophylactic treatment.
  • promoter and “promoter sequence” are interchangeable and refer to a DNA sequence capable of controlling the expression of a coding sequence or functional RNA.
  • a coding sequence is located 3' to a promoter sequence. Promoters can be derived in their entirety from a native gene, or be composed of different elements derived from different promoters found in nature, or even comprise synthetic DNA segments. It is understood by those skilled in the art that different promoters can direct the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental or physiological conditions.
  • Promoters that cause a gene to be expressed in most cell types at most times are commonly referred to as “constitutive promoters.” Promoters that cause a gene to be expressed in a specific cell type are commonly referred to as “cell-specific promoters” or “tissue-specific promoters.” Promoters that cause a gene to be expressed at a specific stage of development or cell differentiation are commonly referred to as “developmentally-specific promoters” or “cell differentiation-specific promoters.” Promoters that are induced and cause a gene to be expressed following exposure or treatment of the cell with an agent, biological molecule, chemical, ligand, light, or the like that induces the promoter are commonly referred to as “inducible promoters” or “regulatable promoters.” It is further recognized that since in most cases the exact boundaries of regulatory sequences have not been completely defined, DNA fragments of different lengths can have identical promoter activity.
  • the promoter sequence is typically bounded at its 3' terminus by the transcription initiation site and extends upstream (5' direction) to include the minimum number of bases or elements necessary to initiate transcription at levels detectable above background.
  • a transcription initiation site (conveniently defined for example, by mapping with nuclease SI), as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase.
  • a promoter that can be used with the present disclosure includes a tissue specific promoter.
  • prophylactic refers to a therapeutic or course of action used to prevent the onset of a disease or condition, or to prevent or delay a symptom associated with a disease or condition.
  • a “prophylaxis” refers to a measure taken to maintain health and prevent the onset of a disease or condition, or to prevent or delay a symptom associated with a disease or condition.
  • the term "gene regulatory region” or “regulatory region” refers to nucleotide sequences located upstream (5' non-coding sequences), within, or downstream (3' non-coding sequences) of a coding region, and which influence the transcription, RNA processing, stability, or translation of the associated coding region. Regulatory regions can include promoters, translation leader sequences, introns, polyadenylation recognition sequences, RNA processing sites, effector binding sites, or stem-loop structures. If a coding region is intended for expression in a eukaryotic cell, a polyadenylation signal and transcription termination sequence will usually be located 3' to the coding sequence.
  • a miR-485 inhibitor disclosed herein e.g ., a polynucleotide encoding a RNA comprising one or more miR-485 binding site
  • a promoter and/or other expression (e.g., transcription) control elements operably associated with one or more coding regions.
  • a coding region for a gene product is associated with one or more regulatory regions in such a way as to place expression of the gene product under the influence or control of the regulatory region(s).
  • a coding region and a promoter are "operably associated" if induction of promoter function results in the transcription of mRNA encoding the gene product encoded by the coding region, and if the nature of the linkage between the promoter and the coding region does not interfere with the ability of the promoter to direct the expression of the gene product or interfere with the ability of the DNA template to be transcribed.
  • Other expression control elements besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can also be operably associated with a coding region to direct gene product expression.
  • similarity refers to the overall relatedness between polymeric molecules, e.g. between polynucleotide molecules (e.g. miRNA molecules). Calculation of percent similarity of polymeric molecules to one another can be performed in the same manner as a calculation of percent identity, except that calculation of percent similarity takes into account conservative substitutions as is understood in the art. It is understood that percentage of similarity is contingent on the comparison scale used, i.e., whether the nucleic acids are compared, e.g, according to their evolutionary proximity, charge, volume, flexibility, polarity, hydrophobicity, aromaticity, isoelectric point, antigenicity, or combinations thereof.
  • subject refers to any mammalian subject, including without limitation, humans, domestic animals (e.g, dogs, cats and the like), farm animals (e.g, cows, sheep, pigs, horses and the like), and laboratory animals (e.g, monkey, rats, mice, rabbits, guinea pigs and the like) for whom diagnosis, treatment, or therapy is desired, particularly humans.
  • domestic animals e.g, dogs, cats and the like
  • farm animals e.g, cows, sheep, pigs, horses and the like
  • laboratory animals e.g, monkey, rats, mice, rabbits, guinea pigs and the like
  • the phrase "subject in need thereof includes subjects, such as mammalian subjects, that would benefit from administration of a miRNA inhibitor of the disclosure (e.g, miR-485 inhibitor), e.g, to increase the expression level of SIRT1 protein and/or SIRT1 gene.
  • a miRNA inhibitor of the disclosure e.g, miR-485 inhibitor
  • the term "therapeutically effective amount” is the amount of reagent or pharmaceutical compound comprising a miRNA inhibitor of the present disclosure that is sufficient to a produce a desired therapeutic effect, pharmacologic and/or physiologic effect on a subject in need thereof.
  • a therapeutically effective amount can be a "prophylactically effective amount” as prophylaxis can be considered therapy.
  • treat refers to, e.g, the reduction in severity of a disease or condition; the reduction in the duration of a disease course; the amelioration or elimination of one or more symptoms associated with a disease or condition (e.g., diabetes); the provision of beneficial effects to a subject with a disease or condition, without necessarily curing the disease or condition.
  • the term also includes prophylaxis or prevention of a disease or condition or its symptoms thereof.
  • upstream refers to a nucleotide sequence that is located 5' to a reference nucleotide sequence.
  • a "vector” refers to any vehicle for the cloning of and/or transfer of a nucleic acid into a host cell.
  • a vector can be a replicon to which another nucleic acid segment can be attached so as to bring about the replication of the attached segment.
  • a "replicon” refers to any genetic element (e.g., plasmid, phage, cosmid, chromosome, virus) that functions as an autonomous unit of replication in vivo , i.e., capable of replication under its own control.
  • the term “vector” includes both viral and nonviral vehicles for introducing the nucleic acid into a cell in vitro, ex vivo or in vivo.
  • Plasmids A large number of vectors are known and used in the art including, for example, plasmids, modified eukaryotic viruses, or modified bacterial viruses. Insertion of a polynucleotide into a suitable vector can be accomplished by ligating the appropriate polynucleotide fragments into a chosen vector that has complementary cohesive termini.
  • Vectors can be engineered to encode selectable markers or reporters that provide for the selection or identification of cells that have incorporated the vector. Expression of selectable markers or reporters allows identification and/or selection of host cells that incorporate and express other coding regions contained on the vector.
  • selectable marker genes known and used in the art include: genes providing resistance to ampicillin, streptomycin, gentamycin, kanamycin, hygromycin, bialaphos herbicide, sulfonamide, and the like; and genes that are used as phenotypic markers, i.e., anthocyanin regulatory genes, isopentanyl transferase gene, and the like.
  • reporters known and used in the art include: luciferase (Luc), green fluorescent protein (GFP), chloramphenicol acetyltransferase (CAT), ⁇ -galactosidase (LacZ), ⁇ -glucuronidase (Gus), and the like. Selectable markers can also be considered to be reporters.
  • miR-485 inhibitors of the present disclosure can exert therapeutic effects (e.g, in a subject suffering from a neurodegenerative disease, e.g, ALS) by regulating the expression and/or activity of one or more genes.
  • miR- 485 inhibitors disclosed herein are capable of regulating the expression and/or activity of a gene selected from SIRT1, CD36, PGC1, NRXN1, STMN2, NRG1, or combinations thereof.
  • the miR-485 inhibitors can affect many biological processes, including, but not limited to, protein homeostasis (e.g ., SIRT1), those associated with the mitochondria (e.g., PGC1 ⁇ ), neuroinflammation (e.g, CD36 and SIRT1), neurogenesis/synaptogenesis (e.g, SIRT1, PGC1 ⁇ , STMN2, NRG1, andNRXN1).
  • SIRT1 Regulation e.g., SIRT1 Regulation
  • the present disclosure provides a method of increasing an expression of a SIRT1 protein and/or a SIRT1 gene in a subject in need thereof, comprising administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor).
  • miR-485 activity i.e., miR-485 inhibitor
  • inhibiting miR-485 activity increases the expression of a SIRT1 protein and/or SIRT1 gene in the subject.
  • SIRT1 also known as NAD-dependent deacetylase sirtuin-1
  • SIRT1 is a protein that in humans is encoded by the SIRT1 gene.
  • the SIRT1 gene is located on chromosome 10 in humans (nucleotides 67,884,656 to 67,918,390 of GenBank Accession Number NC_ 000010.11, plus strand orientation).
  • SIRT1 Synonyms of the SIRT1 gene, and the encoded protein thereof, are known and include "regulatory protein SIR2 homolog 1,” “silent mating-type information regulation 2 homolog 1,” “SIR2,” “ SIR2 -Like Protein 1,” “SIR2L1,” “SIR2alpha,” “Sirtuin Type 1,” “hSIRT1,” or “hSIR2.”
  • SIRT1 isoform 1 (UniProt identifier: Q96EB6-1) consists of 747 amino acids and has been chosen as the canonical sequence (SEQ ID NO: 31).
  • SIRT1 isoform 2 (also known as "delta-exon8) (UniProt identifier: Q96EB6-2) consists of 561 amino acids and differs from the canonical sequence as follows: 454-639: missing (SEQ ID NO: 32). Table 1 below provides the sequences for the two SIRT1 isoforms.
  • SIRT1 includes any variants or isoforms of SIRT1 which are naturally expressed by cells. Accordingly, in some aspects, a miR-485 inhibitor disclosed herein can increase the expression of SIRT1 isoform 1. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of SIRT1 isoform 2. In further aspects, a miR-485 inhibitor disclosed herein can increase the expression of both SIRT1 isoform 1 and isoform 2. Unless indicated otherwise, both isoform 1 and isoform 2 are collectively referred to herein as "SIRT1.”
  • a miR-485 inhibitor of the present disclosure increases the expression of SIRT1 protein and/or SIRT1 gene by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, or at least about 300% compared to a reference (e.g. , expression of SIRT1 protein and/or SIRT1 gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g. , expression of SIRT1 protein and/or SIRT1 gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor.
  • a miR-485 inhibitor disclosed herein increases the expression of SIRT1 protein and/or SIRT1 gene by reducing the expression and/or activity of miR-485, e.g., miR-485-3p.
  • a miR-485 inhibitor of the present disclosure can reduce the expression and/or activity of miR-485-3p.
  • a miR-485 inhibitor disclosed herein decreases the expression and/or activity of miR-485-3p by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% compared to a reference (e.g., miR-485- 3p expression in a corresponding subject that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g., miR-485- 3p expression in a corresponding subject that did not receive an administration of the miR-485 inhibitor.
  • a miR-485 inhibitor disclosed herein decreases the expression and/or activity of miR-485-5p by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% compared to a reference (e.g, miR-485- 5p expression in a corresponding subject that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g, miR-485- 5p expression in a corresponding subject that did not receive an administration of the miR-485 inhibitor.
  • a miR-485 inhibitor disclosed herein decreases the expression and/or activity of both miR-485-3p and miR-485-5p by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% compared to a reference (e.g, miR-485-3p and miR-485-5p expression in a corresponding subject that did not receive an administration of the miR-485 inhibitor).
  • the expression of miR- 485-3p and/or miR-485-5p is completely inhibited after the administration of the miR-485 inhibitor.
  • a miR-485 inhibitor of the present disclosure can increase the expression of SIRT1 protein and/or SIRT1 gene when administered to a subject. Accordingly, in some aspects, the present disclosure provides a method of treating a disease or condition associated with an abnormal (e.g, reduced) level of a SIRT1 protein and/or SIRT1 gene in a subject in need thereof. In some aspects, a disease or condition associated with abnormal (e.g, reduced) level of a SIRT1 protein and/or SIRT1 gene is amyotrophic lateral sclerosis (ALS). In certain aspects, the method comprises administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor), wherein the miR-485 inhibitor increases the level of the SIRT1 protein and/or SIRT1 gene.
  • miR-485 inhibitor amyotrophic lateral sclerosis
  • the present disclosure provides a method of increasing an expression of a CD36 protein and/or a CD36 gene in a subject in need thereof, comprising administering to the subject a compound that inhibits miR- 485 activity (i.e., miR-485 inhibitor).
  • miR-485 inhibitor i.e., miR-485 inhibitor
  • inhibiting miR-485 activity increases the expression of a CD36 protein and/or CD36 gene in the subject.
  • CD36 Cluster determinant 36
  • platelet glycoprotein 4 is a protein that in humans is encoded by the CD36 gene.
  • the CD36 gene is located on chromosome 7 (nucleotides 80,602,656 to 80,679,277 of GenBank Accession Number NC_000007.14, plus strand orientation).
  • CD36 gene and the encoded protein thereof, are known and include "platelet glycoprotein IV,” “fatty acid translocase,” “scavenger receptor class B member 3,” “glycoprotein 88,” “glycoprotein Illb,” “glycoprotein IV,” “thrombospondin receptor,” “GPIIIB,” “PAS IV,” “GP3B,” “GPIV,” “FAT,” “GP4,” “BDPLT10,” “SCARB3,” “CHDS7,” “PASIV,” or “PAS-4.”
  • CD36 isoform 1 (UniProt identifier: P16671-1) consists of 472 amino acids and has been chosen as the canonical sequence (SEQ ID NO: 36).
  • CD36 isoform 2 (also known as "ex8-del") (UniProt identifier: P16671-2) consists of 288 amino acids and differs from the canonical sequence as follows: 274-288: SIYAVFESDVNLKGI ⁇ ETCVHFTSSFSVCKS; and 289-472: missing (SEQ ID NO: 37).
  • CD36 Isoform 3 (also known as "ex6-7-del") (UniProt identifier: P16671-3) consists of 433 amino acids and differs from the canonical sequence as follows: 234-272: missing (SEQ ID NO: 38).
  • CD36 isoform 4 (also known as "ex4-del” (UniProt identifier: P16671-4) consists of 412 amino acids and differs from the canonical sequence as follows: 144-203: missing (SEQ ID NO: 39). Table 2 below provides the sequences for the four CD36 isoforms.
  • CD36 includes any variants or isoforms of CD36 which are naturally expressed by cells. Accordingly, in some aspects, a miR-485 inhibitor disclosed herein can increase the expression of CD36 isoform 1. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of CD36 isoform 2. In some aspect, a miR-485 inhibitor disclosed herein can increase the expression of CD36 isoform 3. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of CD36 isoform 4. In further aspects, a miR-485 inhibitor disclosed herein can increase the expression of both CD36 isoform
  • CD36 CD36 isoform 1, isoform 2, isoform 3, and isoform 4.
  • a miR-485 inhibitor of the present disclosure increases the expression of CD36 protein and/or CD36 gene by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, or at least about 300% compared to a reference (e.g. , expression of CD36 protein and/or CD36 gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g. , expression of CD36 protein and/or CD36 gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor.
  • a miR-485 inhibitor disclosed herein increases the expression of CD36 protein and/or CD36 gene by reducing the expression and/or activity of miR-485.
  • miR-485 There are two known mature forms of miR-485: miR-485-3p and miR-485-5p.
  • a miR-485 inhibitor of the present disclosure can reduce the expression and/or activity of miR-485-3p.
  • a miR- 485 inhibitor can reduce the expression and/or activity of miR-485-5p.
  • a miR-485 inhibitor disclosed herein can reduce the expression and/or activity of both miR-485- 3p and miR-485-5p.
  • a miR-485 inhibitor of the present disclosure can increase the expression of CD36 protein and/or CD36 gene when administered to a subject. Accordingly, in some aspects, the present disclosure provides a method of treating a disease or condition associated with an abnormal (e.g., reduced) level of a CD36 protein and/or CD36 gene in a subject in need thereof. In some aspects, a disease or condition associated with abnormal (e.g ., reduced) level of a CD36 protein and/or CD36 gene is amyotrophic lateral sclerosis (ALS). In certain aspects, the method comprises administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor), wherein the miR-485 inhibitor increases the level of the CD36 protein and/or CD36 gene.
  • miR-485 inhibitor amyotrophic lateral sclerosis
  • the disclosures provided herein demonstrates that the miR-485 inhibitors of the present disclosure can further regulate the expression of PGC-1 ⁇ , e.g. , in a subject suffering from a disease or disorder disclosed herein (see, e.g, Example 3). Therefore, in some aspects, the present disclosure provides a method of increasing an expression of a PGC-1 ⁇ protein and/or a PGC-1 ⁇ gene in a subject in need thereof, comprising administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor). In certain aspects, inhibiting miR-485 activity increases the expression of a PGC-1 ⁇ protein and/or PGC-1 ⁇ gene in the subject.
  • Peroxisome proliferator-activated receptor gamma coactivator 1 -alpha also known as PPARG Coactivator 1 Alpha or Ligand Effect Modulator-6, is a protein that in humans is encoded by the PPARGC1A gene.
  • the PGC1- ⁇ gene is located on chromosome 4 in humans (nucleotides 23,792,021 to 24,472,905 of GenBank Accession Number NC_000004.12, plus strand orientation).
  • PGC1- ⁇ gene Synonyms of the PGC1- ⁇ gene, and the encoded protein thereof, are known and include “ PPARGC1A,” “LEM6,” “PGC1,” “PGC1A,” “PGC- lv,” “PPARGC1, “PGC1 alpha,” or “PGC-1 (alpha).”
  • PGC1- ⁇ isoform 1 (UniProt identifier: Q9UBK2-1) consists of 798 amino acids and has been chosen as the canonical sequence (SEQ ID NO: 40).
  • PGC1- ⁇ isoform 2 (also known as "Isoform NT-7a") (UniProt identifier: Q9UBK2-2) consists of 271 amino acids and differs from the canonical sequence as follows: 269-271: DPK ⁇ LFL; 272-798: Missing
  • PGC1- ⁇ isoform 3 (also known as "Isoform B5") (UniProt identifier: Q9UBK2-3) consists of 803 amino acids and differs from the canonical sequence as follows:
  • PGC1- ⁇ isoform 4 (also known as "Isoform B4") (UniProt identifier: Q9UBK2-4) consists of 786 amino acids and differs from the canonical sequence as follows: 1-18: M AWDMCN QD SE S VW SDIE ⁇ MDEGYF (SEQ ID NO: 43).
  • PGC1- ⁇ isoform 5 (also known as "Isoform B4-8a") (UniProt identifier: Q9UBK2-5) consists of 289 amino acids and differs from the canonical sequence as follows: 1-18: MAWDMCNQDSESVWSDIE ⁇
  • PGC1- a isoform 6 (also known as "Isoform B5-NT") (UniProt identifier: Q9UBK2-6) consists of 276 amino acids and differs from the canonical sequence as follows: 1-18:
  • MAWDMCNQDSESVWSDIE MDET SPRLEEDWKKVLQRE AGWQ; 269-271: DPK ⁇
  • PGC1- ⁇ isoform 7 (also known as "B4-3ext") (UniProt identifier: Q9UBK2-7) consists of 138 amino acids and differs from the canonical sequence as follows: 1-18: MAWDMCNQDSESVWSDIE ⁇ MDEGYF; 144-150:
  • PGC1- ⁇ isoform 8 (also known as "Isoform 8a") (UniProt identifier: Q9UBK2-8) consists of 301 amino acids and differs from the canonical sequence as follows: 294-301: LTPPTTPP ® VKTNLISK; 302-
  • PGC1- ⁇ isoform 9 (also known as "Isoform 9" or "L-PGG- 1 alpha") (UniProt identifier: Q9UBK2-9) consists of 671 amino acids and differs from the canonical sequence as follows: 1-127: Missing (SEQ ID NO: 48). Table 3 below provides the sequences for the nine PGC1- ⁇ isoforms.
  • PGC1- ⁇ includes any variants or isoforms of PGC1- ⁇ which are naturally expressed by cells. Accordingly, in some aspects, a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 1. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 2. Accordingly, in some aspects, a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 1. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 2. Accordingly, in some aspects, a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 3.
  • a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 4. Accordingly, in some aspects, a miR- 485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 5. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 6. Accordingly, in some aspects, a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 7. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 8. Accordingly, in some aspects, a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 9.
  • a miR-485 inhibitor disclosed herein can increase the expression of PGC1- ⁇ isoform 1, isoform 2, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8, and isoform 9..
  • PGC1- a isoform 1 and isoform 2 are collectively referred to herein as "PGC1- a.
  • a miR-485 inhibitor of the present disclosure increases the expression of PGC1- ⁇ protein and/or PGC1- ⁇ gene by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, or at least about 300% compared to a reference (e.g. , expression of PGC1- ⁇ protein and/or PGC1- ⁇ gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g. , expression of PGC1- ⁇ protein and/or PGC1- ⁇ gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor.
  • a miR-485 inhibitor disclosed herein increases the expression of PGC1- ⁇ protein and/or PGC1- ⁇ gene by reducing the expression and/or activity of miR-485.
  • miR-485 There are two known mature forms of miR-485: miR- 485-3p and miR-485-5p.
  • a miR-485 inhibitor of the present disclosure can reduce the expression and/or activity of miR-485-3p.
  • a miR-485 inhibitor can reduce the expression and/or activity of miR-485-5p.
  • a miR-485 inhibitor disclosed herein can reduce the expression and/or activity of both miR-485-3p and miR-485- 5p.
  • a miR-485 inhibitor of the present disclosure can increase the expression of PGC1- ⁇ protein and/or PGC1- ⁇ gene when administered to a subject. Accordingly, in some aspects, the present disclosure provides a method of treating a disease or condition associated with an abnormal (e.g., reduced) level of a PGC1- ⁇ protein and/or PGC1- a gene in a subject in need thereof. In some aspects, a disease or condition associated with abnormal (e.g, reduced) level of a PGC1- ⁇ protein and/or PGC1- ⁇ gene is amyotrophic lateral sclerosis (ALS).
  • ALS amyotrophic lateral sclerosis
  • the method comprises administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor), wherein the miR-485 inhibitor increases the level of the PGC1- ⁇ protein and/or PGC1- ⁇ gene.
  • miR-485 inhibitor a compound that inhibits miR-485 activity
  • the miR-485 inhibitor increases the level of the PGC1- ⁇ protein and/or PGC1- ⁇ gene.
  • the disclosures provided herein demonstrates that the miR-485 inhibitors of the present disclosure can further regulate the expression of NRG1, e.g, in a subject suffering from a disease or disorder disclosed herein (see, e.g, ALS). Therefore, in some aspects, the present disclosure provides a method of increasing an expression of a NRG1 protein and/or a NRG1 gene in a subject in need thereof, comprising administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor). In certain aspects, inhibiting miR-485 activity increases the expression of a NRG1 protein and/or NRG1 gene in the subject.
  • Neuregulin l is a cell adhesion molecule that in humans is encoded by the NRG1 gene.
  • NRG1 is one of four proteins in the neuregulin family that act on the EGFR family of receptors.
  • the NRG1 gene is located on chromosome 8 in humans (nucleotides 31,639,245 to 32,774,046 of GenBank Accession Number NC_000008.11).
  • NRG1 isoform 1 (also known as "Alpha”) (UniProt identifier: Q02297-1) is 640 amino acids in length and has been chosen as the canonical sequence (SEQ ID NO: 91).
  • NRG1 isoform 2 (also known as "Alpha1A”) (UniProt identifier: Q02297-2) is 648 amino acids long and differs from the canonical sequence as follows: 234-234: K ⁇ KHLGIEFIE (SEQ ID NO: 92).
  • NRG1 isoform 3 (also known as "Alpha2B") (UniProt identifier: Q02297-3) is 462 amino acids long and differs from the canonical sequence as follows: (i) 424-462: YVSAMTTPAR...SPPVSSMTVS ⁇ HNLIAELRRN...SSIPHLGFIL; and (ii) 463-640: Missing (SEQ ID NO: 93).
  • NRG1 isoform 4 (also known as "Alpha3") (UniProt identifier: Q02297-4) consists of 247 amino acids and differs from the canonical sequence as follows: (i) 234-247: K AEEL Y QKRVLTIT ⁇ S AQMSLL VIAAKTT ; and (ii) 248-260: Missing (SEQ ID NO: 94).
  • NRG1 isoform 6 (also known as “Betal” and “BetalA”) (UniProt identifier: Q02297- 6) is 645 amino acids in length and differs from the canonical sequence as follows: 213-234: QPGFTGARCTENVPMKVQNQEK ⁇ PNEFTGDRCQNYVMASFYKHLGIEFME (SEQ ID NO: 95).
  • NRG1 isoform 7 (also known as "Beta2”) (UniProt identifier: Q02297-7) consists of 647 amino acids and differs from the canonical sequence as follows: 213-233: QPGFTGARCTENVPMKVQNQE ⁇ PNEFTGDRCQNYVMASFY (SEQ ID NO: 96).
  • NRG1 isoform 8 (also known as "Beta3" and "GGFHFB1”) (UniProt identifier: Q02297-8) is made up of 241 amino acids and differs from the canonical sequence as follows: (i) 213-241: QPGF TGARC TENVPMK V QN QEK AEEL Y QK ⁇ PNEF T GDRC QN Y VM A SFYSTSTPFL SLPE; and (ii) 242-640: Missing (SEQ ID NO: 97).
  • NRG1 isoform 9 (also known as "GGF2" and "GGFHPP2”) (UniProt identifier: Q02297-9) is 422 amino acids in length and differs from the canonical sequence as follows: (i) 1-33:
  • NRG1 isoform 10 (also known as "SMDF") (UniProt identifier: Q02297-10) is 296 amino acids long and differs from the canonical sequence as follows: (i) 1-166: Missing; (ii) 167-167:
  • NRG1 isoform 11 (also known as "Type IV-betala") (UniProt identifier: Q02297-11) is 590 amino acids long and differs from the canonical sequence as follows: (i) 1-21: Missing; (ii) 22-33:
  • NRG1 isoform 12 (UniProt identifier: Q02297-12) consists of 420 amino acids and differs from the canonical sequence as follows: (i) 213-233:
  • Table 4 below provides the amino acid sequences for the NRG1 protein, including known isoforms.
  • a miR-485 inhibitor disclosed herein can increase the expression ofNRG1 isoform 1 (i.e., canonical sequence).
  • a miR-485 inhibitor disclosed herein can increase the expression ofNRG1 isofrom 2.
  • a miR-485 inhibitor disclosed herein can increase the expression ofNRG1 isoform 3.
  • a miR-485 inhibitor disclosed herein can increase the expression ofNRG1 isoform 4.
  • a miR-485 inhibitor disclosed herein can increase the expression ofNRG1 isoform 6.
  • a miR-485 inhibitor disclosed herein can increase the expression of NRG1 isoform 7. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression ofNRG1 isoform 8. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression ofNRG1 isoform 9. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of NRG1 isoform 10. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of NRG1 isoform 11. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression ofNRG1 isoform 12.
  • a miR-485 inhibitor disclosed herein can increase the expression ofNRG1 isoform 1,NRG1 isoform 2, NRG1 isoform 3, NRG1 isoform 4, NRG1 isoform 6, NRG1 isoform 7, NRG1 isoform 8, NRG1 isoform 9, NRG1 isoform 10, NRG1 isoform 11, andNRG1 isoform 12.
  • NRG1 isoform 1,NRG1 isoform 2, NRG1 isoform 3, NRG1 isoform 4, NRG1 isoform 6, NRG1 isoform 7, NRG1 isoform 8, NRG1 isoform 9, NRG1 isoform 10, NRG1 isoform 11, andNRG1 isoform 12.
  • a miR-485 inhibitor of the present disclosure increases the expression ofNRG1 protein and/or NRG1 gene by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, or at least about 300% compared to a reference (e.g. , expression ofNRG1 protein and/orNRG1 gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g. , expression ofNRG1 protein and/orNRG1 gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor.
  • a miR-485 inhibitor disclosed herein increases the expression of NRG1 protein and/or NRG1 gene by reducing the expression and/or activity of miR-485, e.g., miR-485-3p.
  • a miR-485 inhibitor of the present disclosure can increase the expression of NRG1 protein and/or NRG1 gene when administered to a subject. Accordingly, in some aspects, the present disclosure provides a method of treating a disease or condition associated with an abnormal (e.g, reduced) level of a NRG1 protein and/or NRG1 gene in a subject in need thereof. In some aspects, a disease or condition associated with abnormal (e.g, reduced) level of a NRG1 protein and/or NRG1 gene is amyotrophic lateral sclerosis (ALS). In certain aspects, the method comprises administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor), wherein the miR-485 inhibitor increases the level of the NRG1 protein and/or NRG1 gene.
  • miR-485 inhibitor amyotrophic lateral sclerosis
  • the disclosures provided herein demonstrates that the miR-485 inhibitors of the present disclosure can further regulate the expression of STMN2, e.g, in a subject suffering from a disease or disorder disclosed herein (see, e.g, ALS). Therefore, in some aspects, the present disclosure provides a method of increasing an expression of a STMN2 protein and/or a STMN2 gene in a subject in need thereof, comprising administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor). In certain aspects, inhibiting miR-485 activity increases the expression of a STMN2 protein and/or STMN2 gene in the subject.
  • Stathmin-2 is a member of the stathmin family of phosphoproteins and in humans is encoded by the STMN2 gene.
  • Stathmin proteins function in microtubule dynamics and signal transduction.
  • the encoded protein plays a regulatory role in neuronal growth and is also thought to be involved in osteogenesis.
  • the STMN2 gene is located on chromosome 8 in humans (nucleotides 79,611,117 to 79, 666,162 of NC_000008.11). Synonyms of the STMN2 gene, and the encoded protein thereof, are known and include "SCG10" and "SCGN10.”
  • STMN2 isoform 1 (UniProt identifier: Q93045-1) is 179 amino acids in length and has been chosen as the canonical sequence (SEQ ID NO: 102).
  • STMN2 isofrom 2 (UniProt identifier: Q93045-2) is 187 amino acids in length and differs from the canonical sequence as follows: 161-179:
  • Table 5 provides the amino acid sequences for the STMN2 protein.
  • STMN2 includes any variants or isoforms of STMN2 which are naturally expressed by cells. Accordingly, in some aspects, a miR-485 inhibitor disclosed herein can increase the expression of STMN2 isoform 1 (i.e., canonical sequence). In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of STMN2 isofrom 2. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of STMN2 isoform 1 and STMN2 isoform 2.
  • a miR-485 inhibitor of the present disclosure increases the expression of STMN2 protein and/or STMN2 gene by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, or at least about 300% compared to a reference (e.g. , expression of STMN2 protein and/or STMN2 gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g. , expression of STMN2 protein and/or STMN2 gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor.
  • a miR-485 inhibitor disclosed herein increases the expression of STMN2 protein and/or STMN2 gene by reducing the expression and/or activity of miR-485, e.g., miR-485-3p.
  • a miR-485 inhibitor of the present disclosure can increase the expression of STMN2 protein and/or STMN2 gene when administered to a subject. Accordingly, in some aspects, the present disclosure provides a method of treating a disease or condition associated with an abnormal (e.g, reduced) level of a STMN2 protein and/or STMN2 gene in a subject in need thereof. In some aspects, a disease or condition associated with abnormal (e.g, reduced) level of a STMN2 protein and/or STMN2 gene is amyotrophic lateral sclerosis (ALS). In certain aspects, the method comprises administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor), wherein the miR-485 inhibitor increases the level of the STMN2 protein and/or STMN2 gene.
  • miR-485 inhibitor amyotrophic lateral sclerosis
  • the disclosures provided herein demonstrates that the miR-485 inhibitors of the present disclosure can further regulate the expression of NRXN1, e.g, in a subject suffering from a disease or disorder disclosed herein (see, e.g, ALS). Therefore, in some aspects, the present disclosure provides a method of increasing an expression of a NRXN1 protein and/or a NRXN1 gene in a subject in need thereof, comprising administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor). In certain aspects, inhibiting miR-485 activity increases the expression of a NRXN1 protein and/or NRXN1 gene in the subject.
  • Neurexin 1 is a member of the neurexin family of proteins and in humans is encoded by the NRXNl gene.
  • Neurexins are a family of proteins that function in the vertebrate nervous system as cell adhesion molecules and receptors. They are involved in communication through coupling mechanisms of calcium channels and vesicle exocytosis, to ensure that neurotransmitters are properly released.
  • the NRXN1 gene is located on chromosome 2 in humans (nucleotides 49,918,503 to 51,032,536 of NC_000002.12). Synonyms of the NRXN1 gene, and the encoded protein thereof, are known and include "neurexin 1 alpha,” “neurexin 1 beta,” “PTHSL2,” “SCZD17,” and "Hs.22998.”
  • NRXN1 isoform la (UniProt identifier: Q9ULB1-1) is 1,477 amino acids long and has been chosen as the canonical sequence (SEQ ID NO: 104).
  • NRXN1 isoform 2a (UniProt identifier: Q9ULB1-2) consists of 1,496 amino acids and differs from the canonical sequence as follows: (i) 379-386: Missing; (ii) 1239-1239:
  • NRXN1 isoform 3a (UniProt identifier: Q9ULB1-3) is 1,547 amino acids long and differs the from the canonical sequence as follows: (i) 258-258:
  • a ⁇ AGNNDNERLAIARQRIPYRLGRVVDEWLLDK (SEQ ID NO: 106).
  • NRXN1 isoform 4 (UniProt identifier: Q9ULB1-4) is 139 amino acids in length and differs from the canonical sequence as follows: (i) 1-1335: Missing; (ii) 1336-1344: GKPPTKEPI ⁇ MDMRWHCEN; and (iii) 1373-1375: Missing (SEQ ID NO: 107).
  • NRXN1-beta protein there at least two known isoforms resulting from alternative splicing.
  • NRXN1 isoform lb (UniProt identifier: P58400-2) is 472 amino acids in length and has been chosen as the canonical sequence (SEQ ID NO: 108).
  • NRXN1 isoform 3b (UniProt identifier: P58400-1) consists of 442 amino acids and differs from the canonical sequence as follows: 205-234: Missing (SEQ ID NO: 109).
  • Tables 6 and 7 below provide the amino acid sequences for the NRXN1 protein.
  • NRXN1 includes any variants or isoforms of NRXN1 which are naturally expressed by cells. Accordingly, in some aspects, a miR-485 inhibitor disclosed herein can increase the expression of NRXN1 isoform la. In some aspects, a miR- 485 inhibitor disclosed herein can increase the expression NRXN1 isoform 2a. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression NRXN1 isoform 3a. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression NRXN1 isoform 4a. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression NRXN1 isoform lb.
  • a miR-485 inhibitor disclosed herein can increase the expression NRXN1 isoform 3b. In some aspects, a miR-485 inhibitor disclosed herein can increase the expression of NRXN1 isoform la, NRXN1 isoform 2a, NRXN1 isoform 3a, NRXN1 isoform 4a, NRXN1 isoform lb, and NRXN1 isoform 3b. Unless indicated otherwise, the above- described isoforms of NRXN1 are collectively referred to herein as " NRXN1.”
  • a miR-485 inhibitor of the present disclosure increases the expression of NRXN1 protein and/or NRXN1 gene by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, or at least about 300% compared to a reference (e.g, expression of NRXN1 protein and/or NRXN1 gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g, expression of NRXN1 protein and/or NRXN1 gene in a corresponding subject that did not receive an administration of the miR-485 inhibitor.
  • a miR-485 inhibitor disclosed herein increases the expression of NRXN1 protein and/or NRXN1 gene by reducing the expression and/or activity of miR-485, e.g. , miR-485-3p.
  • a miR-485 inhibitor of the present disclosure can increase the expression of NRXN1 protein and/or NRXN1 gene when administered to a subject. Accordingly, in some aspects, the present disclosure provides a method of treating a disease or condition associated with an abnormal (e.g, reduced) level of a NRXN1 protein and/or NRXN1 gene in a subject in need thereof. In some aspects, a disease or condition associated with abnormal (e.g, reduced) level of a NRXN1 protein and/or NRXN1 gene is amyotrophic lateral sclerosis (ALS).
  • ALS amyotrophic lateral sclerosis
  • the method comprises administering to the subject a compound that inhibits miR-485 activity (i.e., miR-485 inhibitor), wherein the miR-485 inhibitor increases the level of the NRXN1 protein and/or NRXN1 gene.
  • miR-485 inhibitor i.e., miR-485 inhibitor
  • any disease or condition associated with abnormal (e.g, reduced) level of a SIRT1 protein and/or SIRT1 gene can be treated with the present disclosure.
  • the present disclosure can be useful in treating any disease or condition associated with abnormal (e.g, reduced) level of a CD36 protein and/or CD36 gene.
  • the present disclosure can also be used to treat a disease or disorder associated with abnormal (e.g, reduced) level of a PGC1- ⁇ protein and/or PGC1- ⁇ gene.
  • the present disclosure can also be used to treat a disease or disorder associated with abnormal (e.g, reduced) level of aNRG1 protein and/or NRG1 gene.
  • the present disclosure can also be used to treat a disease or disorder associated with abnormal (e.g, reduced) level of a STMN2 protein and/or STMN2 gene. In some aspects, the present disclosure can also be used to treat a disease or disorder associated with abnormal (e.g ., reduced) level of aNRXN1 protein and/or NRXN1 gene.
  • a disease or condition associated with abnormal (e.g., reduced) level of such proteins and/or genes is amyotrophic lateral sclerosis (ALS).
  • a disease or condition associated with abnormal (e.g, reduced) level of such proteins and/or genes is not a disease or condition selected from the following: Alzheimer's disease, Parkinson's disease, autism spectrum disorder, mental retardation, seizure, stroke, spinal cord injury, or any combination thereof.
  • ALS that can be treated with present disclosure comprises a sporadic ALS, familial ALS, or both.
  • sporadic ALS refers to ALS that is not associated with any family history of ALS occurrence. Approximately about 90% or more of the ALS diagnosis are for sporadic ALS.
  • familial ALS refers to ALS that occurs more than once within a family, suggesting a genetic component to the disease.
  • ALS that can be treated with the present disclosure comprises primary lateral sclerosis (PLS). PLS can affect upper motor neurons in the arms and legs.
  • PLS primary lateral sclerosis
  • ALS comprises progressive muscular astrophy (PMA).
  • PMA progressive muscular astrophy
  • PMA can affect lower motor neurons in the arms and legs. While PMA is associated with longer survival on average than classic ALS, it still progresses to other spinal cord regions over time, eventually leading to respiratory failure and death.
  • Upper motor neuron signs can develop late in the course of PMA, in which case the diagnosis might be changed to classic ALS.
  • administering a miR-485 inhibitor disclosed herein can improve one or more symptoms of a disease or condition associated with abnormal (e.g, reduced) levels of SIRT1 protein and/or SIRT1 gene. In some aspects, administering a miR-485 inhibitor disclosed herein can improve one or more symptoms of a disease or condition associated with abnormal (e.g, reduced) levels of CD36 protein and/or CD36 gene. In some aspects, administering a miR-485 inhibitor disclosed herein can improve one or more symptoms of a disease or condition associated with abnormal (e.g, reduced) levels of PGC1- ⁇ protein and/or PGC1- ⁇ gene.
  • administering a miR-485 inhibitor disclosed herein can improve one or more symptoms of a disease or condition associated with abnormal (e.g ., reduced) levels of NRG1 protein and/or NRG1 gene.
  • administering a miR- 485 inhibitor disclosed herein can improve one or more symptoms of a disease or condition associated with abnormal (e.g., reduced) levels of STMN2 protein and/or STMN2 gene.
  • administering a miR-485 inhibitor disclosed herein can improve one or more symptoms of a disease or condition associated with abnormal (e.g, reduced) levels of NRXN1 protein and/or NRXN1 gene. Non-limiting examples of such symptoms are described below.
  • a disease or disorder associated with abnormal expression of SIRT1, CD36, PGC1- ⁇ N, RG1 , STMN2, and/or NRXN1 is amyotrophic lateral sclerosis (ALS).
  • a miR-485 inhibitor disclosed herein can improve one or more symptoms associated with ALS.
  • symptoms include: difficulty walking or doing normal daily activities; tripping and falling; weakness of the limbs; slurred speech; trouble swallowing; muscle cramps and twitching; inappropriate crying, laughing, or yawning; dementia; cognitive and behavioral changes; and combinations thereof.
  • administering a miR-485 inhibitor to a subject can increase the physical strength of one or more limbs of the subject (e.g, suffering from an ALS). For instance, in some aspects, the ability of a subject to hold on to an object (e.g, hang wire or pole) for an extended period of time is increased compared to a reference (e.g, corresponding value in the subj ect prior to the administering).
  • a reference e.g, corresponding value in the subj ect prior to the administering.
  • the period of time that a subj ect can hold onto an object is increased by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, or at least about 300% or more compared to a reference (e.g., subjects that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g., subjects that did not receive an administration of the miR-485 inhibitor
  • administering a miR-485 inhibitor disclosed herein to a subject can delay disease onset compared to a reference (e.g, disease onset in a corresponding individual that did not receive an administration of the miR-485 inhibitor).
  • disease onset of ALS is delayed by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, or at least about 300% or more compared to a reference (e.g, subjects that did not receive an administration of the miR-485 inhibitor).
  • disease onset of ALS is delayed by at least about 10 days, at least about 20 days, at least about 30 days, at least about 40 days, at least about 50 days, at least about 60 days, at least about 70 days, at least about 80 days, at least about 90 days, at least about 100 days, at least about 150 days, at least about 200 days, at least about 250 days, at least about 1 year, at least about 2 years, at least about 3 years, at least about 4 years, or at least about 5 years or more compared to a reference (e.g, subjects that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g, subjects that did not receive an administration of the miR-485 inhibitor.
  • administering a miR-485 inhibitor to a subject can improve one or more cognitive symptom in a subject (e.g, suffering from an ALS) compared to a reference (e.g, cognitive symptom in the subject prior to the administering).
  • administering a miR-485 inhibitor of the present disclosure reduces the occurrence or risk of occurrence of one or more symptoms of ALS in a subject (e.g, stumbling, a hard time holding items with your hands, slurred speech, swallowing problems, muscle cramps, worsening posture, a hard time holding your head up, muscle stiffness, or any combination thereof) by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100% compared to a reference (e.g, subjects that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g, subjects that did not receive an administration of the miR-485 inhibitor
  • administering a miR-485 inhibitor of the present disclosure increases the phagocytic activity of scavenger cells (e.g, glial cells) (e.g, by increasing the expression of CD36 protein and/or CD36 gene) in a subject (e.g, suffering from an ALS) compared to a reference (e.g, phagocytic activity in the subject prior to the administering).
  • scavenger cells e.g, glial cells
  • a reference e.g, phagocytic activity in the subject prior to the administering.
  • administering a miR-485 inhibitor of the present disclosure increases dendritic spine density of a neuron in a subject (e.g, suffering from an ALS) by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, or at least about 300% or more compared to a reference ( e.g ., subjects that did not receive an administration of the miR- 485 inhibitor).
  • a reference e.g ., subjects that did not receive an administration of the miR- 485 inhibitor
  • administering a miR-485 inhibitor disclosed herein increases neurogenesis in a subject (e.g., suffering from an ALS) (e.g, by increasing the expression of CD36 protein and/or CD36 gene) compared to a reference (e.g, neurogenesis in the subject prior to the administering).
  • a reference e.g, neurogenesis in the subject prior to the administering.
  • neurogenesis refers to the process by which neurons are created. Neurogenesis encompasses proliferation of neural stem and progenitor cells, differentiation of these cells into new neural cell types, as well as migration and survival of the new cells. The term is intended to cover neurogenesis as it occurs during normal development, predominantly during pre-natal and peri-natal development, as well as neural cells regeneration that occurs following disease, damage or therapeutic intervention.
  • a miR-485 inhibitor of the present disclosure increases neurogenesis in a subject (e.g, suffering from an ALS) by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, or at least about 300% or more compared to a reference (e.g, subjects that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g, subjects that did not receive an administration of the miR-485 inhibitor.
  • increasing and/or inducing neurogenesis is associated with increased proliferation, differentiation, migration, and/or survival of neural stem cells and/or progenitor cells. Accordingly, in some aspects, administering a miR-485 inhibitor of the present disclosure can increase the proliferation of neural stem cells and/or progenitor cells in the subject.
  • the proliferation of neural stem cells and/or progenitor cells is increased by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, or at least about 300% or more compared to a reference (e.g, subjects that did not receive an administration of the miR-485 inhibitor).
  • the survival of neural stem cells and/or progenitor cells is increased by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, or at least about 300% or more compared to a reference (e.g ., subjects that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g ., subjects that did not receive an administration of the miR-485 inhibitor.
  • increasing and/or inducing neurogenesis is associated with an increased number of neural stem cells and/or progenitor cells.
  • the number of neural stem cells and/or progenitor cells is increased by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, or at least about 300% or more compared to a reference (e.g., subjects that did not receive an administration of the miR-485 inhibitor).
  • increasing and/or inducing neurogenesis is associated with increased axon, dendrite, and/or synapse development.
  • axon, dendrite, and/or synapse development is increased by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, or at least about 300% or more compared to a reference (e.g., subjects that did not receive an administration of the miR-485 inhibitor).
  • administering a miR-485 inhibitor of the present disclosure decreases neuroinflammation (e.g, by increasing the expression of SIRT1 protein and/or SIRT1 gene) in a subject (e.g, suffering from an ALS) compared to a reference (e.g, neuroinflammation in the subject prior to the administering).
  • administering a miR-485 inhibitor decreases neuroinflammation in a subject (e.g, suffering from an ALS) by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100% compared to a reference (e.g, subjects that did not receive an administration of the miR-485 inhibitor).
  • decreased neuroinflammation comprises glial cells producing decreased amounts of inflammatory mediators.
  • administering a miR-485 inhibitor disclosed herein to a subject decreases the amount of inflammatory mediators produced by glial cells by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100% compared to a reference ( e.g ., subjects that did not receive an administration of the miR-485 inhibitor).
  • an inflammatory mediator produced by glial cells comprises TNF- a.
  • the inflammatory mediator comprises IL-I ⁇ .
  • an inflammatory mediator produced by glial cells comprises both TNF-a and IL-I ⁇ .
  • administering a miR-485 inhibitor disclosed herein increases autophagy (e.g., by increasing the expression of a SIRT1 protein and/or SIRT1 gene) in a subject (e.g, suffering from an ALS).
  • autophagy refers to cellular stress response and a survival pathway that is responsible for the degradation of long-lived proteins, protein aggregates, as well as damaged organelles in order to maintain cellular homeostasis.
  • administering a miR-485 inhibitor disclosed herein to a subject increases autophagy by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 100%, at least about 150%, at least about 200%, or at least about 300% or more, compared to a reference (e.g, subjects that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g, subjects that did not receive an administration of the miR-485 inhibitor
  • ALS patients exhibit certain motor and/or non-motor symptoms.
  • motor symptoms associated with ALS include muscle weakness (e.g, weakness in legs, difficulty grasping a pen or cup, difficulty lifting arms above the head, clumsiness when carrying out fine motor movements with hands or fingers, difficulty breathing), muscle atrophy, fasciculations (i.e., brief, spontaneous, uncontrolled twitching of the muscles), spasticity (i.e., prolonged, uncontrollable contraction of a muscle, leading to tightness and stiffness), dysarthria (i.e., slow, slurred speech, due to an inability to move the mouth and facial muscles), dysphagia (i.e., inability to swallow), and combinations thereof.
  • muscle weakness e.g, weakness in legs, difficulty grasping a pen or cup, difficulty lifting arms above the head, clumsiness when carrying out fine motor movements with hands or fingers, difficulty breathing
  • muscle atrophy i.e., brief, spontaneous, uncontrolled twitching of the muscles
  • spasticity
  • Non-limiting examples of non-motor symptoms associated with ALS include cognitive impairment, pseudobulbar affect (PBA) (i.e., involuntary and uncontrollable episodes of either laughing or crying that seem inappropriate in the social situation), or both.
  • PBA pseudobulbar affect
  • administering a miR-485 inhibitor of the present disclosure improves one or more motor symptoms in a subject (e.g ., suffering from an ALS) compared to a reference (e.g., corresponding motor symptoms in the subject prior to the administering).
  • administering a miR-485 inhibitor of the present disclosure improves one or more motor symptoms in a subject (e.g, suffering from an ALS) by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, or at least about 300% or more compared to a reference (e.g, subjects that did not receive an administration of the miR-485 inhibitor).
  • a reference e.g, subjects that did not receive an administration of the miR-485 inhibitor
  • administering a miR-485 inhibitor of the present disclosure improves one or more non-motor symptoms in a subject (e.g, suffering from an ALS) compared to a reference (e.g, corresponding non-motor symptom in the subject prior to the administering).
  • administering a miR-485 inhibitor disclosed herein improves one or more non -motor symptoms in a subject (e.g, suffering from an ALS) by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, or at least about 300% or more compared to a reference (e.g, subjects that did not receive an administration of the miR- 485 inhibitor).
  • a reference e.g, subjects that did not receive an administration of the miR- 485 inhibitor
  • a miR-485 inhibitor disclosed herein can be administered by any suitable route known in the art.
  • a miR-485 inhibitor is administered parenthetically, intramuscularly, subcutaneously, ophthalmic, intravenously, intraperitoneally, intradermally, intraorbitally, intracerebrally, intracranially, intracerebroventricularly, intraspinally, intraventricular, intrathecally, intracistemally, intracapsularly, intratumorally, or any combination thereof.
  • a miR-485 inhibitor is administered intracerebroventricularly (ICV).
  • a miR-485 inhibitor is administered intravenously.
  • a miR-485 inhibitor of the present disclosure can be used in combination with one or more additional therapeutic agents.
  • the additional therapeutic agent and the miR-485 inhibitor are administered concurrently.
  • the additional therapeutic agent and the miR-485 inhibitor are administered sequentially.
  • miR-485 inhibitors of the present disclosure do not adversely affect body weight when administered to a subject. In some aspects, miR-485 inhibitors disclosed herein do not result in increased mortality or cause pathological abnormalities when administered to a subject.
  • a miR-485 inhibitor of the present disclosure comprises a nucleotide sequence encoding a nucleotide molecule that comprises at least one miR-485 binding site, wherein the nucleotide molecule does not encode a protein.
  • the miR-485 binding site is at least partially complementary to the target miRNA nucleic acid sequence (i.e., miR-485), such that the miR-485 inhibitor hybridizes to the miR-485 nucleic acid sequence.
  • the miR-485 binding site of a miR inhibitor disclosed herein has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% sequence complementarity to the nucleic acid sequence of a miR-485.
  • the miR-485 binding site is fully complementary to the nucleic acid sequence of a miR-485.
  • the miR-485 hairpin precursor can generate both miR-485-5p and miR-485-3p.
  • miR-485" encompasses both miR-485-5p and miR-485- 3p unless specified otherwise.
  • the human mature miR-485-3p has the sequence 5'- GUCAUACACGGCUCUCCUCUCU-3' (SEQ ID NO: 1; miRBase Acc. No.
  • a 5' terminal subsequence of miR-485-3p 5'-UCAUACA-3' is the seed sequence.
  • the human mature miR-485-5p has the sequence 5'- AGAGGCUGGCCGUGAUGAAUUC-3' (SEQ ID NO: 33; miRBase Acc. No. MIMAT0002 175).
  • a 5' terminal subsequence of miR-485-5p 5'-GAGGCUG-3' is the seed sequence.
  • the human mature miR-485-3p has significant sequence similarity to that of other species.
  • the mouse mature miR-485-3p differs from the human mature miR-485-3p by a single amino acid at each of the 5'- and 3'- ends (i.e., has an extra "A” at the 5'-end and missing "C” at the 3'-end).
  • the mouse mature miR-485-3p has the following sequence: 5'-AGUC AUACACGGCUCUCCUCUC-3 ' (SEQ ID NO: 34; miRBase Acc. No. MIMAT0003129; underlined portion corresponds to overlap to human mature miR-485-3p).
  • the sequence for the mouse mature miR-485-5p is identical to that of the human: 5'-agaggcuggccgugaugaauuc-3' (SEQ ID NO: 33; miRBase Acc. No.
  • a miR-485 inhibitor of the present disclosure is capable of binding miR-485-3p and/or miR-485-5p from one or more species.
  • a miR-485 inhibitor disclosed herein is capable of binding to miR-485-3p and/or miR-485-5p from both human and mouse.
  • the miR-485 binding site is a single-stranded polynucleotide sequence that is complementary (e.g ., fully complementary) to a sequence of a miR-485-3p (or a subsequence thereof).
  • the miR-485-3p subsequence comprises the seed sequence.
  • the miR-485 binding site has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% sequence complementarity to the nucleic acid sequence set forth in SEQ ID NO: 49.
  • the miR-485 binding site is complementary to miR-485-3p except for 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mismatches.
  • the miR-485 binding site is fully complementary to the nucleic acid sequence set forth in SEQ ID NO: 1.
  • the miR-485 binding site is a single-stranded polynucleotide sequence that is complementary (e.g., fully complementary) to a sequence of a miR-485-5p (or a subsequence thereof).
  • the miR-485-5p subsequence comprises the seed sequence.
  • the miR-485 binding site has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% sequence complementarity to the nucleic acid sequence set forth in SEQ ID NO: 50.
  • the miR-485 binding site is complementary to miR-485-5p except for 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mismatches.
  • the miR-485 binding site is fully complementary to the nucleic acid sequence set forth in SEQ ID NO: 35.
  • the seed region of a miRNA forms a tight duplex with the target mRNA.
  • Most miRNAs imperfectly base-pair with the 3' untranslated region (UTR) of target mRNAs, and the 5' proximal "seed" region of miRNAs provides most of the pairing specificity.
  • UTR 3' untranslated region
  • the miRNA ribonucleotides 3' of this region allow for lower sequence specificity and thus tolerate a higher degree of mismatched base pairing, with positions 2-7 being the most important.
  • the miR-485 binding site comprises a subsequence that is fully complementary (i.e., 100% complementary) over the entire length of the seed sequence of miR- 485.
  • miRNA sequences and miRNA binding sequences that can be used in the context of the disclosure include, but are not limited to, all or a portion of those sequences in the sequence listing provided herein, as well as the miRNA precursor sequence, or complement of one or more of these miRNAs.
  • any aspects of the disclosure involving specific miRNAs or miRNA binding sites by name is contemplated also to cover miRNAs or complementary sequences thereof whose sequences are at least about at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to the mature sequence of the specified miRNA
  • miRNA binding sequences of the present disclosure can include additional nucleotides at the 5', 3', or both 5' and 3' ends of those sequences in the sequence listing provided herein, as long as the modified sequence is still capable of specifically binding to miR-485.
  • miRNA binding sequences of the present disclosure can differ in at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more nucleotides with respect to those sequence in the sequence listing provided, as long as the modified sequence is still capable of specifically binding to miR-485.
  • a miRNA-485 inhibitor of the present disclosure comprises at least
  • nucleotide at least 2 nucleotides, at least 3 nucleotides, at least 4 nucleotides, at least 5 nucleotides, at least 6 nucleotides, at least 7 nucleotides, at least 8 nucleotides, at least 9 nucleotides, at least 10 nucleotides, at least 11 nucleotides, at least 12 nucleotides, at least 13 nucleotides, at least 14 nucleotides, at least 15 nucleotides, at least 16 nucleotides, at least 17 nucleotides, at least 18 nucleotides, at least 19 nucleotides, or at least 20 nucleotides at the 5' of the nucleotide sequence.
  • a miRNA-485 inhibitor comprises at least 1 nucleotide, at least 2 nucleotides, at least 3 nucleotides, at least 4 nucleotides, at least 5 nucleotides, at least 6 nucleotides, at least 7 nucleotides, at least 8 nucleotides, at least 9 nucleotides, at least 10 nucleotides, at least 11 nucleotides, at least 12 nucleotides, at least 13 nucleotides, at least 14 nucleotides, at least 15 nucleotides, at least 16 nucleotides, at least 17 nucleotides, at least 18 nucleotides, at least 19 nucleotides, or at least 20 nucleotides at the 3' of the nucleotide sequence.
  • a miR-485 inhibitor disclosed herein is about 6 to about 30 nucleotides in length. In certain aspects, a miR-485 inhibitor disclosed herein is 7 nucleotides in length. In further aspects, a miR-485 inhibitor disclosed herein is 8 nucleotides in length. In some aspects, a miR-485 inhibitor is 9 nucleotides in length. In some aspects, a miR-485 inhibitor of the present disclosure is 10 nucleotides in length. In certain aspects, a miR-485 inhibitor is 11 nucleotides in length. In further aspects, a miR-485 inhibitor is 12 nucleotides in length. In some aspects, a miR-485 inhibitor disclosed herein is 13 nucleotides in length.
  • a miR-485 inhibitor disclosed herein is 14 nucleotides in length. In some aspects, a miR-485 inhibitor disclosed herein is 15 nucleotides in length. In further aspects, a miR-485 inhibitor is 16 nucleotides in length. In certain aspects, a miR-485 inhibitor of the present disclosure is 17 nucleotides in length. In some aspects, a miR-485 inhibitor is 18 nucleotides in length. In some aspects, a miR-485 inhibitor is 19 nucleotides in length. In certain aspects, a miR-485 inhibitor is 20 nucleotides in length. In further aspects, a miR-485 inhibitor of the present disclosure is 21 nucleotides in length. In some aspects, a miR-485 inhibitor is 22 nucleotides in length.
  • a miR-485 inhibitor disclosed herein comprises a nucleotide sequence that is at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to a sequence selected from SEQ ID NOs: 2 to 30.
  • a miR-485 inhibitor comprises a nucleotide sequence selected from the group consisting of SEQ ID NOs: 2 to 30, wherein the nucleotide sequence can optionally comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mismatches.
  • a miRNA inhibitor comprises 5'-UGUAUGA-3' (SEQ ID NO: 2),
  • the miRNA inhibitor has 5'-UGUAUGAC-3' (SEQ ID NO: 16),
  • 5'-GUGUAUGAC-3' (SEQ ID NO: 17), 5'-CGUGUAUGAC-3' (SEQ ID NO: 18), 5'- CCGUGUAUGAC-3' (SEQ ID NO: 19), 5'-GCCGUGUAUGAC-3' (SEQ ID NO: 20), 5'- AGCCGUGUAUGAC-3' (SEQ ID NO: 21), 5'-GAGCCGUGUAUGAC-3' (SEQ ID NO: 22), 5'-AGAGCCGUGUAUGAC-3' (SEQ ID NO: 23), 5'-GAGAGCCGUGUAUGAC-3' (SEQ ID NO: 24), 5'-GGAGAGCCGUGUAUGAC-3' (SEQ ID NO: 25), 5'-
  • the miRNA inhibitor has a sequence selected from the group consisting of: 5'-TGTATGA-3' (SEQ ID NO: 62), 5'-GTGTATGA-3' (SEQ ID NO: 63), 5'- CGTGTATGA-3' (SEQ ID NO: 64), 5'-CCGTGTATGA-3' (SEQ ID NO: 65), 5'- GCCGTGTATGA-3' (SEQ ID NO: 66), 5'-AGCCGTGTATGA-3' (SEQ ID NO: 67), 5'- GAGCCGTGTATGA-3' (SEQ ID NO: 68), 5'-AGAGCCGTGTATGA-3' (SEQ ID NO: 69), 5'-GAGAGCCGTGTATGA-3' (SEQ ID NO: 70), 5'-GGAGAGCCGTGTATGA-3' (SEQ ID NO: 71), 5'-AGGAGAGCCGTGTATGA-3' (SEQ ID NO: 71), 5'-AGGAGAGCCGTGTATGA-3' (SEQ ID
  • GAGGAGAGCCGTGTATGA-3 ' (SEQ ID NO: 73), 5 ' - AG AGG AG AGC C GT GT AT G A- 3 ' (SEQ ID NO: 74), 5 ' -GAGAGGAGAGCC GT GT AT GA-3 ' (SEQ ID NO: 75); 5'- TGTATGAC-3' (SEQ ID NO: 76), 5'-GTGTATGAC-3' (SEQ ID NO: 77), 5'- CGTGTATGAC-3' (SEQ ID NO: 78), 5'-CCGTGTATGAC-3' (SEQ ID NO: 79), 5'- GCCGTGTATGAC-3' (SEQ ID NO: 80), 5'-AGCCGTGTATGAC-3' (SEQ ID NO: 81), 5'- GAGCCGTGTATGAC-3' (SEQ ID NO: 82), 5'-AGAGCCGTGTATGAC-3' (SEQ ID NO: 83), 5'-GAGAGCCGTGTATGAC-3' (S
  • a miRNA inhibitor disclosed herein comprises a nucleotide sequence that is at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or at least about 95% identical to 5 -
  • the miRNA inhibitor comprises a nucleotide sequence that has at least 90% similarity to 5'- AGAGAGGAGAGCCGUGUAUGAC -3' (SEQ ID NO: 30) or 5'-
  • the miRNA inhibitor comprises the nucleotide sequence 5'- AGAGAGGAGAGCCGUGUAUGAC -3' (SEQ ID NO: 30) or 5'- AG AG AGG AG AGC C GT GT AT GAC -3' (SEQ ID NO: 90) with one substitution or two substitutions.
  • the miRNA inhibitor comprises the nucleotide sequence 5'- AGAGAGGAGAGCCGUGUAUGAC -3' (SEQ ID NO: 30) or 5'- AG AG AGC C GT GT AT GAC -3' (SEQ ID NO: 90).
  • the miRNA inhibitor comprises the nucleotide sequence 5'- AGAGAGGAGAGCCGUGUAUGAC -3' (SEQ ID NO: 30).
  • a miR-485 inhibitor of the present disclosure comprises the sequence disclosed herein, e.g., any one of SEQ ID NOs: 2 to 30, and at least one, at least two, at least three, at least four or at least five additional nucleic acid at the N terminus, at least one, at least two, at least three, at least four, or at least five additional nucleic acid at the C terminus, or both.
  • a miR-485 inhibitor of the present disclosure comprises the sequence disclosed herein, e.g., any one of SEQ ID NOs: 2 to 30, and one additional nucleic acid at the N terminus and/or one additional nucleic acid at the C terminus.
  • a miR-485 inhibitor of the present disclosure comprises the sequence disclosed herein, e.g., any one of SEQ ID NOs: 2 to 30, and one or two additional nucleic acids at the N terminus and/or one or two additional nucleic acids at the C terminus.
  • a miR-485 inhibitor of the present disclosure comprises the sequence disclosed herein, e.g., any one of SEQ ID NOs: 2 to 30, and one to three additional nucleic acids at the N terminus and/or one to three additional nucleic acids at the C terminus.
  • a miR-485 inhibitor comprises 5'- GAGAGGAGAGCCGUGUAUGAC-3' (SEQ ID NO: 29).
  • a miR-485 inhibitor of the present disclosure comprises one miR-
  • a miR-485 inhibitor disclosed herein comprises at least two miR-485 binding sites. In certain aspects, a miR-485 inhibitor comprises three miR-485 binding sites. In some aspects, a miR-485 inhibitor comprises four miR-485 binding sites. In some aspects, a miR-485 inhibitor comprises five miR-485 binding sites. In certain aspects, a miR-485 inhibitor comprises six or more miR-485 binding sites. In some aspects, all the miR- 485 binding sites are identical. In some aspects, all the miR-485 binding sites are different. In some aspects, at least one of the miR-485 binding sites is different. In some aspects, all the miR-485 binding sites are miR-485-3p binding sites. In other aspects, all the miR-485 binding sites are miR-485-5p binding sites. In further aspects, a miR-485 inhibitor comprises at least one miR-485-3p binding site and at least one miR-485-5p binding site.
  • a miR-485 inhibitor disclosed herein comprises a polynucleotide which includes at least one chemically modified nucleoside and/or nucleotide.
  • modified polynucleotides refers to a compound containing a sugar molecule (e.g ., a pentose or ribose) or a derivative thereof in combination with an organic base (e.g., a purine or pyrimidine) or a derivative thereof (also referred to herein as "nucleobase").
  • nucleotide refers to a nucleoside including a phosphate group.
  • Modified nucleotides can be synthesized by any useful method, such as, for example, chemically, enzymatically, or recombinantly, to include one or more modified or non-natural nucleosides.
  • Polynucleotides can comprise a region or regions of linked nucleosides. Such regions can have variable backbone linkages.
  • the linkages can be standard phosphodiester linkages, in which case the polynucleotides would comprise regions of nucleotides.
  • modified polynucleotides disclosed herein can comprise various distinct modifications.
  • the modified polynucleotides contain one, two, or more (optionally different) nucleoside or nucleotide modifications.
  • a modified polynucleotide can exhibit one or more desirable properties, e.g, improved thermal or chemical stability, reduced immunogenicity, reduced degradation, increased binding to the target microRNA, reduced non-specific binding to other microRNA or other molecules, as compared to an unmodified polynucleotide.
  • a polynucleotide of the present disclosure is chemically modified.
  • the terms "chemical modification” or, as appropriate, “chemically modified” refer to modification with respect to adenosine (A), guanosine (G), uridine (U), thymidine (T) or cytidine (C) ribo- or deoxyribonucleosides in one or more of their position, pattern, percent or population, including, but not limited to, its nucleobase, sugar, backbone, or any combination thereof.
  • a polynucleotide of the present disclosure can have a uniform chemical modification of all or any of the same nucleoside type or a population of modifications produced by downward titration of the same starting modification in all or any of the same nucleoside type, or a measured percent of a chemical modification of all any of the same nucleoside type but with random incorporation
  • the polynucleotide of the present disclosure e.g, a miR-485 inhibitor
  • Modified nucleotide base pairing encompasses not only the standard adenine- thymine, adenine-uracil, or guanine-cytosine base pairs, but also base pairs formed between nucleotides and/or modified nucleotides comprising non-standard or modified bases, wherein the arrangement of hydrogen bond donors and hydrogen bond acceptors permits hydrogen bonding between a non-standard base and a standard base or between two complementary nonstandard base structures.
  • non-standard base pairing is the base pairing between the modified nucleobase inosine and adenine, cytosine or uracil. Any combination of base/sugar or linker can be incorporated into polynucleotides of the present disclosure.
  • TD's of the present disclosure can be administered as RNAs, as DNAs, or as hybrid molecules comprising both RNA and DNA units.
  • the polynucleotide (e.g, a miR-485 inhibitor) includes a combination of at least two (e.g, 2, 3, 4, 5, 6, 7, 8, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 18, 20 or more) modified nucleobases.
  • the nucleobases, sugar, backbone linkages, or any combination thereof in a polynucleotide are modified by at least about 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100%.
  • the chemical modification is at nucleobases in a polynucleotide of the present disclosure (e.g ., a miR-485 inhibitor).
  • the at least one chemically modified nucleoside is a modified uridine (e.g., pseudouridine (y), 2-thiouridine (s2U), 1- methyl-pseudouridine (m1 ⁇ ), 1 -ethyl-pseudouridine (e1 ⁇ ), or 5-methoxy-uridine (mo5U)), a modified cytosine (e.g, 5-methyl-cytidine (m5C)) a modified adenosine (e.g, 1-methyl- adenosine (ml A), N6-methyl-adenosine (m6A), or 2-methyl-adenine (m2 A)), a modified guanosine (e.g, 7-methyl-guanosine (m7G) or 1-
  • uridine e.g.
  • the polynucleotide of the present disclosure e.g ., a miR-485 inhibitor
  • a polynucleotide is uniformly modified (e.g., fully modified, modified throughout the entire sequence) for a particular modification.
  • a polynucleotide can be uniformly modified with the same type of base modification, e.g, 5-methyl-cytidine (m5C), meaning that all cytosine residues in the polynucleotide sequence are replaced with 5-methyl-cytidine (m5C).
  • m5C 5-methyl-cytidine
  • a polynucleotide can be uniformly modified for any type of nucleoside residue present in the sequence by replacement with a modified nucleoside such as any of those set forth above.
  • the polynucleotide of the present disclosure includes a combination of at least two (e.g. , 2, 3, 4 or more) of modified nucleobases.
  • the polynucleotide of the present disclosure can include any useful linkage between the nucleosides.
  • linkages, including backbone modifications, that are useful in the composition of the present disclosure include, but are not limited to the following: 3'-alkylene phosphonates, 3'-amino phosphoramidate, alkene containing backbones, aminoalkylphosphoramidates, aminoalkylphosphotriesters, boranophosphates, -CH 2 -O-N(CH3)-CH 2 -, -CH 2 -N(CH3)-N(CH 3 )-CH 2 -, -CH 2 -NH-CH 2 -, chiral phosphonates, chiral phosphorothioates, formacetyl and thioformacetyl backbones, methylene (methylimino), methylene formacetyl and thioformacetyl backbones, methylenei
  • the presence of a backbone linkage disclosed above increase the stability and resistance to degradation of a polynucleotide of the present disclosure (i.e., miR- 485 inhibitor).
  • a backbone modification that can be included in a polynucleotide of the present disclosure comprises phosphorodiamidate morpholino oligomer (PMO) and/or phosphorothioate (PS) modification.
  • the modified nucleosides and nucleotides which can be incorporated into a polynucleotide of the present disclosure can be modified on the sugar of the nucleic acid.
  • the sugar modification increases the affinity of the binding of a miR-485 inhibitor to miR-485 nucleic acid sequence.
  • affinity-enhancing nucleotide analogues in the miR-485 inhibitor such as LNA or 2'-substituted sugars, can allow the length and/or the size of the miR-485 inhibitor to be reduced.
  • nucleotides in a polynucleotide of the present disclosure contain sugar modifications (e.g, LNA).
  • 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 nucleotide units in a polynucleotide of the present disclosure are sugar modified (e.g, LNA).
  • RNA includes the sugar group ribose, which is a 5-membered ring having an oxygen.
  • modified nucleotides include replacement of the oxygen in ribose (e.g, with S, Se, or alkylene, such as methylene or ethylene); addition of a double bond (e.g, to replace ribose with cyclopentenyl or cyclohexenyl); ring contraction of ribose (e.g, to form a 4-membered ring of cyclobutane or oxetane); ring expansion of ribose (e.g, to form a 6- or 7-membered ring having an additional carbon or heteroatom, such as for anhydrohexitol, altritol, mannitol, cyclohexanyl, cyclohexenyl, and morpholino that also has a phosphoramidate backbone); multi cyclic forms (e.g, multi cyclic forms (e
  • the sugar group can also contain one or more carbons that possess the opposite stereochemical configuration than that of the corresponding carbon in ribose.
  • a polynucleotide molecule can include nucleotides containing, e.g., arabinose, as the sugar.
  • the 2' hydroxyl group (OH) of ribose can be modified or replaced with a number of different substituents.
  • exemplary substitutions at the 2'-position include, but are not limited to, H, halo, optionally substituted C 1-6 alkyl; optionally substituted C 1-6 alkoxy; optionally substituted C 6-10 aryloxy; optionally substituted C 3-8 cycloalkyl; optionally substituted C 3-8 cycloalkoxy; optionally substituted C 6-10 aryloxy; optionally substituted C 6-10 aryl-C 1-6 alkoxy, optionally substituted C 1-12 (heterocyclyl)oxy; a sugar (e.g, ribose, pentose, or any described herein); a polyethyleneglycol (PEG), -O(CH 2 CH 2 O) n CH 2 CH 2 OR, where R is H or optionally substituted alkyl, and n is an integer from 0 to 20 (e.g, from 0 tol
  • nucleotide analogues present in a polynucleotide of the present disclosure comprise, e.g, 2'-O-alkyl-RNA units, 2'-OMe-RNA units, 2'-O-alkyl-SNA, 2'-amino-DNA units, 2'-fluoro-DNA units, LNA units, arabino nucleic acid (ANA) units, 2'-fluoro-ANA units, HNA units, INA (intercalating nucleic acid) units, 2'MOE units, or any combination thereof.
  • ANA arabino nucleic acid
  • INA intercalating nucleic acid
  • the LNA is, e.g, oxy-LNA (such as beta- D-oxy-LNA, or alpha-L-oxy-LNA), amino-LNA (such as beta-D-amino-LNA or alpha-L- amino-LNA), thio-LNA (such as beta-D-thioO-LNA or alpha-L-thio-LNA), ENA (such a beta- D-ENA or alpha-L-ENA), or any combination thereof.
  • oxy-LNA such as beta- D-oxy-LNA, or alpha-L-oxy-LNA
  • amino-LNA such as beta-D-amino-LNA or alpha-L- amino-LNA
  • thio-LNA such as beta-D-thioO-LNA or alpha-L-thio-LNA
  • ENA such a beta- D-ENA or alpha-L-ENA
  • nucleotide analogues that can be included in a polynucleotide of the present disclosure comprises a locked nucleic acid (LNA), an unlocked nucleic acid (UNA), an arabino nucleic acid (ABA), a bridged nucleic acid (BNA), and/or a peptide nucleic acid (PNA).
  • LNA locked nucleic acid
  • UNA unlocked nucleic acid
  • ABA arabino nucleic acid
  • BNA bridged nucleic acid
  • PNA peptide nucleic acid
  • a polynucleotide of the present disclosure can comprise both modified RNA nucleotide analogues (e.g, LNA) and DNA units.
  • a miR-485 inhibitor is a gapmer. See, e.g., U.S. Pat. Nos. 8,404,649; 8,580,756; 8,163,708; 9,034,837; all of which are herein incorporated by reference in their entireties.
  • a miR-485 inhibitor is a micromir. See U.S. Pat. Appl. Publ. No. US20180201928, which is herein incorporated by reference in its entirety.
  • a polynucleotide of the present disclosure can include modifications to prevent rapid degradation by endo- and exo-nucleases.
  • Modifications include, but are not limited to, for example, (a) end modifications, e.g., 5' end modifications (phosphorylation, dephosphorylation, conjugation, inverted linkages, etc.), 3' end modifications (conjugation, DNA nucleotides, inverted linkages, etc.), (b) base modifications, e.g., replacement with modified bases, stabilizing bases, destabilizing bases, or bases that base pair with an expanded repertoire of partners, or conjugated bases, (c) sugar modifications (e.g., at the 2' position or 4' position) or replacement of the sugar, as well as (d) intemucleoside linkage modifications, including modification or replacement of the phosphodiester linkages.
  • end modifications e.g., 5' end modifications (phosphorylation, dephosphorylation, conjugation, inverted linkages, etc.), 3' end modifications (conjug
  • the miR-485 inhibitors of the present disclosure can be administered, e.g., to a subject suffering from a disease or condition associated with abnormal (e.g, reduced) level of a SIRT1 protein and/or SIRT1 gene, using any relevant delivery system known in the art.
  • the delivery system is a vector.
  • the present disclosure provides a vector comprising a miR-485 inhibitor of the present disclosure.
  • the vector is viral vector.
  • the viral vector is an adenoviral vector or an adeno-associated viral vector.
  • the viral vector is an AAV that has a serotype of AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or any combination thereof.
  • the adenoviral vector is a third generation adenoviral vector.
  • ADEASYTM is by far the most popular method for creating adenoviral vector constructs. The system consists of two types of plasmids: shuttle (or transfer) vectors and adenoviral vectors.
  • the transgene of interest is cloned into the shuttle vector, verified, and linearized with the restriction enzyme Pmel.
  • This construct is then transformed into ADEASIER-1 cells, which are BJ5183 E. coli cells containing PADEASYTM.
  • P ADEASYTM is a ⁇ 33Kb adenoviral plasmid containing the adenoviral genes necessary for virus production.
  • the shuttle vector and the adenoviral plasmid have matching left and right homology arms which facilitate homologous recombination of the transgene into the adenoviral plasmid.
  • Recombinant adenoviral plasmids are then verified for size and proper restriction digest patterns to determine that the transgene has been inserted into the adenoviral plasmid, and that other patterns of recombination have not occurred. Once verified, the recombinant plasmid is linearized with Pad to create a linear dsDNA construct flanked by ITRs. 293 or 911 cells are transfected with the linearized construct, and virus can be harvested about 7-10 days later.
  • other methods for creating adenoviral vector constructs known in the art at the time the present application was filed can he used to practice the methods disclosed herein.
  • the viral vector is a retroviral vector, e.g., a lentiviral vector (e.g., a third or fourth generation lentiviral vector).
  • Lentiviral vectors are usually created in a transient transfection system in which a cell line is transfected with three separate plasmid expression systems. These include the transfer vector plasmid (portions of the HIV provirus), the packaging plasmid or construct, and a plasmid with the heterologous envelop gene ( env ) of a different virus.
  • the three plasmid components of the vector are put into a packaging cell which is then inserted into the HIV shell.
  • the virus portions of the vector contain insert sequences so that the virus cannot replicate inside the cell system.
  • AAV vector can comprise a known vector or can comprise a variant, fragment, or fusion thereof.
  • the AAV vector is selected from the group consisting of AAV type 1 (AAV1), AAV2, AAV3A, AVV3B, AAV4, AAV5, AAV6, AAV7, AAV8, AVV9, AVV10, AVV11, AVV12, AVV13, AAVrh.74, avian AAV, bovine AAV, canine AAV, equine AAV, goat AVV, primate AAV, non-primate AAV, bovine AAV, shrimp AVV, snake AVV, and any combination thereof.
  • the AAV vector is derived from an AAV vector selected from the group consisting of AAV1, AAV2, AAV3A, AVV3B, AAV4, AAV5, AAV6, AAV7, AAV8, AVV9, AVV10, AVV11, AVV 12, AVV13, AAVrh.74, avian AAV, bovine AAV, canine AAV, equine AAV, goat AVV, primate AAV, non-primate AAV, ovine AAV, shrimp AVV, snake AVV, and any combination thereof.
  • the AAV vector is a chimeric vector derived from at least two
  • AAV vectors selected from the group consisting of AAV1, AAV2, AAV3A, AVV3B, AAV4, AAV5, AAV6, AAV7, AAV8, AVV9, AVV10, AVV11, AVV 12, AVV13, AAVrh.74, avian AAV, bovine AAV, canine AAV, equine AAV, goat AVV, primate AAV, non-primate AAV, ovine AAV, shrimp AVV, snake AVV, and any combination thereof.
  • the AAV vector comprises regions of at least two different AAV vectors known in the art.
  • the AAV vector comprises an inverted terminal repeat from a first
  • AAV e.g., AAV1, AAV2, AAV3A, AVV3B, AAV4, AAV5, AAV6, AAV7, AAV8, AVV9, AVV10, AVV11, AVV 12, AVV13, AAVrh.74, avian AAV, bovine AAV, canine AAV, equine AAV, goat AVV, primate AAV, non-primate AAV, ovine AAV, shrimp AVV, snake AVV, or any derivative thereof) and a second inverted terminal repeat from a second AAV (e.g., AAV1, AAV2, AAV3A, AVV3B, AAV4, AAV5, AAV6, AAV7, AAV8, AVV9, AVV10, AVV11, AVV 12, AVV13, AAVrh.74, avian AAV, bovine AAV, canine AAV, equine AAV, goat AVV, primate AAV, non-primate
  • the AVV vector comprises a portion of an AAV vector selected from the group consisting of AAV1, AAV2, AAV3A, AVV3B, AAV4, AAV5, AAV6, AAV7, AAV8, AVV9, AVV 10, AVV11, AVV 12, AVV13, AAVrh.74, avian AAV, bovine AAV, canine AAV, equine AAV, goat AVV, primate AAV, non-primate AAV, ovine AAV, shrimp AVV, snake AVV, and any combination thereof.
  • the AAV vector comprises AAV2.
  • the AVV vector comprises a splice acceptor site.
  • the AVV vector comprises a promoter. Any promoter known in the art can be used in the AAV vector of the present disclosure.
  • the promoter is an RNA Pol III promoter.
  • the RNA Pol III promoter is selected from the group consisting of the U6 promoter, the HI promoter, the 7SK promoter, the 5S promoter, the adenovirus 2 (Ad2) VAI promoter, and any combination thereof.
  • the promoter is a cytomegalovirus immediate-early gene (CMV) promoter, an EFla promoter, an SV40 promoter, a PGK1 promoter, a Ubc promoter, a human beta actin promoter, a CAG promoter, a TRE promoter, a UAS promoter, a Ac5 promoter, a polyhedrin promoter, a CaMKIIa promoter, a GALl promoter, a GAL 10 promoter, a TEF promoter, a GDS promoter, a ADH1 promoter, a CaMV35S promoter, or a Ubi promoter.
  • the promoter comprises the U6 promoter.
  • the AAV vector comprises a constitutively active promoter
  • the constitutive promoter is selected from the group consisting of hypoxanthine phosphoribosyl transferase (HPRT), adenosine deaminase, pyruvate kinase, beta-actin promoter, cytomegalovirus (CMV), simian virus ( e.g SV40), papilloma virus, adenovirus, human immunodeficiency virus (HIV), Rous sarcoma virus, a retrovirus long terminal repeat (LTR), Murine stem cell virus (MSCV) and the thymidine kinase promoter of herpes simplex virus.
  • HPRT hypoxanthine phosphoribosyl transferase
  • CMV cytomegalovirus
  • simian virus e.g SV40
  • papilloma virus e.g SV40
  • HSV40 human immunodeficiency virus
  • Rous sarcoma virus Rous sarcoma virus
  • the promoter is an inducible promoter.
  • the inducible promoter is a tissue specific promoter.
  • the tissue specific promoter drives transcription of the coding region of the AVV vector in a neuron, a glial cell, or in both a neuron and a glial cell.
  • the AVV vector comprises one or more enhancers.
  • the one or more enhancer are present in the AAV alone or together with a promoter disclosed herein.
  • the AAV vector comprises a 3'UTR poly(A) tail sequence.
  • the 3'UTR poly(A) tail sequence is selected from the group consisting of bGH poly(A), actin poly(A), hemoglobin poly(A), and any combination thereof.
  • the 3'UTR poly(A) tail sequence comprises bGH poly(A).
  • a miR-485 inhibitor disclosed herein is administered with a delivery agent.
  • delivery agents include a lipidoid, a liposome, a lipoplex, a lipid nanoparticle, a polymeric compound, a peptide, a protein, a cell, a nanoparticle mimic, a nanotube, a micelle, or a conjugate.
  • the present disclosure also provides a composition compri sing a miRNA inhibitor of the present disclosure (i.e. , miR-485 inhibitor) and a delivery agent.
  • the delivery agent comprises a cationic carrier unit comprising
  • CC is a positively charged carrier moiety
  • AM is an adjuvant moiety
  • L1 and L2 are independently optional linkers, and wherein when mixed with a nucleic acid at an ionic ratio of about 1 : 1, the cationic carrier unit forms a micelle.
  • composition comprising a miRNA inhibitor of the present disclosure (i.e., miR-485 inhibitor) interacts with the cationic carrier unit via an ionic bond.
  • the water-soluble polymer comprises poly(alkylene glycols), poly(oxyethylated polyol), poly(olefmic alcohol), poly(inylpyrrolidone), poly(hydroxyalkylmethacrylamide), poly(hydroxyalkylmethacrylate), poly(saccharides), poly( ⁇ -hydroxy acid), poly (vinyl alcohol), polyglycerol, polyphosphazene, polyoxazolines (“POZ”) poly(N-acryloylmorpholine), or any combinations thereof.
  • POZ polyoxazolines
  • the water- soluble polymer comprises polyethylene glycol ("PEG"), polyglycerol, or poly(propylene glycol) ("PPG").
  • the water-soluble polymer comprises: least about 113, at least about 114, at least about 115, at least about 116, at least about 117, at least about 118, at least about 119, at least about 120, at least about 121, at least about 122, at least about 123, at least about 124, at least about 125, at least about 126, at least about 127, at least about 128, at least about 129, at least about 130, at least about 131, at least about 132, at least about 133, at least about 134, at least about 135, at least about 136, at least about 137, at least about 138, at least about 139, at least about 140, or at least about 141.
  • the n is about 80 to about 90, about 90 to about 100, about 100 to about 110, about 110 to about 120, about
  • the water-soluble polymer is linear, branched, or dendritic.
  • the cationic carrier moiety comprises one or more basic amino acids.
  • the cationic carrier moiety comprises at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least 11, at least 12, at least 13, at least 14, at last 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 31, at least 32, at least 33, at least 34, at least 35, at least 36, at least 37, at least 38, at least 39, at least 40, at least 41, at least 42, at least 43, at least 44, at least 45, at least 46, at least 47, at least 48, at least 49, or at least 50 basic amino acids.
  • the cationic carrier moiety comprises about 30 to about 50 basic amino acids.
  • the basic amino acid comprises arginine, lysine, histidine, or any combination thereof.
  • the cationic carrier moiety comprises about 40 lysine monomers.
  • the adjuvant moiety is capable of modulating an immune response, an inflammatory response, and/or a tissue microenvironment.
  • the adjuvant moiety comprises an imidazole derivative, an amino acid, a vitamin, or any combination thereof.
  • the adjuvant moiety comprises: wherein each of G1 and G2 is H, an aromatic ring, or 1-10 alkyl, or G1 and G2 together form an aromatic ring, and wherein n is 1-10.
  • the adjuvant moiety comprises nitroimidazole. In some aspects, the adjuvant moiety comprises metronidazole, tinidazole, nimorazole, dimetridazole, pretomanid, omidazole, megazol, azanidazole, benznidazole, or any combination thereof. In some aspects, the adjuvant moiety comprises an amino acid.
  • the adjuvant moiety comprises
  • the adjuvant moiety comprises a vitamin.
  • the vitamin comprises a cyclic ring or cyclic hetero atom ring and a carboxyl group or hydroxyl group.
  • the vitamin comprises: wherein each of Y1 and Y2 is C, N, O, or S, and wherein n is 1 or 2.
  • the vitamin is selected from the group consisting of vitamin A, vitamin B1, vitamin B2, vitamin B3, vitamin B6, vitamin B7, vitamin B9, vitamin B 12, vitamin C, vitamin D2, vitamin D3, vitamin E, vitamin M, vitamin H, and any combination thereof.
  • the vitamin is vitamin B3.
  • the adjuvant moiety comprises at least about two, at least about three, at least about four, at least about five, at least about six, at least about seven, at least about eight, at least about nine, at least about ten, at least about 11, at least about 12, at least about 13, at least about 14, at least about 15, at least about 16, at least about 17, at least about 18, at least about 19, or at least about 20 vitamin B3. In some aspects, the adjuvant moiety comprises about 10 vitamin B3.
  • the composition comprises a water-soluble biopolymer moiety with about 120 to about 130 PEG units, a cationic carrier moiety comprising a poly-lysine with about 30 to about 40 lysines, and an adjuvant moiety with about 5 to about 10 vitamin B3.
  • the composition comprises (i) a water-soluble biopolymer moiety with about 100 to about 200 PEG units, (ii) about 30 to about 40 lysines with an amine group (e.g., about 32 lysines), (iii) about 15 to 20 lysines, each having a thiol group (e.g., about 16 lysines, each with a thiol group), and (iv) about 30 to 40 lysines fused to vitamin B3 (e.g., about 32 lysines, each fused to vitamin B3).
  • an amine group e.g., about 32 lysines
  • a thiol group e.g., about 16 lysines, each with a thiol group
  • vitamin B3 e.g., about 32 lysines, each fused to vitamin B3
  • the composition further comprises a targeting moiety, e.g., a LAT1 targeting ligand, e.g., phenyl alanine, linked to the water soluable polymer.
  • a targeting moiety e.g., a LAT1 targeting ligand, e.g., phenyl alanine
  • the thiol groups in the composition form disulfide bonds.
  • the composition comprises (1) a micelle comprising (i) about 100 to about 200 PEG units, (ii) about 30 to about 40 lysines with an amine group (e.g., about 32 lysines), (iii) about 15 to 20 lysines, each having a thiol group (e.g., about 16 lysines, each with a thiol group), and (iv) about 30 to 40 lysines fused to vitamin B3 (e.g., about 32 lysines, each fused to vitamin B3), and (2) a miR485 inhibitor (e.g., SEQ ID NO: 30), wherein the miR485 inhibitor is encapsulated within the micelle.
  • a micelle comprising (i) about 100 to about 200 PEG units, (ii) about 30 to about 40 lysines with an amine group (e.g., about 32 lysines), (iii) about 15 to 20 lysines, each having a thiol group (
  • the composition further comprises a targeting moiety, e.g., a LAT1 targeting ligand, e.g., phenyl alanine, linked to the PEG units.
  • a targeting moiety e.g., a LAT1 targeting ligand, e.g., phenyl alanine
  • the thiol groups in the micelle form disulfide bonds.
  • the present disclosure also provides a micelle comprising a miRNA inhibitor of the present disclosure (i.e., miR-485 inhibitor, e.g., SEQ ID NO: 30) wherein the miRNA inhibitor and the delivery agent are associated with each other.
  • a miRNA inhibitor of the present disclosure i.e., miR-485 inhibitor, e.g., SEQ ID NO: 30
  • the association is a covalent bond, a non-covalent bond, or an ionic bond.
  • the positive charge of the cationic carrier moiety of the cationic carrier unit is sufficient to form a micelle when mixed with the miR-485 inhibitor disclosed herein in a solution, wherein the overall ionic ratio of the positive charges of the cationic carrier moiety of the cationic carrier unit and the negative charges of the miR-485 inhibitor (or vector comprising the inhibitor) in the solution is about 1: 1.
  • the cationic carrier unit is capable of protecting the miRNA inhibitor of the present disclosure (i.e., miR-485 inhibitor) from enzymatic degradation. See PCT Publication No. WO2020/261227, published December 30, 2020, which is herein incorporated by reference in its entirety.
  • the present disclosure also provides pharmaceutical compositions comprising a miR-485 inhibitor disclosed herein (e.g., a polynucleotide or a vector comprising the miR-485 inhibitor) that are suitable for administration to a subject.
  • the pharmaceutical compositions generally comprise a miR-485 inhibitor described herein (e.g, a polynucleotide or a vector) and a pharmaceutically-acceptable excipient or carrier in a form suitable for administration to a subject.
  • Pharmaceutically acceptable excipients or carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition.
  • kits or products of manufacture comprising a miRNA inhibitor of the present disclosure (e.g., a polynucleotide, vector, or pharmaceutical composition disclosed herein) and optionally instructions for use, e.g., instructions for use according to the methods disclosed herein.
  • the kit or product of manufacture comprises a miR-485 inhibitor (e.g., vector, e.g, an AAV vector, a polynucleotide, or a pharmaceutical composition of the present disclosure) in one or more containers.
  • the kit or product of manufacture comprises miR-485 inhibitor (e.g, a vector, e.g, an AAV vector, a polynucleotide, or a pharmaceutical composition of the present disclosure) and a brochure.
  • miR-485 inhibitors disclosed herein e.g, vectors, polynucleotides, and pharmaceutical compositions of the present disclosure, or combinations thereof
  • MeO-PEG-PLL(TFA) 500 mg was dissolved in methanol (60 mL) and 1N NaOH
  • This synthesis step generated the water-soluble biopolymer (WP) and cationic carrier (CC) of a cationic carrier unit of the present disclosure (see FIG. 1).
  • Azido-poly(ethylene glycol)-b-poly(L-lysine) was synthesized by ring opening polymerization of Lys(TFA)-NCA with azido- PEG ( N 3 -PEG).
  • N 3 -PEG 300 mg, 0.06 mmol
  • Lys(TFA)-NCA (1287 mg, 4.8 mmol) were separately dissolved in DMF containing 1M thiourea and DMF(or NMP).
  • Lys(TFA)-NCA solution was dropped into the N 3 -PEG solution by micro syringe and the reaction mixture was stirred at 37 °C for 4 days.
  • the reaction bottles were purged with argon and vacuum.
  • N 3 -PEG-PLL 500 mg was dissolved in methanol (60 mL) and IN NaOH (6 mL) was dropped into the polymer solution with stirring. The mixture was maintained for 1 day with stirring at 37°C. The reaction mixture was dialyzed against 10 mM HEPES for 4 times and distilled water. White powder of N 3 -PEG-PLL was obtained after lyophilization.
  • tissue-specific adjuvant moieties (methoxy or) azido-poly(ethylene glycol)-b-poly(L- lysine/nicotinamide/mercaptopropanamide) (N 3 -PEG-PLL(Nic/SH)):
  • the tissue-specific adjuvant moieties (AM, see FIG. 1) were attached to the WP-CC component of a cationic carrier unit of the present disclosure.
  • the tissue-specific adjuvant moiety (AM) used in the cationic carrier unit was nicotinamide (vitamin B3). This step would yield the WP-CC- AM components of the cationic carrier unit depicted in FIG. 1.
  • N 3 -PEG-PLL(Nic/SH) was synthesized by chemical modification of N 3 -PEG-PLL and nicotinic acid in the presence of EDC/NHS.
  • N 3 -PEG-PLL (372 mg, 25.8 ⁇ mol) and nicotinic acid were separately dissolved in mixture of deionized water and methanol (1:1).
  • EDC.HC1 556.7 mg, 1.5 equiv. to H 2 of N 3 -PEG-PLL
  • NHS 334.2 mg, 1.5 equiv. to NH2 of PEG-PLL
  • the reaction mixture was added into the N 3 -PEG-PLL solution.
  • the reaction mixture was maintained at 37 °C for 16 hours with stirring.
  • 3,3’- dithiodiproponic acid (36.8 mg, 0.1 equiv.) was dissolved in methanol, EDC.HC1 (40.3 mg, 0.15 equiv.), and NHS (24.2 mg, 0.15 equiv.) were dissolved each in deionized water.
  • NHS and EDC.HC1 were added sequentially into 3,3’-dithiodiproponic acid solution.
  • the mixture solution was stirred for 4 hours at 37 °C after adding crude N 3 -PEG-PLL(Nic) solution.
  • the mixture was dialyzed sequentially methanol, 50 % methanol in deionized water, deionized water.
  • N 3 -PEG-PLL(Nic/SH) 130 mg, 6.5 ⁇ mol
  • alkyne modified phenyl alanine 5.7 mg, 4.0 equiv.
  • Nano sized PIC micelles were prepared by mixing MeO- or Phe-PEG-PLL(Nic) and miRNA.
  • PEG-PLL(Nic) was dissolved in HEPES buffer (10 mM) at 0.5 mg/mL concentration.
  • a miRNA solution (22.5 ⁇ M) in RNAse free water was mixed with the polymer solution at 2:1 (v/v) ratio of miRNA inhibitor (SEQ ID NOs: 2-30) (e.g ., AGAGAGGAGAGCCGUGUAUGAC; SEQ ID NO: 30) to polymer.
  • the mixing ratio of polymer to anti-miRNA was determined by optimizing micelle forming conditions, i.e., ratio between amine in polymer (carrier of the present disclosure) to phosphate in anti-miRNA (payload).
  • the mixture of polymer (carrier) and anti-miRNA (payload) was vigorously mixed for 90 seconds by multi -vortex at 3000 rpm, and kept at room temperature for 30 min to stabilize the micelles.
  • mice (10 ⁇ M of Anti-miRNA concentration) were stored at 4 °C prior to use.
  • MeO- or Phe- micelles were prepared using the same method, and different amounts of Phe- containing micelles (25% -75%) were also prepared by mixing both polymers during micelle preparation.
  • Example 2 Analysis of IL-I ⁇ and PGC-1 ⁇ expression in ALS [0302]
  • an established ALS animal model i.e., SODl-ALS mice
  • SODl-ALS mice female SOD1G93A mutant transgenic mice background B6/SJL were purchased from the Jackson Laboratory and bred with WT B6/SJL.
  • the genotype of SOD1G93A mutant mice was confirmed by PCR analysis of tail DNA following standard PCR conditions provided by The Jackson Laboratory. Mice of mixed genotypes were housed four to five per cage with a 12- hour light/12-hour dark cycle and food and water ad libitum. All animal procedures were performed according to the Konyang University guidelines for care and use of laboratory animals.
  • Control ALS mice received two administrations of PBS , an antisense oligonucleotide which had previously been tested to slow the progression of ALS, via ICV injection.
  • the onset of ALS was assessed. Mice were assessed for six times in about two weeks. Mice without any symptom were scored as 0.
  • Mice with trembling hind limbs was scored as 1.
  • Mice showing rigidly paralyzed hind limbs when the mice were suspended by tail were scored as 2.
  • Mice showing falling or difficulty in walking were scored as 3.
  • Mice that drag the hind limbs and could not stand were scored as 4.
  • Mice that could not correct the position when the mice were left lying on the back were scored 5. If the score of the assessment in mice was less than 4, the mice were considered as exhibiting disease onset.
  • mice treated with the miR-485 inhibitor disclosed herein had significantly later disease onset compared to the control animals that were treated with PBS.
  • the average disease onset in the control animals was about 90 days.
  • disease onset was delayed about nearly a month (/.£., about 120 days).
  • the animals treated with the miR-485 inhibitor also exhibited increased survival compared to the control animals (see FIG. 3C).
  • the miR-485 inhibitors can have therapeutic effects in ALS subjects by not only delaying disease onset but can also improve one or more symptoms associated with ALS (e.g ., muscle weakness). Moreover, the above data shows that compared to other drugs in the art, the miR-485 inhibitor disclosed herein exerts much greater therapeutic effects at significantly lower doses.
  • Example 2 received intravenous administration of either PBS or a miR-485 inhibitor (2.5 mg/kg per dose) starting at about two months (i.e., day 66) post-birth. See FIG. 9 A.
  • Each of the mice received four total doses at a dosing interval of lx/week (on days 66, 73, 80, and 87 post- birth). Then, at about 100-125 days post-birth, body weight and motor function was assessed using rotarod, hang wire, and balance beam tests as described further below.
  • the balance beam consisted of a transparent Plexiglas structure that was 50 cm high with a dark resting box at the end of the runway. Mice were trained on the beam for three times in the morning, allowing for a resting inter-trial period of a least 15 min. Mice were left in the dark resting box for at least 10 s before being placed back in their home cage. Mice were then re tested in the afternoon, at least 2 h after the training session. During test session, mice performance was recorded. The test consisted of three trials with a resting inter-trial period of at least 10 min. The number of total paw slips was calculated manually for the last of the three tests.
  • ALS mice treated with the miR-485 inhibitor had delayed disease onset (by approximately 21 days). Additionally, compared to the control animals, the ALS mice treated with the miR-485 inhibitor also exhibited reduced loss in body weight (see FIGs. 9G and 9H) and increased survival (see FIG. 91). And, as shown in FIGs. 9C-9F, ALS mice treated with the miR-485 inhibitor also exhibited improved motor function. For instance, after miR-485 inhibitor administration, the ALS mice exhibited increased latency to fall time (in both the rotarod and hang wire tests - see FIGs. 9C and 9D), decreased number of footslips (beam balance test - see FIG. 9E), and reduced beam cross time (beam balance test - see FIG. 9F).
  • Example 6 Analysis of the safety profile of miR-485 inhibitors [0316] To assess whether the in vivo administration of miR-485 inhibitors could result in any adverse effects, a single dose toxicity test was performed. Briefly, the miR-485 inhibitor was administered to male and female rats at one of the following doses: (i) 0 mg/kg (G1), (ii) 3.75 mg/kg (G2), (iii) 7.5 mg/kg (G3), and (iv) 15 mg/kg (G4). Then, any abnormalities in body weight, mortality, clinical signs, and pathology were observed in the animals at various time points post-transfer.
  • SOD1 also known as copper-zinc superoxide dismutate enzyme
  • SOD1 plays an important role in keeping cells (e.g., neurons) safe from oxidative stress. Mutations in SOD1 (e.g, G93A) have been implicated in ALS. Accordingly, to better understand the potential mechanisms by which the miR-485 inhibitors disclosed herein treat ALS, NSC-34 cells (hybrid cell line produced by fusion of motor neuron enriched, embryonic mouse spinal cord cells with mouse neuroblastoma) were transfected with GFP-tagged wild-type SOD1 (SOD1WT) and SOD1 comprising the G93A mutation (SOD1G93A) constructs.
  • SOD1WT GFP-tagged wild-type SOD1
  • SOD1G93A G93A mutation
  • the transfected cells were treated with varying concentrations (0, 50, 100, or 300 nM) of the miR-485 inhibitor.
  • Various SOD 1 -related activity (SOD1 aggregation, SIRT1 and PGC-1 ⁇ expression, and apoptosis) was assessed in the transfected cells using both Western blot and immunofluorescence.
  • Western blot at 48 hours post transfection, total cell extracts were prepared in 2% SDS in Tris buffer (pH 7.5). Then, insolubility in non-denaturing detergents of SOD1 species was assessed.
  • the cells were washed in PBS, fixed with methanol for 10 min at room temperature, and permeabilized with 0.1% Triton X-100 in PBS for 10 min at room temperature in a moisture chamber.
  • Antibodies and concentrations employed were: mouse GFP (Santacruz), 1:100; rabbit anti-LC3B (Cell Signaling Technology). Images were obtained using a confocal microscope (Leica 524 DMi8).
  • miR-485 inhibitor treatment in the transfected NSC-34 cells resulted in concentration dependent reduction in mutant SOD1 aggregation, as assessed by Western blot.
  • This effect of the miR-485 inhibitors to reduce mutant SOD1 aggregation was also confirmed by immunofluorescence (see FIG. 10B).
  • FIG. 10B shows that there was significantly reduced number of inclusions formed by SOD1G93A aggregation.
  • SOD1G93A was frequently co-localized with expression of LC3B (see white arrows in FIG.
  • the miR-485 inhibitor treatment also reduced SOD1G93A- induced apoptosis, as evidenced by the reduced expression of cleaved caspase-3 in NSC-34 cells transfected with SOD1G93A construct and treated with the miR-485 inhibitor.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biochemistry (AREA)
  • Neurology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Neurosurgery (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Plant Pathology (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Dispersion Chemistry (AREA)
  • Nanotechnology (AREA)
  • Optics & Photonics (AREA)
  • Inorganic Chemistry (AREA)
PCT/IB2021/050975 2020-02-07 2021-02-06 Use of mirna-485 inhibitors for treating amyotrophic lateral sclerosis (als) Ceased WO2021156832A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
AU2021215407A AU2021215407A1 (en) 2020-02-07 2021-02-06 Use of miRNA-485 inhibitors for treating amyotrophic lateral sclerosis (ALS)
MX2022009451A MX2022009451A (es) 2020-02-07 2021-02-06 S de micro ácido ribonucleico 485 (miarn 485) para tratamiento de esclerosis lateral amiotrófica (ela).
KR1020227030526A KR20220154105A (ko) 2020-02-07 2021-02-06 근위축성 측삭 경화증(als) 치료를 위한 mirna-485 억제제의 용도
EP21751058.5A EP4100068A4 (en) 2020-02-07 2021-02-06 USE OF MIRNA-485 INHIBITORS TO TREAT AMYOTROPHIC LATERAL SCLERosis (ALS)
CN202180026758.0A CN115461086A (zh) 2020-02-07 2021-02-06 miRNA-485抑制剂用于治疗肌萎缩性侧索硬化症(als)的用途
US17/760,342 US20230131083A1 (en) 2020-02-07 2021-02-06 Use of mirna-485 inhibitors for treating amyotrophic lateral sclerosis (als)
CA3166603A CA3166603A1 (en) 2020-02-07 2021-02-06 Use of mirna-485 inhibitors for treating amyotrophic lateral sclerosis (als)
JP2022547888A JP2023513189A (ja) 2020-02-07 2021-02-06 筋萎縮性側索硬化症(als)を治療するためのmirna-485阻害剤の使用

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US202062971771P 2020-02-07 2020-02-07
US62/971,771 2020-02-07
US202062989487P 2020-03-13 2020-03-13
US62/989,487 2020-03-13
US202063047147P 2020-07-01 2020-07-01
US63/047,147 2020-07-01

Publications (1)

Publication Number Publication Date
WO2021156832A1 true WO2021156832A1 (en) 2021-08-12

Family

ID=77200814

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2021/050975 Ceased WO2021156832A1 (en) 2020-02-07 2021-02-06 Use of mirna-485 inhibitors for treating amyotrophic lateral sclerosis (als)

Country Status (9)

Country Link
US (1) US20230131083A1 (cg-RX-API-DMAC7.html)
EP (1) EP4100068A4 (cg-RX-API-DMAC7.html)
JP (1) JP2023513189A (cg-RX-API-DMAC7.html)
KR (1) KR20220154105A (cg-RX-API-DMAC7.html)
CN (1) CN115461086A (cg-RX-API-DMAC7.html)
AU (1) AU2021215407A1 (cg-RX-API-DMAC7.html)
CA (1) CA3166603A1 (cg-RX-API-DMAC7.html)
MX (1) MX2022009451A (cg-RX-API-DMAC7.html)
WO (1) WO2021156832A1 (cg-RX-API-DMAC7.html)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4720313A1 (en) * 2023-05-26 2026-04-08 Shanghai Vitalgen Biopharma Co., Ltd. Recombinant aav vectors for treating proteinopathies in central nervous system

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017046267A1 (de) * 2015-09-17 2017-03-23 ToposNomos Ltd. Pharmazeutische wirkstoffe zur verwendung in der behandlung von amyotropher lateralsklerose (als) und diagnoseverfahren
WO2018139819A1 (ko) * 2017-01-26 2018-08-02 주식회사 바이오오케스트라 마이크로 rna를 이용한 뇌 질환 예방 또는 치료 용도
US20200392489A1 (en) * 2019-06-17 2020-12-17 Biorchestra Co., Ltd. Uses for prevention or treatment of brain diseases using microrna

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9951330B2 (en) * 2013-07-11 2018-04-24 The Trustees Of Columbia University In The City Of New York Micrornas that silence tau expression
WO2016030899A1 (en) * 2014-08-28 2016-03-03 Yeda Research And Development Co. Ltd. Methods of treating amyotrophic lateral scleroses
DK3378482T5 (da) * 2015-11-19 2024-09-30 Univ Nagoya City Public Univ Corp Formulering til administration af antitumorlægemiddel
WO2018139759A1 (ko) * 2017-01-26 2018-08-02 주식회사 바이오오케스트라 마이크로 rna를 이용한 알츠하이머병 진단방법
JPWO2019240223A1 (ja) * 2018-06-13 2021-07-01 公益財団法人川崎市産業振興財団 数平均分子量が3kDa〜10kDaであるPEGブロックとカチオン性ポリマーとのブロックコポリマーと、アンチセンスオリゴヌクレオチドとを含む、ポリイオンコンプレックスミセル

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017046267A1 (de) * 2015-09-17 2017-03-23 ToposNomos Ltd. Pharmazeutische wirkstoffe zur verwendung in der behandlung von amyotropher lateralsklerose (als) und diagnoseverfahren
WO2018139819A1 (ko) * 2017-01-26 2018-08-02 주식회사 바이오오케스트라 마이크로 rna를 이용한 뇌 질환 예방 또는 치료 용도
US20200392489A1 (en) * 2019-06-17 2020-12-17 Biorchestra Co., Ltd. Uses for prevention or treatment of brain diseases using microrna

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
GIZEM YALCIN: "Sirtuins and Neurodegeneration", JOURNAL OF NEUROLOGY & NEUROMEDICINE, vol. 3, no. 1, 23 February 2018 (2018-02-23), XP055832720 *
HUIYUN LIANG, WARD WALTER F, JANG YOUNGMOK C, BHATTACHARYA ARUNABH, BOKOV ALEX F, LI YAN, JERNIGAN AMANDA, RICHARDSON ARLAN, REMME: "PGC-1α protects neurons and alters disease progression in an amyotrophic lateral sclerosis mouse model", MUSCLE & NERVE, vol. 44, no. 6, 1 December 2011 (2011-12-01), pages 947 - 956, XP055681719, DOI: 10.1002/mus.22217 *
See also references of EP4100068A4 *
WEINBERG REBECCA B., MUFSON ELLIOTT J., COUNTS SCOTT E.: "Evidence for a neuroprotective microRNA pathway in amnestic mild cognitive impairment", FRONTIERS IN NEUROSCIENCE, vol. 9, 5 November 2015 (2015-11-05), pages 1 - 12, XP055832717, DOI: 10.3389/fnins.2015.00430 *

Also Published As

Publication number Publication date
US20230131083A1 (en) 2023-04-27
AU2021215407A1 (en) 2022-08-25
CN115461086A (zh) 2022-12-09
EP4100068A4 (en) 2024-03-20
EP4100068A1 (en) 2022-12-14
MX2022009451A (es) 2022-10-31
CA3166603A1 (en) 2021-08-12
KR20220154105A (ko) 2022-11-21
JP2023513189A (ja) 2023-03-30

Similar Documents

Publication Publication Date Title
US20230099372A1 (en) Use of mirna-485 inhibitors for treating tauopathy
US20230304014A1 (en) Mirna-485 inhibitor for huntington's disease
US20230126157A1 (en) Mirna-485 inhibitor for gene upregulation
US20230131083A1 (en) Use of mirna-485 inhibitors for treating amyotrophic lateral sclerosis (als)
WO2022264038A1 (en) Use of mirna-485 inhibitors for treating inflammasome-related diseases or disorders
US20240117350A1 (en) Use of mirna-485 inhibitor to regulate psd95, synaptophysin, and caspase-3 expression
US20240294908A1 (en) Use of mirna-485 inhibitors for treating diseases or disorders associated with abnormal nlrp3 expression
WO2024228118A1 (en) Mirna-485 inhibitors
US20230121720A1 (en) Diagnostic methods using pcg-1a expression
US20230119699A1 (en) Diagnostic methods using sirt1 expression
WO2024228119A1 (en) Mirna-485 inhibitors
WO2022003609A1 (en) Snp diagnostic methods
WO2023079499A1 (en) Use of mir-485 inhibitors to treat age-associated diseases or conditions
WO2024127317A1 (en) Treating mitochondrial dysfunction with mirna-485 inhibitor

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21751058

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3166603

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022547888

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021215407

Country of ref document: AU

Date of ref document: 20210206

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021751058

Country of ref document: EP

Effective date: 20220907

WWW Wipo information: withdrawn in national office

Ref document number: 2021751058

Country of ref document: EP