WO2021142212A1 - Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same - Google Patents

Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same Download PDF

Info

Publication number
WO2021142212A1
WO2021142212A1 PCT/US2021/012630 US2021012630W WO2021142212A1 WO 2021142212 A1 WO2021142212 A1 WO 2021142212A1 US 2021012630 W US2021012630 W US 2021012630W WO 2021142212 A1 WO2021142212 A1 WO 2021142212A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
vector
acid sequence
hbv
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/012630
Other languages
English (en)
French (fr)
Inventor
Hildegund CJ ERTL
Colin Stephen MAGOWAN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Wistar Institute of Anatomy and Biology
Virion Therapeutics LLC
Original Assignee
Wistar Institute of Anatomy and Biology
Virion Therapeutics LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202511456350.3A priority Critical patent/CN121221754A/zh
Priority to KR1020227027069A priority patent/KR20220163354A/ko
Priority to CA3166989A priority patent/CA3166989A1/en
Priority to IL294387A priority patent/IL294387A/en
Priority to BR112022013620A priority patent/BR112022013620A2/pt
Priority to CN202180019813.3A priority patent/CN115335076B/zh
Priority to AU2021205936A priority patent/AU2021205936A1/en
Priority to PH1/2022/551648A priority patent/PH12022551648A1/en
Priority to MX2022008572A priority patent/MX2022008572A/es
Priority to EP21703111.1A priority patent/EP4087605A1/en
Priority to JP2022542413A priority patent/JP7696909B2/ja
Priority to US17/790,259 priority patent/US12605444B2/en
Application filed by Wistar Institute of Anatomy and Biology, Virion Therapeutics LLC filed Critical Wistar Institute of Anatomy and Biology
Publication of WO2021142212A1 publication Critical patent/WO2021142212A1/en
Priority to US17/459,313 priority patent/US11291716B2/en
Priority to US17/679,356 priority patent/US11850282B2/en
Anticipated expiration legal-status Critical
Priority to US18/492,945 priority patent/US12290561B2/en
Priority to US19/170,785 priority patent/US20250228934A1/en
Priority to JP2025097871A priority patent/JP2025124904A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/29Hepatitis virus
    • A61K39/292Serum hepatitis virus, hepatitis B virus, e.g. Australia antigen
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10311Mastadenovirus, e.g. human or simian adenoviruses
    • C12N2710/10341Use of virus, viral particle or viral elements as a vector
    • C12N2710/10343Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16611Simplexvirus, e.g. human herpesvirus 1, 2
    • C12N2710/16622New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2730/00Reverse transcribing DNA viruses
    • C12N2730/00011Details
    • C12N2730/10011Hepadnaviridae
    • C12N2730/10111Orthohepadnavirus, e.g. hepatitis B virus
    • C12N2730/10122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2730/00Reverse transcribing DNA viruses
    • C12N2730/00011Details
    • C12N2730/10011Hepadnaviridae
    • C12N2730/10111Orthohepadnavirus, e.g. hepatitis B virus
    • C12N2730/10134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • HBV hepatitis B virus
  • HBV hepatitis B virus
  • HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof.
  • HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof is also disclosed.
  • Fusion proteins comprising: an N-terminal herpes simplex virus (HSV) glycoprotein (gD) sequence or a variant thereof; the disclosed HBV Core protein, HBV polymerase N-terminal domain, HBV polymerase C-terminal domain, or immunogenic fragments thereof; and a C-terminal HSV gD sequence or a variant thereof are also provided.
  • HSV herpes simplex virus
  • gD glycoprotein
  • fusion proteins comprising: an N-terminal herpes simplex virus (HSV) glycoprotein (gD) sequence or a variant thereof; combinations of the disclosed HBV Core protein, HBV polymerase N-terminal domain, HBV polymerase C-terminal domain, and/or immunogenic fragments thereof; and a C-terminal HSV gD sequence or a variant thereof.
  • HSV herpes simplex virus
  • gD glycoprotein
  • nucleic acid molecules encoding the disclosed proteins or fusion proteins, vectors comprising the nucleic acid molecules, and vaccines comprising the disclosed vectors are disclosed herein.
  • FIG. 1 illustrates the frequency of epitope-optimized Core amino acids. Amino acid residues are indicated on the X-axis; percent sequence similarity across all genomes analyzed is indicated on the Y-axis.
  • FIG. 2A, FIG. 2B, FIG. 2C, FIG. 2D, FIG. 2E, and FIG. 2F illustrate vaccine insert-specific T cell frequencies in C57B1/6 mice following intramuscular (i.m.) injection with the indicated doses of: replication-defective adenovirus vector of chimpanzee serotype 6 (AdC6) containing the epitope-optimized Core sequence genetically fused into gD (SEQ ID NO: 15) (AdC6-gDCore) (FIG. 2A and FIG.
  • FIG. 2D AdC6 containing the epitope-optimized polymerase C- terminal domain sequence genetically fused into gD (SEQ ID NO: 19) (AdC6-gDPolC) (FIG. 2B and FIG. 2E); and AdC6 containing the epitope-optimized polymerase N-terminal domain sequence genetically fused into gD (SEQ ID NO: 17) (AdC6-gDPolN) (FIG. 2C and FIG. 2F).
  • Mice were bled 14 days after the injection and T cell frequencies to the various HBV inserts were analyzed by intracellular cytokine staining (ICS) for interferon (IFN)-y upon stimulation of cells with overlapping peptides representing the HBV sequences. Control cells were cultured without peptides. Graphs show results for individual mice with medians indicated by the lines.
  • FIG. 2A-2C show insert-specific CD8+ T cell frequency
  • FIG. 2D-2F show insert-specific CD4+
  • FIG. 3A, FIG. 3B, and FIG. 3C illustrate T cell frequencies in different mouse strains (A: C57B1/6 mice; B: BALB/c mice; C: HLA-A2 transgenic (tg) mice) to pools of peptides representing the indicated HBV sequence.
  • Results were obtained with splenocytes harvested 4 weeks after immunization and tested by ICS for IFN-g. Peptides were arranged in matrices so that recognition of 2 pools identified one peptide. The graphs show responses to the different pools; responses to a pool containing all peptides are shown to the right. Background frequencies obtained without the peptides were subtracted.
  • CD8+ T cell and CD4+ T cell responses are shown for BALB/c mice; CD8+ T cell responses are shown for HLA-A2 tg mice, which carry a human MHC class I molecule but mouse MHC class II molecules.
  • T cells were gated on activated CD44+ cells.
  • Each consecutively numbered “peptide” consists of 15 amino acids beginning on the 1 st , 6 th , 11 th , etc. amino acid of the Core, PolN, or PolC sequence.
  • peptide 1 of Core corresponds to amino acids 1-15 of SEQ ID NO: 6 (i.e.
  • peptide 2 of Core corresponds to amino acids 6-20 of SEQ ID NO: 6
  • peptide 3 of Core corresponds to amino acids 11-25 of SEQ ID NO: 6, etc.
  • peptide 1 of PolN corresponds to amino acids 1-15 of SEQ ID NO: 8 (i.e. the epitope-optimized PolN amino acid sequence)
  • peptide 2 of PolN corresponds to amino acids 6-20 of SEQ ID NO: 8
  • peptide 3 of PolN corresponds to amino acids 11-25 of SEQ ID NO: 8, etc.
  • peptide 1 of PolC corresponds to amino acids 1-15 of SEQ ID NO: 10 (i.e. the epitope-optimized PolC amino acid sequence)
  • peptide 2 of PolC corresponds to amino acids 6-20 of SEQ ID NO: 10
  • peptide 3 of PolC corresponds to amino acids 11-25 of SEQ ID NO: 10, etc.
  • FIG. 4A, FIG. 4B and FIG. 4C show the IFN-g response upon boosting with AdC6-gDCore (A), AdC6-gDPolC (B), and AdC6-gDPolN (C) in C57B1/6 mice immunized with various doses of the indicated vectors.
  • the left graphs show responses tested from blood 2 weeks after priming with AdC6 vector. Mice were boosted 8 weeks later with the same doses of AdC7 vectors expressing the same inserts.
  • the right graphs show responses at 2 weeks after the boost in blood.
  • FIG. 5A, FIG. 5B, and FIG. 5C illustrate T cell frequencies in different mouse strains (A: C57B1/6 mice; B: BALB/c mice; C: HLA-A2 tg mice) to pools of peptides representing the indicated HBV sequence.
  • Mice were primed with AdC6 vectors expressing either of the 3 inserts (i.e., Core, PolC, or PolN) and were boosted 8 weeks later with AdC7 vectors expressing the same inserts. Results were obtained with splenocytes harvested 4 weeks after the immunization and tested by ICS for IFN-g. Peptides were arranged in matrices so that recognition of 2 pools identified one peptide.
  • the graphs show responses to the different pools; responses to a pool containing all peptides are shown to the right. Background frequencies obtained without the peptides were subtracted. Pools that were deemed to elicit a response and peptides identified in response to different pools are listed at the bottom of each figure.
  • CD8+ T cell and CD4+ T cell responses are shown for BALB/c mice; CD8+ T cell responses are shown for HLA-A2 tg mice which carry a human MHC class I molecule but mouse MHC class II molecules. T cells were gated on activated CD44+ cells. Each consecutively numbered “peptide” consists of 15 amino acids beginning on the 1 st , 6 th , 11 th , etc.
  • peptide 1 of Core corresponds to amino acids 1-15 of SEQ ID NO: 6 (i.e. the epitope-optimized Core amino acid sequence)
  • peptide 2 of Core corresponds to amino acids 6-20 of SEQ ID NO: 6
  • peptide 3 of Core corresponds to amino acids 11-25 of SEQ ID NO: 6, etc.
  • peptide 1 of PolN corresponds to amino acids 1-15 of SEQ ID NO: 8 (i.e. the epitope-optimized PolN amino acid sequence)
  • peptide 2 of PolN corresponds to amino acids 6-20 of SEQ ID NO: 8
  • peptide 3 of PolN corresponds to amino acids 11-25 of SEQ ID NO: 8, etc.
  • peptide 1 of PolC corresponds to amino acids 1-15 of SEQ ID NO: 10 (i.e. the epitope-optimized PolC amino acid sequence)
  • peptide 2 of PolC corresponds to amino acids 6-20 of SEQ ID NO: 10
  • peptide 3 of PolC corresponds to amino acids 11-25 of SEQ ID NO: 10, etc.
  • FIG. 6 illustrates the effect of vaccination on HBV genome copy numbers in serum upon AAV-1.3HBV challenge.
  • a group of 3 mice were challenged with 1 x 10 10 , 1 x 10 11 or 1.5 x 10 11 virus genomes (vg) of an adeno-associated virus 8 (AAV8)-1.3HBV vector and 8 weeks later were vaccinated with AdC6-gDPolN.
  • Viral titers were tested 8 weeks after vaccination and compared to pre-vaccination titers. Viral changes from baseline for each treatment group are shown.
  • FIG. 7A, FIG. 7B, FIG. 7C, FIG. 7D, and FIG. 7E illustrate exemplary HBV epitope shifting experiments.
  • FIG. 7A - mice were immunized with the AdC6-gDPolN vaccine. Four weeks later splenocytes were tested by intracellular cytokine staining for IFN-g responses to peptide pools representing the PolN sequence. T cells after stimulation were stained for T cell markers.
  • FIG. 7A - mice were immunized with the AdC6-gDPolN vaccine. Four weeks later splenocytes were tested by intracellular cytokine staining for IFN-g responses to peptide pools representing the PolN sequence. T cells after stimulation were stained
  • FIG. 7C results obtained with the same assay using splenocytes from mice that had been challenged with 1.5 x 10 11 vg of AAV8-1.3- HBV. Mice were vaccinated 4 weeks later and T cell responses were tested from spleen 10 weeks later.
  • FIG. 7A, 7B, and 7C show the frequencies of IFN-g producing CD44+CD8+ T cells over all CD44+CD8+ T cells. Background responses obtained by splenocytes incubated without peptide pools were subtracted.
  • FIG. 7D - peptide pools.
  • FIG. 7E individual peptide sequences.
  • FIG. 7E discloses SEQ ID NOs: 55-68 and 189-233, respectively, in order of appearance.
  • FIG. 8A, FIG. 8B, and FIG. 8C show data from the same experiment described above in FIG. 7. Based on the responses to the peptide pools, it was determined which individual peptides (both pools and peptides shown in FIG. 7) were positive. The graphs show responses to all of the peptides. Each peptide was present in two pools and therefore two values for frequencies were obtained for each peptide; only the lower data points are shown in this figure.
  • FIG. 9A illustrates antigen immunogenicity
  • FIG. 9A illustrates antigen immunogenicity
  • FIG. 9B illustrates the duration of response
  • FIG. 9C illustrates the prime-boost response.
  • FIG. 10 illustrates the CD8+T cell peptide recognition of PolN epitopes in BALB/c, C57B1/6, and HLA-A2 transgenic mice after vaccination with a prime of AdC6- gDPolN and a boost of AdC7-gDPolN.
  • CD8+ T cell peptide recognition was calculated as the fraction of positive peptides recognized two weeks after either the prime or the boost by the total number of overlapping 8 peptides from PolN (59 peptides total).
  • FIG. 11A and FIG. 11B illustrate vaccine-induced HBV-specific CD8+ T cell response in the liver of C57B1/6 mice injected with the indicated vectors. * p-value between 0.01-0.05; *** p-value between 0.0001-0.001; via 1-way ANOVA.
  • FIG. 12A, FIG. 12B, FIG. 12C, FIG. 12D, FIG. 12E, and FIG. 12F illustrate hematoxylin & eosin staining of liver samples from C57B1/6 mice injected with the indicated vectors. 20x magnification. Arrows indicate areas of lymphocytic infiltrates.
  • FIG. 13A and FIG. 13B illustrate vaccine-induced markers of CD8+ T cell activation/exhaustion in the liver of C57B1/6 mice injected with the indicated vectors. ** p- value between 0.001-0.01; *** p-value between 0.0001-0.001; via 1-way ANOVA.
  • FIG. 14A and FIG. 14B illustrate HBV viral dynamics in C57B1/6 mice injected with an exemplary AdC6-gDPolN vector.
  • the median HBV DNA VL/ml at week 4 - 7.3 logio cps/mL are provided.
  • n 7; one mouse excluded for missing data.
  • FIG. 15A and FIG. 15B illustrate the impact of AAV-induced HBV on CD8+ T cell responses in C57B1/6 mice first injected with 10 10 or 10 11 vg of AAV-1.3HBV and then four weeks later boosted with 10 10 vp of an exemplary AdC6-gDPolN vector.
  • each slice represents an individual epitope with size showing the proportion of the total; only responses > 0.1% were included. Pullouts represent epitopes only recognized in AAV8-1.3HBV infected mice.
  • FIG. 16 illustrates the frequencies of IFN-y-producing CD8+ T cells for individual C57B1/6 mice that were injected i.v. with the 10 10 vg of the AAV8-1.3HBV vectors, vaccinated 4 weeks later with 5 x 10 9 vp of the AdC6-gDPolN vector, and boosted 2 months later with the same dose of the AdC7-gDPolN vaccine. Control mice only received the vaccine. Naive mice served as additional controls.
  • FIG. 17A and FIG. 17B illustrate: A) % of CD8 + T cells within the lymphatic infiltrates of livers of individual mice; and B) the frequencies of PolN-tetramer + CD8 + T cells within the same infiltrates.
  • C57B1/6 mice were injected i.v. with the 10 10 or 10 11 vg of the AAV8-1.3HBV vector, were vaccinated 4 weeks later with 5 x 10 9 vp of the AdC6-gDPolN vector, and were boosted 2 months later with the same dose of the AdC7-gDPolN vaccine. Control mice only received the vaccine. Naive mice served as additional controls.
  • FIG. 18A, FIG. 18B, FIG. 18C, FIG. 18D, FIG. 18E, and FIG. 18F illustrate the phenotypes of the infiltrating tetramer + CD8 + T cells in comparison to naive (i.e., tetramer CD44 CD8 + ) T cells analyzed with the mean fluorescent intensity (MFI) of the indicated markers. Lines with stars above indicate significant differences by multiple t-test. (*) p ⁇ 0.05-
  • FIG. 19A, FIG. 19B, FIG. 19C, FIG. 19D, FIG. 19E, and FIG. 19F illustrate the percentage of Tet + or naive CD8 + T cells positive for the indicated markers.
  • Lines with stars above indicate significant differences by multiple t-test. (*) p ⁇ 0.05-0.01, (**) p ⁇ 0.01-0.001,
  • FIG. 20A, FIG. 20B, FIG. 20C, FIG. 20D, FIG. 20E, and FIG. 20F illustrate the CD8 + T cell response to individual peptides spanning the PolN sequence.
  • FIG. 20A and FIG. 20D show CD8 + T cell responses of mice that received just the AdC6-gDPolN vaccine.
  • FIG. 20B and FIG. 20E show CD8 + T cell responses of mice that were injected with 10 10 vg of AAV8-1.3HBV 4 weeks prior to vaccination with AdC6-gDPolN.
  • FIG. 20F show CD8 + T cell responses of mice that were injected with 10 n vg of AAV8-1.3HBV 4 weeks prior to vaccination with AdC6-gDPolN.
  • FIG. 20A, 20B and 20C can be used to calculate the breadth of the immune response by individual epitopes using the peptide pools shown in FIG. 7D and the individual peptide sequences recognized using FIG. 7E.
  • FIG. 21A and FIG. 21B illustrate the PolN-specific CD8+ T cells in the spleen or liver of mice.
  • FIG. 21A left panel shows CD8 + T cell responses in spleen of AAV8-1.3HBV injected mice that did or did not receive the AdC6-gDPolN vaccine at 5 x 10 10 vp subsequently.
  • FIG. 21 A middle panel shows CD8 + T cell frequencies in livers of mice that were treated with different doses of AAV8-1.3HBV and then received vaccines in a prime boost regimen.
  • FIG. 21 A right panel shows the levels of Tox-1 expression in PolN-specific CD8 + T cells or naive CD8 + T cells from the same experiment.
  • FIG. 21B illustrates % IFN-y'CD8 1 T cells.
  • FIG. 22A and FIG. 22B illustrate A) CD8+ T cell frequencies in the blood of mice injected with the indicated AdC6 vectors; and B) frequencies of tetramer+CD8+ T cells.
  • FIG. 23 illustrates CD8+ T cell frequencies in the blood of mice injected with the indicated AdC7 vectors.
  • FIG. 24A, FIG. 24B, FIG. 24C, FIG. 24D, FIG. 24E, and FIG. 24F illustrate CD8 + (FIG. 24A-FIG. 24C) and CD4+ (FIG. 24D-FIG. 24F) T cell frequencies to the gDHBV2 and gDHBV3 inserts in blood of mice injected with the indicated AdC7 vectors (“after prime”) and then boosted with the corresponding AdC6 vectors (“after boost”). Graphs show frequencies of T cells producing IFN-g, frequencies of T cells producing TNF-oc, and the sum of frequencies of T cells producing either cytokine.
  • FIG. 25A and FIG. 25B illustrate the HBV DNA viral titer in C57B1/6 mice that were challenged with lxlO 9 vg of AAV8-1.3HBV and were vaccinated 4 weeks later with lxlO 10 vp of AdC6-gDPolN (“gDPolN”), AdC6-gDHBV2 (“gDHBV2”), AdC6-gDHBV3 (“gDHBV3”), or AdC6-HBV2 without gD (“HBV2”); AAV-infected, non-vaccinated animals (“naive”), and non- AAV-infected, non-vaccinated animals (data not shown) served as controls.
  • FIG. 25A illustrates the viral titer for each group at weeks 4 and 8 after AAV challenge
  • FIG. 25B illustrates the results of the individual mice at weeks 4 and 8 after AAV challenge.
  • FIG. 26A, FIG. 26B, FIG. 26C, and FIG. 26D illustrate the percent of parental IFN-g and/or TNF-a producing CD8 + T cells (FIG. 26A), CD44+CD8+ T cells (FIG. 26B),
  • CD4+ T cells (FIG. 26C) or CD44+CD4+ T cells (FIG. 26D) two and eight weeks after prime and two and four weeks after the boost (as the mean) using the indicated construct.
  • the graph shows the overall frequencies of CD8 + T cells producing IFN-g 1 as assessed by ICS.
  • FIG. 28A, FIG. 28B, and FIG. 28C illustrate cytokine-producing CD4+ T cells at multiple time points: four weeks after prime (FIG. 28A); two weeks after the boost (FIG.
  • FIG. 30A, FIG. 30B, FIG. 30C, FIG. 30D, FIG. 30E, and FIG. 30F illustrates the phenotypes of the tetramer+ CD8+ T cells shown as the mean fluorescent intensity of a dye linked to the indicated antibody: FIG. 30A - anti-PDl antibody conjugated to BV605; FIG. 30B - anti-LAG3 antibody conjugated to BV650; FIG. 30C - anti-TIM3 antibody conjugated to Pe- Cy7-A; FIG. 30D - anti-CTLA4 antibody conjugated to PE-A; FIG. 30E - anti-EOMES antibody conjugated to AF488; and FIG. 30F - anti-T-bet antibody conjugated to BV786.
  • FIG. 31 illustrates the CD8 + T cell responses after a prime vaccination of 5xl0 10 vp AdC7-gDHBV2 followed two months later by vaccination with 5xl0 10 vp AdC6- gDHBV2. Numbers on the X axis correspond to the SEQ ID NO as provided herein.
  • FIG. 32 illustrates the CD8+ T cell responses after a prime vaccination with 5xl0 9 vp AdC7-gDHBV2 followed two months later by vaccination with 5xl0 9 vp AdC6- gDHBV2. Numbers on the X axis correspond to the SEQ ID NO as provided herein.
  • FIG. 33 shows the immunogenicity after a prime vaccination with 5x10 10 vp AdC7-gDHBV3 followed two months later by vaccination with 5xl0 10 vp AdC6-gDHBV3. Numbers on the X axis correspond to the SEQ ID NO as provided herein.
  • FIG. 34 illustrates the immunogenicity of the AdC6-gDHBV2 and AdC7- gDHBV2 vaccines corresponding to the SEQ ID NO (X axis) as provided herein. Core, PolC, and PolN regions in both HBV2 constructs were immunogenic.
  • FIG. 35 illustrates the immunogenicity of the AdC6-gDHBV3 and AdC7- gDHBV3 vaccines corresponding to the SEQ ID NO (X axis) as provided herein. Core, PolC, and PolN regions in both HBV3 constructs were immunogenic.
  • any description as to a possible mechanism or mode of action or reason for improvement is meant to be illustrative only, and the disclosed proteins, vaccines, and methods are not to be constrained by the correctness or incorrectness of any such suggested mechanism or mode of action or reason for improvement.
  • range includes the endpoints thereof and all the individual integers and fractions within the range, and also includes each of the narrower ranges therein formed by all the various possible combinations of those endpoints and internal integers and fractions to form subgroups of the larger group of values within the stated range to the same extent as if each of those narrower ranges was explicitly recited.
  • range of numerical values is stated herein as being greater than a stated value, the range is nevertheless finite and is bounded on its upper end by a value that is operable within the context of the invention as described herein.
  • immunogenic fragment thereof refers to a portion of the disclosed HBV Core (Core), HBV polymerase N-terminal domain (PolN), or HBV polymerase C-terminal domain (PolC) that can produce an immune response in a subject.
  • providing to the subject and similar terms indicate a procedure by which the fusion proteins, nucleic acid molecules, vectors, or vaccines are delivered to a subject such that target cells, tissues, or segments of the body of the subject are contacted with the fusion proteins, nucleic acid molecules, vectors, or vaccines. “Providing to the subject” includes parenteral and non-parenteral routes of administration.
  • biosimilar refers to a biological product that is highly similar to the reference product notwithstanding minor differences in clinically inactive components with no clinically meaningful differences between the biosimilar and the reference product in terms of safety, purity and potency, based upon data derived from (a) analytical studies that demonstrate that the biological product is highly similar to the reference product notwithstanding minor differences in clinically inactive components; (b) animal studies (including the assessment of toxicity); and/or (c) a clinical study or studies (including the assessment of immunogenicity and pharmacokinetics or pharmacodynamics) that are sufficient to demonstrate safety, purity, and potency in one or more appropriate conditions of use for which the reference product is licensed and intended to be used and for which licensure is sought for the biosimilar.
  • the biosimilar may be an interchangeable product that may be substituted for the reference product at the pharmacy without the intervention of the prescribing healthcare professional.
  • the biosimilar is to be expected to produce the same clinical result as the reference product in any given patient and, if the biosimilar is administered more than once to an individual, the risk in terms of safety or diminished efficacy of alternating or switching between the use of the biosimilar and the reference product is not greater than the risk of using the reference product without such alternation or switch.
  • the biosimilar utilizes the same mechanisms of action for the proposed conditions of use to the extent the mechanisms are known for the reference product.
  • the condition or conditions of use prescribed, recommended, or suggested in the labeling proposed for the biosimilar have been previously approved for the reference product.
  • the route of administration, the dosage form, and/or the strength of the biosimilar are the same as those of the reference product and the biosimilar is manufactured, processed, packed or held in a facility that meets standards designed to assure that the biosimilar continues to be safe, pure and potent.
  • the biosimilar may include minor modifications in the amino acid sequence when compared to the reference product, such as N- or C-terminal truncations that are not expected to change the biosimilar performance. Biosimilars of the disclosed proteins and fusion proteins are included within the scope of this disclosure.
  • subject as used herein is intended to mean any animal, in particular, mammals. Although induction of an immune response in mice is exemplified herein, any type of mammal can be treated using the disclosed methods. Thus, the methods are applicable to human and nonhuman animals, although preferably used with mice and humans, and most preferably with humans.
  • HBV hepatitis B virus
  • Ad adenovirus
  • HSV herpes simplex virus
  • GD glycoprotein
  • vg virus genomes
  • HBV Core protein can comprise the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof.
  • Exemplary immunogenic fragments of SEQ ID NO: 6 include SEQ ID NOs: 20-54 provided in Table 3, below.
  • the immunogenic fragment of the HBV Core protein comprises the amino acid sequence of SEQ ID NO: 180.
  • the immunogenic fragment of the HBV Core protein comprises the amino acid sequence of SEQ ID NO: 183.
  • Nucleic acid molecules encoding the HBV Core protein or an immunogenic fragment thereof are also provided.
  • the nucleic acid molecule can encode the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6.
  • the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 7.
  • the nucleic acid molecules can encode the Core fragments provided in Table 3.
  • the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 180.
  • the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 183.
  • Vectors comprising the nucleic acid molecules encoding the HBV Core protein or an immunogenic fragment thereof are also provided.
  • Suitable vectors include viral vectors, such as lentiviral vectors, retroviral vectors, adenoviral vectors, adeno-associated viral vectors, alphavirus replicons, herpes virus vectors, pox virus vectors, and rhabdovirus vectors.
  • the viral vector is an adenoviral vector.
  • the adenoviral vector can be a chimpanzee-derived adenoviral vector.
  • the vector is an AdC68 vector as described in Farina SF, Gao GP, Xiang ZQ, Rux JJ, Burnett RM, Alvira MR, Marsh J, Ertl HC, Wilson JM. “Replication-defective vector based on a chimpanzee adenovirus.” J Virol. 2001 Dec; 75(23):11603-13.
  • the vector is an AdC7 vector as described in Reyes- Sandoval A, Fitzgerald JC, Grant R, Roy S, Xiang ZQ, Li Y, Gao GP, Wilson JM, Ertl HC.
  • the vector is an AdC6 vector as described in Pinto AR, Fitzgerald JC, Giles-Davis W, Gao GP, Wilson JM, Ertl HC. “Induction of CD8+ T cells to an HIV-1 antigen through a prime boost regimen with heterologous El -deleted adenoviral vaccine carriers ” J Immunol. 2003 Dec 15; 171(12):6774-9.
  • the vector comprises the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7.
  • the vector is an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7.
  • the vector is an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7.
  • the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 180.
  • the vector is an AdC6 vector.
  • the vector is an AdC7 vector.
  • the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 183.
  • the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector.
  • Vaccines comprising the vectors comprising the nucleic acid molecules encoding the HBV Core protein or an immunogenic fragment thereof are also disclosed.
  • the vaccine comprises a vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7.
  • the vaccine comprises an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7.
  • the vaccine comprises an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 7.
  • the vaccine comprises an AdC6 vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 180.
  • the vaccine comprises an AdC7 vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 180. In some embodiments, the vaccine comprises an AdC6 vector that comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 183. In some embodiments, the vaccine comprises an AdC7 vector that comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 183.
  • the vaccine can further comprise a pharmaceutically acceptable carrier or pharmaceutical acceptable excipient.
  • Preferred diluents for aerosol or parenteral administration are phosphate buffered saline or normal (0.9%) saline.
  • Compositions comprising such carriers are formulated by well-known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro, ed., Mack Publishing Co., Easton, Pa., 1990; and Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing, 2000).
  • HBV polymerase N-terminal domain and the HBV polymerase C-terminal domain (PolC).
  • the disclosed HBV polymerase N-terminal domain can comprise the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof.
  • Exemplary immunogenic fragments of SEQ ID NO: 8 include SEQ ID NOs: 55-113 provided in Table 4, below.
  • the immunogenic fragment of the HBV PolN comprises the amino acid sequence of SEQ ID NO:
  • the immunogenic fragment of the HBV PolN comprises the amino acid sequence of SEQ ID NO: 181.
  • the disclosed HBV polymerase C-terminal domain can comprise the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof.
  • Exemplary immunogenic fragments of SEQ ID NO: 10 include SEQ ID NOs: 114-172 provided in Table 5, below.
  • the immunogenic fragment of the HBV PolC comprises the amino acid sequence of SEQ ID NO: 179.
  • the immunogenic fragment of the HBV PolC comprises the amino acid sequence of SEQ ID NO:
  • Nucleic acid molecules encoding the HBV polymerase N-terminal domain or an immunogenic fragment thereof, or the HBV polymerase C-terminal domain or an immunogenic fragment thereof, are also provided.
  • the nucleic acid molecule can encode the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8.
  • the nucleic acid molecule encoding the HBV polymerase N-terminal domain comprises the nucleotide sequence of SEQ ID NO: 9.
  • the nucleic acid molecules can encode the HBV polymerase N-terminal domain fragments provided in Table 4.
  • the nucleic acid molecule can encode the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10.
  • the nucleic acid molecule encoding the HBV polymerase C-terminal domain comprises the nucleotide sequence of SEQ ID NO: 11.
  • the nucleic acid molecules can encode the HBV polymerase C-terminal domain fragments provided in Table 5.
  • the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 178.
  • the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 181.
  • the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 179.
  • the nucleic acid molecule encodes the amino acid sequence of SEQ ID NO: 182.
  • Vectors comprising the nucleic acid molecules encoding the HBV polymerase N-terminal domain or an immunogenic fragment thereof or C-terminal domain or an immunogenic fragment thereof are also provided. Suitable vectors include those described above. In some embodiments, the vector comprises the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9. In some embodiments, the vector comprises the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11. In some aspects, the vector is an adenoviral vector. Suitable adenoviral vectors include, for example, an AdC6 vector or AdC7 vector.
  • the vector is an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9. In some embodiments, the vector is an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9. In some embodiments, the vector is an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11. In some embodiments, the vector is an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11. In some embodiments, the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 178.
  • the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 181. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 179. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vector comprises the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 182. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector.
  • Vaccines comprising the vectors comprising the nucleic acid molecules encoding the HBV polymerase N-terminal domain or an immunogenic fragment thereof or HBV polymerase C-terminal domain or an immunogenic fragment thereof are also disclosed.
  • the vaccine comprises a vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9.
  • the vaccine can comprise an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9.
  • the vaccine can comprise an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 9.
  • the vaccine comprises a vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11.
  • the vaccine can comprise an AdC6 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11.
  • the vaccine can comprise an AdC7 vector comprising the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 11.
  • the vaccine can further comprise a pharmaceutically acceptable carrier or pharmaceutical acceptable excipient as disclosed above.
  • the vaccine comprises a vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 178. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vaccine comprises a vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 181. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vaccine comprises a vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 179. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector. In some embodiments, the vaccine comprises a vector comprising the nucleic acid molecule that encodes the amino acid sequence of SEQ ID NO: 182. In some aspects, the vector is an AdC6 vector. In some aspects, the vector is an AdC7 vector.
  • Fusion proteins comprising combinations of the disclosed HBV Core protein or immunogenic fragments thereof, the HBV polymerase N-terminal domain or immunogenic fragments thereof, and/or the HBV polymerase C-terminal domain or immunogenic fragments thereof are also provided herein.
  • the fusion protein can comprise: (1) an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof;
  • one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 and one or more immunogenic fragments of the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8.
  • one or more of SEQ ID NOs: 20-54 provided in Table 3 immunogenic fragments of SEQ ID NO: 6
  • one or more of SEQ ID NOs: 55-113 provided in Table 4 immunogenic fragments of SEQ ID NO: 8
  • HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof;
  • one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 and one or more immunogenic fragments of the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10.
  • one or more of SEQ ID NOs: 20-54 provided in Table 3 immunogenic fragments of SEQ ID NO: 6
  • one or more of SEQ ID NOs: 114-172 provided in Table 5 (immunogenic fragments of SEQ ID NO: 10)
  • HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof
  • HBV polymerase C- terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof
  • one or more of SEQ ID NOs: 55-113 provided in Table 4 immunogenic fragments of SEQ ID NO: 8
  • one or more of SEQ ID NOs: 114-172 provided in Table 5 immunogenic fragments of SEQ ID NO: 10
  • an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof, an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof, and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof;
  • one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6, one or more immunogenic fragments of the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8, and one or more immunogenic fragments of the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10.
  • SEQ ID NOs: 20-54 provided in Table 3 (immunogenic fragments of SEQ ID NO: 6), one or more of SEQ ID NOs: 55-113 provided in Table 4 (immunogenic fragments of SEQ ID NO: 8), and one or more of SEQ ID NOs: 114-172 provided in Table 5 (immunogenic fragments of SEQ ID NO: 10);
  • An HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C- terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof; or
  • An HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof
  • an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof
  • an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof.
  • the fusion protein can comprise an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO:
  • the fusion protein comprises the amino acid sequence of SEQ ID NO: 174.
  • the fusion protein can comprise an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO:
  • the fusion protein comprises the amino acid sequence of SEQ ID NO: 175.
  • fusion proteins comprising a herpes simplex virus (HSV) glycoprotein (gD) sequence and the disclosed HBV Core protein, the HBV polymerase N-terminal domain, the HBV polymerase C-terminal domain, or various combinations thereof.
  • HBV herpes simplex virus
  • gD glycoprotein
  • the HSV gD is a receptor-binding glycoprotein of HSV.
  • the gD ectodomain is organized in two structurally and functionally differentiated regions: the amino-terminus, which includes the signal sequence and receptor-binding sites; and the carboxy -terminus, which includes the pro-fusion domain and the transmembrane domain.
  • gD interacts with the herpesvirus entry mediator (HVEM) receptor and the nectin receptors. Interaction of gD with the receptors results in the down-regulation of the HVEM receptors binding to BTLA or CD 160, which are immunoinhibitory molecules that are expressed on T cells.
  • HVEM herpesvirus entry mediator
  • the disclosed fusion proteins comprising gD and the disclosed HBV Core protein, the HBV polymerase N-terminal domain, the HBV polymerase C-terminal domain (referred to as “gDCore,” “gDPolN” or “gDPolC,” respectively), or combinations thereof are expected to enhance a subject’s immune response against HBV to a greater extent compared to the HBV Core and/or polymerase antigens alone (i.e. without gD).
  • Suitable HSV gD proteins for use in the disclosed fusion proteins include wild- type or mutant gD that retains the ability to: 1) augment stimulation of a CD8+ T cell response to an antigen; and/or 2) disrupt an HVEM-BTLA pathway activity.
  • the fusion proteins can comprise the HBV Core protein or an immunogenic fragment thereof, HBV polymerase N-terminal domain or an immunogenic fragment thereof, HBV polymerase C-terminal domain or an immunogenic fragment thereof disclosed herein, or any combination thereof, an N-terminal HSV gD protein sequence, and a C-terminal HSV gD protein sequence.
  • the HBV Core protein, HBV polymerase N-terminal domain, and HBV polymerase C-terminal domain can be those provided in Table 9 or the immunogenic fragments provided in Tables 3-5.
  • the HBV Core protein, HBV polymerase N-terminal domain, HBV polymerase C-terminal domain, or immunogenic fragments thereof can be inserted between the N-terminal HSV gD protein sequence and the C-terminal HSV gD protein sequence.
  • the N-terminal HSV gD protein sequence comprises the amino acid sequence of SEQ ID NO: 12 and the C-terminal HSV gD protein sequence comprises the amino acid sequence of SEQ ID NO: 13.
  • the N-terminal HSV gD protein sequence comprises amino acid residues 26-269 of SEQ ID NO: 12.
  • the fusion protein can comprise: an N-terminal HSV gD sequence or a variant thereof; an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof; and a C-terminal HSV gD sequence or a variant thereof.
  • the immunogenic fragment of the HBV Core protein can comprise any one of SEQ ID NOs: 20-54, 180, or 183.
  • the fusion protein can comprise: an N-terminal HSV gD sequence or a variant thereof; an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or SEQ ID NO: 183; and a C-terminal HSV gD sequence or a variant thereof.
  • the fusion protein can comprise: an N-terminal HSV gD sequence or a variant thereof; an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof; and a C-terminal HSV gD protein sequence or a variant thereof.
  • the immunogenic fragment of the HBV polymerase N-terminal domain can comprise any one of SEQ ID NOs: 55-113, 178, or 181.
  • the fusion protein can comprise: an N-terminal HSV gD sequence or a variant thereof; an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or SEQ ID NO: 181; and a C-terminal HSV gD protein sequence or a variant thereof.
  • the fusion protein can comprise: an N-terminal HSV gD sequence or a variant thereof; an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; and a C-terminal HSV gD protein sequence or a variant thereof.
  • the immunogenic fragment of the HBV polymerase C-terminal domain can comprise any one of SEQ ID NOs: 114-172, 179, or 182.
  • the fusion protein can comprise: an N-terminal HSV gD sequence or a variant thereof; an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or SEQ ID NO: 182; and a C-terminal HSV gD protein sequence or a variant thereof.
  • the fusion protein can comprise: an N-terminal HSV gD sequence or a variant thereof; an HBV sequence comprising:
  • HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof;
  • one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 and one or more immunogenic fragments of the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8.
  • one or more of SEQ ID NOs: 20-54 provided in Table 3 immunogenic fragments of SEQ ID NO: 6
  • one or more of SEQ ID NOs: 55-113 provided in Table 4 immunogenic fragments of SEQ ID NO: 8
  • HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof;
  • one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 and one or more immunogenic fragments of the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10.
  • one or more of SEQ ID NOs: 20-54 provided in Table 3 immunogenic fragments of SEQ ID NO: 6
  • one or more of SEQ ID NOs: 114-172 provided in Table 5 (immunogenic fragments of SEQ ID NO: 10)
  • HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof
  • HBV polymerase C- terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof
  • one or more of SEQ ID NOs: 55-113 provided in Table 4 immunogenic fragments of SEQ ID NO: 8
  • one or more of SEQ ID NOs: 114-172 provided in Table 5 immunogenic fragments of SEQ ID NO: 10
  • an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof, an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof, and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; or
  • one or more immunogenic fragments of the HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6, one or more immunogenic fragments of the HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8, and one or more immunogenic fragments of the HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10.
  • SEQ ID NOs: 20-54 provided in Table 3 (immunogenic fragments of SEQ ID NO: 6), one or more of SEQ ID NOs: 55-113 provided in Table 4 (immunogenic fragments of SEQ ID NO: 8), and one or more of SEQ ID NOs: 114-172 provided in Table 5 (immunogenic fragments of SEQ ID NO: 10);
  • an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof
  • an HBV polymerase C- terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof
  • an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof
  • an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof
  • an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof
  • an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof and a C-terminal HSV gD protein sequence or a variant thereof.
  • the N-terminal HSV gD sequence can comprise at least amino acids 1-269 of HSV gD.
  • the N-terminal HSV gD sequence for example, can comprise the amino acid sequence of SEQ ID NO: 12.
  • the N-terminal HSV gD sequence comprises amino acid residues 26-269 of SEQ ID NO: 12.
  • the C-terminal HSV gD sequence comprises the transmembrane domain of the HSV gD.
  • the C-terminal HSV gD sequence for example, can comprise the amino acid sequence of SEQ ID NO: 13.
  • the fusion protein can comprise the amino acid sequence of SEQ ID NO: 14 (corresponding to gDCore) or an immunogenic fragment thereof.
  • the fusion protein can comprise the amino acid sequence of SEQ ID NO: 16 (corresponding to gDPolN) or an immunogenic fragment thereof.
  • the fusion protein can comprise the amino acid sequence of SEQ ID NO: 18 (corresponding to gDPolC) or an immunogenic fragment thereof.
  • the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or the immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide.
  • the fusion protein can comprise the amino acid sequence of SEQ ID NO: 185 (gDHBV2).
  • the fusion protein can comprise the amino acid sequence of SEQ ID NO: 187 (gDHBV3).
  • nucleic acid molecules encoding any of the disclosed fusion proteins are also provided.
  • the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 15 (corresponding to gDCore).
  • nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 17 (corresponding to gDPolN).
  • nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 19 (corresponding to gDPolC).
  • the nucleic acid molecule can comprise the nucleotide sequence of SEQ ID NO: 184 (gDHBV2).
  • the nucleic acid molecule can comprise the nucleotide sequence of SEQ ID NO: 186 (gDHBV3).
  • Vectors comprising the nucleic acid molecules encoding the fusion proteins are also disclosed. Suitable vectors include those described above including, for example, an adenoviral vector.
  • the adenoviral vector is an AdC6 vector.
  • the adenoviral vector is an AdC7 vector.
  • the vector can comprise the nucleotide sequence of SEQ ID NO: 184 (gDHBV2).
  • the vector is an AdC6 vector that comprises the nucleotide sequence of SEQ ID NO: 184 (gDHBV2).
  • the vector is an AdC7 vector that comprises the nucleotide sequence of SEQ ID NO: 184 (gDHBV2).
  • the vector can comprise the nucleotide sequence of SEQ ID NO: 186 (gDHBV3).
  • the vector is an AdC6 vector that comprises the nucleotide sequence of SEQ ID NO: 186 (gDHBV3).
  • the vector is an AdC7 vector that comprises the nucleotide sequence of SEQ ID NO: 186 (gDHBV3).
  • Vaccines comprising any of the disclosed vectors are also provided.
  • the vaccine can further comprise a pharmaceutically acceptable carrier or pharmaceutical acceptable excipient as disclosed above.
  • the vaccine can comprise a vector comprising the nucleotide sequence of SEQ ID NO: 184 (gDHBV2).
  • the vaccine comprises an AdC6 vector that comprises the nucleotide sequence of SEQ ID NO: 184 (gDHBV2).
  • the vaccine comprises an AdC7 vector that comprises the nucleotide sequence of SEQ ID NO: 184 (gDHBV2).
  • the vaccine can comprise a vector that comprises the nucleotide sequence of SEQ ID NO: 186 (gDHBV3).
  • the vaccine comprises an AdC6 vector that comprises the nucleotide sequence of SEQ ID NO: 186 (gDHBV3). In some aspects, the vaccine comprises an AdC7 vector that comprises the nucleotide sequence of SEQ ID NO: 186 (gDHBV3).
  • kits for inducing an immune response to HBV in a subject comprising providing to the subject an effective amount of any of the disclosed fusion proteins, any of the disclosed nucleic acid molecules, any of the disclosed vectors, or any of the disclosed vaccines to thereby induce an immune response to HBV.
  • the methods comprise providing to the subject an effective amount of any of the disclosed fusion proteins to thereby induce an immune response to HBV.
  • the methods comprise providing to the subject an effective amount of any of the disclosed nucleic acid molecules to thereby induce an immune response to HBV.
  • the methods comprise providing to the subject an effective amount of any of the disclosed vectors to thereby induce an immune response to HBV.
  • the methods comprise providing to the subject an effective amount of any of the disclosed vaccines to thereby induce an immune response to HBV.
  • the methods can comprise providing to the subject an effective amount of a vaccine comprising an AdC6 vector, wherein the AdC6 vector comprises a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof.
  • the methods further comprise providing to the subject, subsequent to providing the vaccine comprising the AdC6 vector, a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof.
  • Such prime-boost methods can comprise: Providing to the subject a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 14, or an immunogenic fragment thereof, and subsequently providing to the subject a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 14, or an immunogenic fragment thereof.
  • the amino acid sequence of SEQ ID NO: 14, or an immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide;
  • the amino acid sequence of SEQ ID NO: 16, or an immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide; or
  • the amino acid sequence of SEQ ID NO: 18, or an immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide.
  • the methods can comprise providing to the subject an effective amount of a vaccine comprising an AdC7 vector, wherein the AdC7 vector comprises a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof.
  • the methods further comprise providing to the subject, subsequent to providing the vaccine comprising the AdC7 vector, a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof.
  • prime-boost methods can comprise:
  • the amino acid sequence of SEQ ID NO: 14, or an immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide;
  • the amino acid sequence of SEQ ID NO: 16, or an immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide; or
  • the amino acid sequence of SEQ ID NO: 18, or an immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide.
  • the methods can comprise providing to the subject an effective amount of a vaccine comprising an AdC6 vector, wherein the AdC6 vector comprises a fusion protein comprising the amino acid sequence of SEQ ID NO: 185 or 187, or an immunogenic fragment thereof.
  • the methods further comprise providing to the subject, subsequent to providing the vaccine comprising the AdC6 vector, a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185 or 187, or an immunogenic fragment thereof.
  • prime-boost methods can comprise:
  • the amino acid sequence of SEQ ID NO: 185, or an immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide; or
  • the amino acid sequence of SEQ ID NO: 187, or an immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide.
  • the methods can comprise providing to the subject an effective amount of a vaccine comprising an AdC7 vector, wherein the AdC7 vector comprises a fusion protein comprising the amino acid sequence of SEQ ID NO: 185 or 187, or an immunogenic fragment thereof.
  • the methods further comprise providing to the subject, subsequent to providing the vaccine comprising the AdC7 vector, a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185 or 187, or an immunogenic fragment thereof.
  • prime-boost methods can comprise:
  • the amino acid sequence of SEQ ID NO: 185, or an immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide; or
  • the amino acid sequence of SEQ ID NO: 187, or an immunogenic fragment thereof does not contain the N-terminal 25 amino acid signal peptide.
  • the immune response induced by the disclosed methods include, but is not limited to, T cell responses, B cell responses, or both (i.e. cellular and/or humoral immune responses).
  • the immune response can be a primary immune response or a secondary immune response.
  • the disclosed methods can induce a subject’s immune response against HBV to a greater extent compared to the HBV Core or polymerase antigens alone (i.e. without gD).
  • the disclosed methods can be used for both therapeutic treatment and prophylactic or preventative measures and can reduce the severity and/or frequency of symptoms, eliminate symptoms and/or the underlying cause of the symptoms, reduce the frequency or likelihood of symptoms and/or their underlying cause, and improve or remediate damage caused, directly or indirectly, by HBV.
  • Treatment also includes prolonging survival as compared to the expected survival of a subject not receiving treatment.
  • Subjects to be treated include those that have HBV as well as those prone to have HBV or those in which HBV is to be prevented.
  • the amount of the disclosed fusion proteins, nucleic acid molecules, vectors, or vaccines needed to thereby induce an immune response to HBV may vary according to factors such as the disease state, age, sex, and weight of the subject, and the ability of the fusion proteins, nucleic acid molecules, vectors, or vaccines to cause a desired response in the subject.
  • exemplary indicators of an effective amount include, for example, improved well-being of the subject and reduction, elimination, or prevention of HBV symptoms.
  • fusion proteins any of the disclosed fusion proteins, nucleic acid molecules, vectors, or vaccines in the manufacture of a medicament for inducing an immune response to HBV in a subject.
  • the disclosed fusion proteins, nucleic acid molecules, vectors, or vaccines for use in inducing an immune response to HBV in a subject is also provided.
  • Hepatitis B virus can be grouped into several genotypes, based on phylogenic clustering. To assist in the development of an antigen insert for a multi-genotype HBV vaccine for patients with chronic infections, a preliminary bioinformatics evaluation of the genes encoding the HBV Core and HBV polymerase across genotypes A, B, C and D was conducted.
  • HBVdb Hepatitis B Virus database
  • Consensus Core sequences were first identified for each genotype using the Shannon Entropy tool hosted by the Los Alamos National Laboratory (www.hiv.lanl.gov/content/sequence/ENTROPY/entropy), which calculated the variation and frequency at each amino acid position. These calculations were repeated for each genotype, generating four “consensus” Core sequences, one for each genotype analyzed (SEQ ID NOs: 1- 4):
  • Genotype C Consensus (SEQ ID NO: 3)
  • Genotype D Consensus (SEQ ID NO: 4)
  • An epitope-optimized polymerase sequence was generated from the four major HBV clades as discussed above for the Core sequence. Because the polymerase is long, two fragments - an N-terminal fragment (from which a highly variable segment between the genotypes was removed) and a C-terminal fragment - were generated. Both fragments are approximately 300 amino acids in length.
  • the epitope-optimized polymerase amino acid sequences are shown below and in Table 9:
  • the genes encoding the epitope-optimized Core or polymerase amino acid sequences were cloned into transfer vectors that contained the herpes simplex virus (HSV) glycoprotein D (gD) sequence under the control of the CMV promoter.
  • HSV herpes simplex virus
  • gD glycoprotein D
  • the genes were then cloned into the El -deleted, E3 ORF 3, 4, 5, 6, and 7-deleted replication deficient adenoviral vector (as described in PCT/US2017/043315) to generate the following vectors:
  • AdC6 containing the epitope-optimized Core sequence fused to gD (AdC6- gDCore);
  • AdC6 containing the epitope-optimized polymerase N-terminal sequence fused to gD (AdC6-gDPolN);
  • AdC6 containing the epitope-optimized polymerase C-terminal sequence fused to gD (AdC6-gDPolC);
  • AdC7 containing the epitope-optimized Core sequence fused to gD (AdC7- gDCore);
  • AdC7 containing the epitope-optimized polymerase N-terminal sequence fused to gD (AdC7-gDPolN);
  • AdC7 containing the epitope-optimized polymerase C-terminal sequence fused to gD (AdC7-gDPolC).
  • C57B1/6 mice showed a very robust CD8+ T cell response to the epitope- optimized polymerase N-terminal sequence and lower responses to the epitope-optimized polymerase C-terminal sequence and the epitope-optimized Core sequence, while CD4+ responses were better against the epitope-optimized Core sequence and the epitope-optimized polymerase C-terminal sequence (FIG. 2A - FIG. 2F).
  • Epitope mapping in C57B1/6 mice showed higher and broader responses to PolN than PolC (FIG. 3 A).
  • CD8+ T cells failed to respond to PolN or PolC. This pattern was largely mirrored in BALB/c mice, where CD8+ T cell responses were highest against PolN with recognition of 12 peptides followed by PolC with recognition of 4 peptides (FIG. 3B). Responses to Core were low but surprisingly broad with recognition of 10 peptides (FIG. 3B). BALB/c CD4+ T cells responded best to Core with recognition of 15 peptides with lower recognition of PolC (4 peptides) or PolN (2 peptides).
  • CD8+ T cell responses were also tested in HLA-A2 tg mice where PolN again triggered the highest response involving 12 peptides (FIG. 3C).
  • the response to PolC was lower but broader (16 peptides) while only one peptide of Core was detected (FIG. 3C).
  • the sequences of the peptides tested in the priming experiments are provided in Table 3 (Core peptides), Table 4 (PolN peptides), and Table 5 (PolC peptides).
  • the peptide composition of the peptide pools from the priming experiments are provided in Tables 6-8. Overall these data show that the inserts elicited detectable T cell responses that in most cases were directed against multiple epitopes within each sequence.
  • the vaccines are immunogenic: PolN > PolC > Core for CD8+ T cells; Core > PolC > PolN for CD4+ T cell responses;
  • a group of 3 mice were challenged with 1 x 10 10 , 1 x 10 11 or 1.5 x 10 11 vg of AAV-1.3HBV and were vaccinated with AdC6-gDPolN 8 weeks later. Viral titers were tested 8 weeks after vaccination and compared to pre-vaccination titers.
  • FIG. 6 shows viral changes from baseline for each treatment group.
  • CD8+ T cells to HBV antigens become exhausted during chronic HBV infections. Progression towards exhaustion is more rapid and pronounced for CD8+ T cells to dominant, as compared to subdominant, epitopes. The underlying reason is that exhaustion is driven by overwhelming antigen-driven stimulation through the T cell receptor; dominant epitopes are presented at higher levels on MHC class I antigens expressed by antigen presenting cells than subdominant epitopes with lower avidity to their restricting elements. Typical vaccine approaches primarily induce immune responses to dominant epitopes.
  • Therapeutic vaccines should take into account loss of T cells to dominant epitopes during chronic virus infections and should be designed to favor expansion of CD8+ T cells to subdominant epitopes, which have a higher likelihood of resisting disease-driven exhaustion, translating to superior disease control.
  • the epitope profile in naive mice immunized with an adenovirus vector comprising a nucleic acid sequence encoding the HBV polymerase N-terminal domain (PolN) fused to the herpes simplex virus glycoprotein D (“AdC6-gDPolN”, wherein the amino acid sequence of gDPolN is SEQ ID NO: 16) was determined.
  • AdC6-gDPolN herpes simplex virus glycoprotein D
  • Responses in mice that had not been pre-treated with the AAV8-1.3HBV vector were compared to those obtained in mice infected with an AAV8 vector expressing the 1.3HBV genome prior to vaccination with the AdC6- gDPolN.
  • the AAV8-1.3HBV vector induced high titers of HBV in serum, which could drive CD8+ T cell exhaustion.
  • a peptide pool matrix was used to identify epitopes in mice vaccinated with the AdC6-gDPolN vector, but not challenged with an AAV- 1.3HBV vector.
  • a number of regions in these naive mice were identified that elicited potent responses (e.g. greater than 1% IFN-g production CD8+CD44+ T cells.
  • FIG. 7A and FIG. 8A are examples of potent responses (e.g. greater than 1% IFN-g production CD8+CD44+ T cells.
  • mice were challenged with 1 x 10 10 virus genomes (vg) of the AAV- 1.3HBV vector, were vaccinated 4 weeks later with an AdC6 vector expressing the same HBV polymerase sequence (gDPolN) as in the initial experiment in non-challenged mice, and ten weeks thereafter the HBV PolN-specific CD8+ T cell epitope profile was determined using peptide pool matrices on splenocytes from the mice that had been challenged prior to vaccination.
  • FIG. 7B and FIG. 8B The experiment was repeated using more stringent conditions by challenging mice with a 1.5 x 10 11 vg dose of the AAV8-1.3HBV vector.
  • mice were again vaccinated 4 weeks later and were tested approximately 10 weeks after vaccination for CD8+ T cell responses to the peptide pool matrices.
  • FIG. 7C and FIG. 8C In both experiments, compared to the results obtained from unvaccinated mice, a shift was observed in the epitope profile in AAV8-1.3HBV infected mice, which at the time of vaccination had high viral loads between 10 7 -10 9 vg per ml of serum. The effect was more pronounced in mice that had been challenged with a high dose of the AAV8-1.3HBV vector. In both experiments a reduction in responses were observed.
  • mice challenged with the high dose of AAV8-1.3HBV showed a loss of CD8+ T cells to many of the epitopes that showed immunodominance in uninfected vaccinated mice (e.g. within region represented by peptides 50 to 59, FIG. 8), a better preservation of epitopes that were subdominant (such as those within the region represented by peptides 2 to 8) as well as new epitopes, such as in the region presented by peptides 10 to 29.
  • These data confirm a shift from recognition of dominant to recognition of subdominant epitopes.
  • HBV polymerase N-terminal domain insert (HBV PolN v2) was generated (SEQ ID NO: 173):
  • This insert induced CD8+ T cell responses mainly to subdominant epitopes to which responses remain intact in mice with high HBV viral loads.
  • AdC6 vector-immunized mice were boosted with AdC7 vectors containing the same insert (e.g. AdC7-gDCore, AdC7-gDPolN, or AdC7-gDPolC).
  • mice were bled at 14 days and 56 days after the injection and T cell frequencies to the various HBV inserts were analyzed by intracellular cytokine staining (ICS) for interferon (IFN)-y upon stimulation of cells with overlapping peptides representing the HBV sequences.
  • Control cells were cultured without peptides.
  • Frequencies and phenotype of CD8+ T cells to one immunodominant epitope within PolN were tested for by staining with an MHC I tetramer.
  • the breadth and specificity of CD8+ T cell responses to individual peptides within a target sequence was performed via epitope mapping of splenocytes (CD8+ T cells tested by ICS for IFN-g).
  • mice received intravenous administration of lxlO 10 viral genomes (vg) of AAV8-1.3HBV, lxlO 11 vg of AAV8- 1.3HBV, or nothing via their tail vein, and 4 weeks later received a single IM inj ection of 5x10 9 viral particles (vp) of AdC6-gDPolN. Eight weeks after the IM injection, mice were sacrificed, livers were removed, and lymphocytes were isolated and stained with T cell markers and a tetramer recognizing the T cell receptor to an immunodominant epitope present in the PolN sequence.
  • mice received a single IM injection of 5xl0 9 vp of AdC6-gDPolN at four weeks (-) or received either intravenous administration of lxlO 11 viral genomes (vg) of AAV8-1.3HBV via their tail vein with or without a single IM injection of 5xl0 9 vp of AdC6-gDPolN four weeks later.
  • lxlO 11 viral genomes vg
  • mice were sacrificed, livers were removed and liver slices were prepared from each of the three groups, stained with hematoxylin and eosin and evaluated for lymphocytic infiltrates.
  • cells were stained with a specific tetramer and fluorochrome labeled antibodies to T-bet (clone 4B10, BV785 stain) or antibodies to PD-1 (clone 29F.1A12, BF605 stain), TIM-3 (clone RMT3- 23, Pe/Cy7 stain), CTLA-4 (clone UC10-4B9, PE stain), or LAG-3 (clone C9B7W, BV650 stain).
  • T-bet clone 4B10, BV785 stain
  • PD-1 clone 29F.1A12, BF605 stain
  • TIM-3 clone RMT3- 23, Pe/Cy7 stain
  • CTLA-4 clone UC10-4B9, PE stain
  • LAG-3 clone C9B7W, BV650 stain
  • FIG. 9A and FIG. 9B show % CD8+ T cells over all CD8+ T cells for individual mice with medians indicated by the lines.
  • Vaccination induced broad epitope recognition by CD8+ T cells that was further enhanced after boosting (27% to 34%; FIG. 10).
  • AAV8-1.3HBV-infected vaccinated mice showed a preferential increase in hepatic CD8+ infiltrates (FIG. 11 A-l IB and FIG. 12A-12F), a decreased presence of vaccine-induced HBV-specific CD8+ T cells (FIG. 11A and FIG. 1 IB) and slightly reduced levels of T-bet (suggestive of loss of effector functions)
  • FIG. 11 A shows the % CD8+ T cells over all recovered lymphocytes from individual livers.
  • FIG. 11B shows percent tetramer positive CD8 + cells, which were identified from histograms in comparison to naive T cells. No clear pattern of cellular markers suggestive of T cell differentiation to an exhaustion phenotype was observed, however, between vaccinated AAV1.3HBV-infected and -uninfected mice (FIG. 13A-13B).
  • FIG. 15 A and FIG. 15B illustrate the results from experiments in which mice were first injected with AAV-1.3HBV and then four weeks later boosted with 10 10 vp of the AdC6-gDPolN vector, splenocytes were harvested 8 weeks after the immunization and tested by ICS for IFN-g upon a short in vitro stimulation with individual peptides spanning the sequence of PolN. Background frequencies obtained without peptide were subtracted.
  • FIG. 15 A and FIG. 15B illustrate the results from experiments in which mice were first injected with AAV-1.3HBV and then four weeks later boosted with 10 10 vp of the AdC6-gDPolN vector, splenocytes were harvested 8 weeks after the immunization and tested by ICS for IFN-g upon a short in vitro stimulation with individual peptides spanning the sequence of PolN. Background frequencies obtained without peptide were subtracted.
  • FIG. 15A shows the peptide recognition profile of mice that received the AdC6-gDPolN vaccine only followed by those that were first injected with the indicated doses of the AAV8-1.3HBV vector.
  • the pie graphs in FIG. 15B show the corresponding responses to peptides that reached the threshold of 0.1% of all CD44 + CD8 + cells (data correspond to those in FIG. 15 A).
  • Each slice/color represents the frequency of the response to an individual peptide with size showing the proportion of the total; only responses greater than 0.1% were included. Pullouts indicate epitopes only recognized in AAV8-1.3HBV infected mice.
  • AAV pre-treatment reduced both the number of epitopes recognized after a single IM prime and the magnitude of the immune response as the sum total of IFN-g producing CD8+ T cells over the pool of CD8 + T cells.
  • AAV pre-treatment shifted the T cell recognition to new epitopes, which represent roughly a third of the detectable CD8 + T cell response.
  • the percentage of functional HBV- specific CD8+ T cell responses were highest in naive mice (4.4%, FIG. 15B) but decreased in the presence of low and high dose AAV8-1.3HBV (2.0% & 0.6%; respectively, FIG. 15B).
  • AAV8- 1.3HBV-uninfected animals showed strong CD8+ T cell responses to a number of epitopes, which were decreased and shifted in AAV-HBV-infected animals to include T cell recognition of new epitopes.
  • HBV therapeutic vaccine that targets early CD8+ T cell activation using gD as a genetically encoded checkpoint inhibitor was generated and was shown to:
  • mice mounted a vigorous PolN-specific CD8 + T cell response 2 weeks after vaccination, which gradually declined by week 8 and then increased again after the boost.
  • the CD8 + T cell response was more stable after the boost than after the prime.
  • At most time points tested responses were lower in mice that had been injected with the AAV8-1.3HBV vector than in the controls that had not been injected with an AAV vector.
  • Methods - C57B1/6 mice were injected i.v. with the 10 10 or 10 11 vg of the AAV8-1.3HBV vectors. Four weeks later they were vaccinated with 5 x 10 9 vp of the AdC6- gDPolN vector. Control mice received only the AdC6-gDPolN vector. Naive mice served as additional controls. Mice were boosted 2 months later with the same dose of the AdC7-gDPolN vaccine.
  • livers were cut into small fragments and treated with 2 mg/ml Collagenase P, 1 mg/ml DNase I (all from Roche, Basel Switzerland) and 2% FBS (Tissue Culture Biologicals, Tulare, CA) in LI 5 under agitation for 1 hour. Liver fragments were homogenized, filtrated through 70 pm strainers and lymphocytes were purified by Percoll- gradient centrifugation and washed with DMEM supplemented with 10% FBS.
  • Collagenase P 1 mg/ml DNase I
  • FBS Tulare, CA
  • Lymphocytes were stained with a violet live/dead dye (Thermo Fisher Scientific), anti-CD8-APC (clone 53- 6.7, BioLegend), anti-CD44-Alexa Flour 700 (clone IM7, BioLegend), anti-EOMES-Alexa Fluor 488 (clone Danllmag, eBioscience), anti-PDl-BV605 (clone 29F.1A12, BioLegend), anti- LAG3-BV650 (clone C9B7W, BioLegend), anti-T-bet-BV786 (clone 4B10, BioLegend), anti- CTLA-4-PE-A (clone UC10-4B9, BioLegend), anti-TIM-3-Pe-Cy7-A (clone RMT3-23, BioLegend), and an APC-labeled MHC class I tetramer (NIH tetramer Facility, Emory University, Atlanta GA) corresponding to amino acids 39
  • the phenotypes of the infiltrating tetramer + CD8 + T cells in comparison to naive (i.e., tetramer CD44 CD8 + T cells) were assessed by determining the mean fluorescent intensity of a dye linked to a given antibody (FIG. 18A-FIG. 18F) and by assessing the percentages (FIG. 19A-FIG. 19F) of CD8 + T cells that were positive for the indicated markers.
  • T-bet which controls a number of CD8 + T cell functions, was reduced on hepatic CD8 + T cells from mice that had been injected with AAV8-1.3HBV prior to vaccination in comparison the vaccine only group. Exhaustion markers were not increased in AAV8- 1.3HBV-pre-treated groups suggesting that the observed loss of PolN-specific CD8 + T cells in presence of HBV was unlikely to be caused by classical CD8 + T cell exhaustion (FIG. 18A-FIG. 18F and FIG. 19A-FIG. 19F).
  • mice were injected i.v. with the 10 10 or 10 11 vg of the AAV8-1.3HBV vectors and were boosted 2 months later with the corresponding AdC7 vectors. Control mice received only the AdC6-gDPolN vector. Mice were euthanized 10 weeks later and the pooled splenocytes were tested against pools of peptides in the non- AAV infected animal study. Results are provided in FIG. 20A-FIG. 20C.
  • mice were injected i.v. with the 10 10 or 10 11 vg of the AAV8-1.3HBV vectors. Four weeks later they were vaccinated with 5 x 10 10 vp of the AdC6- gDPolN vector. Control mice received only the AdC6-gDPolN vector. Naive mice served as additional controls. Splenocytes were analyzed 6 weeks later for IFN-y-producing CD8 + T cells in response to individual peptides spanning the PolN sequence. Results are provided in FIG. 20D-FIG. 20F.
  • mice were injected with graded concentrations of AAV8-1.3HBV (lxlO 10 , 4xl0 10 , or lxlO 11 ). All mice were vaccinated 4 weeks later with 5 xlO 10 vp of the AdC6-gDPolN vector. The mice were boosted 2 months later with the same dose of the AdC7-gDPolN vector. Mice were euthanized 2 months later and lymphocytes were isolated from livers and tested for CD8 + T cells producing IFN-g in response to the PolN peptide pool. Cells were also stained with an antibody to Tox, a transcription factor that increases in exhausted T cells.
  • mice were injected with 10 10 vg of the AAV8-1.3HPV given i.v. One month later they were vaccinated with 5 x 10 9 vp of the AdC6-gDPolN vector. The mice were boosted 2 months later with the same dose of the AdC7-gDPolN vector given at the same dose. The mice were euthanized ⁇ 2 months later. Liver sections were collected and fixed in 10% formaldehyde. Sections ( ⁇ 3 pm in thickness) were prepared and stained with Hematoxylin Eosin (H&E). They were reviewed under a light microscope at 20x magnification. [0159] Results - One out of 33 sections from mice that had received both the AAV vector and the vaccine showed a small lymphocytic infiltrate that was at the margin of the liver section.
  • HBV2 2 nd generation HBV vaccine insert
  • HBV3 3 rd generation HBV vaccine insert
  • HBV3 Poly N (italics)-Pol C (underlined)-Core) (SEQ ID NO: 175) HFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLPEWQTPSFPKIHLQEDIVDRCKQF
  • the second generation HBV (“HBV2”) insert includes immuno-dominant PolN epitopes identified from mice that had not been infected with the AAV8-1.3HBV vector prior to vaccination. Many of these epitopes were found to be lost in a mouse model of chronic HBV infection brought about by pre-administering an AAV8-1.3HBV vector (as defined in “Epitope Shifting” above).
  • the third generation HBV (“HBV3”) insert selects for contiguous regions of PolN that were preferentially recognized by mice with high loads of HBV (see above). Regions of Core and PolC were selected for both constructs using the following general formula: regions with the highest immune responses on either prime (FIG. 3) or boost (FIG. 5) regions in C57B1/6, BALBc and HLA-A2 tg mice, and with the aim of selecting a large contiguous region instead of selecting unique epitopes and inserting spacer sequences between them.
  • HBV2 and HBV3 Genetic integrity and stability of the 2 nd and 3 rd generation HBV inserts (HBV2 and HBV3)
  • Western Blot - Purified recombinant viral vector preparations (AdC6-gDHBV2, AdC6-gDHBV3, AdC7-gDHBV2, and AdC7-gDHBV3) were evaluated for their ability to elicit transgene-product expression in vitro.
  • Western Blot assays were performed to assess the expression of gD protein in cell lysates following cell culture infection with the vector of interest.
  • Adherent HEK293 cell monolayers were infected with known quantities of the purified vector and harvested at 48 hours post-infection, resuspended in lysis and extraction buffer containing protease inhibitors, and lysed by sonication.
  • the total protein extracts were denatured by the use of dithiothreitol as a redox agent and submitted to electrophoresis in a 12% Bis-Tris polyacrylamide gel (PAGE). Subsequent to protein separation by SDS-PAGE, the samples were transferred onto an activated polyvinylidene difluoride membrane by wet electrophoretic transfer. The membrane was immunostained for the detection of gD protein using the primary antibody to gD diluted to 1:1000 in saline (clone PA1-30233, Invitrogen, Carlsbad, CA) for 1 h at room temperature.
  • Membranes were washed with IX TBS-T prior to incubating with HRP- conjugated goat anti-rabbit secondary IgG (ab6721, Abeam, Cambridge UK) for 1 h at room temperature. This was followed by the addition of a luminol-based chemiluminescent substrate. The stained membrane was exposed to an autoradiography film and signal emission was evaluated after processing by an automated film developer. Following documentation of the gD protein expression in infected HEK293 cell lysates, the membrane was stripped and re-probed for the presence of b-actin in the total protein extract samples. This staining step was employed to evaluate the consistency of the PAGE sample loading step and thus better support the semi- quantitative analysis of the in vitro stimulation of gD protein expression by the recombinant viral vector.
  • HBV2 and HBV3 Immunogenicity of the 2 nd and 3 rd generation HBV inserts (HBV2 and HBV3) as expressed by AdC6 or AdC7 vectors
  • mice Groups of C57B1/6 mice were injected with 5 x 10 9 or 5 x 10 10 vp of AdC7- gDHBV2 or 5 x 10 10 vp of AdC7-gDHBV3 vector. Naive mice served as negative controls. Mice were bled 14 days later and PBMCs were tested for frequencies of CD8 + T cells producing IFN-g in response to peptide pools corresponding to the HBV inserts.
  • mice were bled ⁇ 4 weeks later and PBMCs were retested by ICS for CD8 + T cells producing IFN-g and/or TNF-oc in response to the peptides for the inserts. Mice were boosted two months after the prime with the same dose of the heterologous vector expressing the same insert. PBMCs were tested by ICS 2 weeks later and pre- and post-boost CD8 + and CD4 + T cell responses were compared. The AdC7-gDHBV2 vector induced robust frequencies of CD8 +
  • T cells producing IFN-g and/or TNF-oc after the prime Frequencies increased after the AdC6- gDHBV2 boost and this was especially pronounced after the low vector doses and for CD8 + T cells producing IFN-g.
  • the AdC7-gDHBV3 vector was poorly immunogenic but CD8 + T cell responses became positive after the AdC6-gDHBV3 boost.
  • CD4+ T cell responses were marginal after the prime but increased after the boost. There was no marked difference in CD4 responses to the HBV2 or HBV3 insert.
  • AdC7-gDHBV2 and AdC7-gDHBV3 vectors displayed borderline immunogenicity consistent with their design as they lack the epitope that corresponds to the tetramer being used (FIG. 22A and FIG. 23).
  • AdC6- gDPolN and AdC6-gDHBV2 vaccinated animals had greater than 1 and 2 logio copies/mL declines, respectively; in contrast, none of the naive, AdC6-HBV2, or AdC6-gDHBV3 vaccinated animals had a 1 logio copies/mL or greater decline at Week 8.
  • AdC6-gDHBV2 (b) 5xl0 9 vp AdC7-gDHBV2 followed two months later by 5xl0 9 vp AdC6- gDHBV2; (c) 5xl0 10 vp AdC7-gDHBV3 followed two months later by 5xl0 10 vp AdC6- gDHBV3; or (d) no vaccine. Blood was assessed by ICS for IFN-g 1 CD8 + T cell responses 2 and
  • FIG. 26 shows the percent of parental IFN-g and/or TNF-a producing CD8 + T cells (FIG. 26A), CD44+CD8+ T cells (FIG. 26B), CD4+ T cells (FIG. 26C) or CD44+CD4+ T cells (FIG. 26D).
  • Immune responses as assessed by ICS from PBMCs of individual mice are shown two and eight weeks after the prime, as well as two and four weeks after the boost as the mean.
  • immunogenicity CP8 + T cell responses was from blood assessed by ICS for IFN-g 1 at two and six weeks after the prime, prior to the boost, and then two and six weeks after the boost. Immunogenicity was also assessed by tetramer staining using an APC-labeled MHC class I tetramer (NIH tetramer Facility, Emory University, Atlanta GA) corresponding to amino acids 396-404 FAVPNLQSL (peptide 55) of the HBV polymerase at week four after the prime. HBV3 does not contain the FAVPNLQSL peptide.
  • Results At all time points, each vaccine tested was found to induce IFN-g 1 CP8 + T cells. Results obtained with the gPHBV2 vaccine were similar to those obtained with the gPPolN vaccine; the gPHBV3 vaccine was less immunogenic. Upon tetramer staining, frequencies of the specific CD8 + T cells were comparable between the two vaccines; a number of activation markers tended to be more highly expressed on tetramer+ CD8+ T cells from the gDHBV2-immunized groups.
  • FIG. 27 shows CD8 + T cells at multiple time points: four weeks after prime (FIG. 27 A); two weeks after the boost (FIG. 27B); and four weeks after the boost (FIG. 27C). The graph shows the overall frequencies of CD8 + T cells producing IFN-g 1 as assessed by ICS.
  • FIG. 28 shows cytokine-producing CD4+ T cells at multiple time points: four weeks after prime (FIG. 28A); two weeks after the boost (FIG. 28B); and four weeks after the boost (FIG. 28C) as assessed by ICS.
  • the dashed line indicates the cut-off for positive responses, based on the results from the naive mice.
  • FIG. 29 shows the results of tetramer staining gated on either CD8+ T cells (FIG. 29A) or CD44+CD8+ T cells (FIG. 29B) at four weeks after the prime.
  • FIG. 30 shows the phenotypes of the tetramer+ CD8+ T cells shown as the mean fluorescent intensity of a dye linked to the indicated antibody: FIG. 30A anti-PDl antibody conjugated to BV605; FIG. 30B anti-LAG3 antibody conjugated to BV650; FIG. 30C anti-TIM3 antibody conjugated to Pe-Cy7-A; FIG. 30D anti-CTLA4 antibody conjugated to PE-A; FIG.
  • FIG. 30E anti-EOMES antibody conjugated to AF488; and FIG. 30F anti-T-bet antibody conjugated to BV786.
  • FIG. 31 shows the CD8 + T cell responses after a prime vaccination of 5xl0 10 vp AdC7-gDHBV2 followed two months later by vaccination with 5xl0 10 vp AdC6-gDHBV2. Numbers on the X axis correspond to the SEQ ID NO as provided herein.
  • FIG. 32 shows the CD8+ T cell responses after a prime vaccination with 5xl0 9 vp AdC7-gDHBV2 followed two months later by vaccination with 5xl0 9 vp AdC6-gDHBV2.
  • FIG. 33 shows the immunogenicity after a prime vaccination with 5xl0 10 vp AdC7-gDHBV3 followed two months later by vaccination with 5xl0 10 vp AdC6-gDHBV3. Numbers on the X axis correspond to the SEQ ID NO as provided herein.
  • FIG. 34 shows the immunogenicity of the AdC6-gDHBV2 and AdC7-gDHBV2 vaccines corresponding to the SEQ ID NO (X axis) as provided herein. Core, PolC, and PolN regions in both HBV2 constructs were immunogenic.
  • FIG. 35 shows the immunogenicity of the AdC6-gDHBV3 and AdC7-gDHBV3 vaccines corresponding to the SEQ ID NO (X axis) as provided herein. Core, PolC, and PolN regions in both HBV3 constructs were immunogenic.
  • mice will be bled at various times after the injection and frequencies of insert-specific CD8+ and CD4+ T cells will be determined by intracellular cytokine staining (ICS) for IFN-g.
  • ICS intracellular cytokine staining
  • PCR will be performed at 2 weeks, 6 weeks, and 8 weeks after the prime vaccination, and a T cell assay will be performed at 4 weeks after the prime vaccination.
  • mice will be boosted with AdC7 vectors containing the same antigenic insert used in the prime vaccination (“boost vaccination”) and blood and serum will be tested for CD8+/CD4+ T cell as previously described at different time points after vaccination.
  • PCR will be performed at 2 weeks, 6 weeks, and 10 weeks after the boost vaccination, and a T cell assay will be performed at 4 weeks and 12 weeks after the boost vaccination.
  • Embodiment 1 A hepatitis B virus (HBV) Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof.
  • HBV hepatitis B virus
  • Embodiment 2 The HBV Core protein of embodiment 1, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 20-54.
  • Embodiment 3 A hepatitis B virus (HBV) Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof.
  • HBV hepatitis B virus
  • Embodiment 4 A nucleic acid molecule encoding the HBV Core protein of any one of embodiments 1-3.
  • Embodiment 5 The nucleic acid molecule of embodiment 4, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 7.
  • Embodiment 6 A vector comprising the nucleic acid molecule of embodiment 4 or 5.
  • Embodiment 7 The vector of embodiment 6, wherein the vector is an adenoviral vector.
  • Embodiment 8 The vector of embodiment 7, wherein the adenoviral vector is an AdC6 vector or AdC7 vector.
  • Embodiment 9 A vaccine comprising the vector of any one of embodiments 6-8.
  • Embodiment 10 A HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof.
  • Embodiment 11 The HBV polymerase N-terminal domain of embodiment 10, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 55-113.
  • Embodiment 12 A HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof.
  • Embodiment 13 A HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof.
  • Embodiment 14 The HBV polymerase C-terminal domain of embodiment 13, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 114-172.
  • Embodiment 15 A HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof.
  • Embodiment 16 A nucleic acid molecule encoding the HBV polymerase of any one of embodiments 10-15.
  • Embodiment 17 The nucleic acid molecule of embodiment 16, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 9.
  • Embodiment 18 The nucleic acid molecule of embodiment 16, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 11.
  • Embodiment 19 A vector comprising the nucleic acid molecule of any one of embodiments 16-18.
  • Embodiment 20 The vector of embodiment 19, wherein the vector is an adenoviral vector.
  • Embodiment 21 The vector of embodiment 20, wherein the adenoviral vector is an AdC6 vector or AdC7 vector.
  • Embodiment 22 A vaccine comprising the vector of any one of embodiments 19-21.
  • Embodiment 23 A fusion protein comprising: one or more of an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof, an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof, and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof.
  • Embodiment 24 The fusion protein of embodiment 23, comprising:
  • HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof;
  • HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof;
  • an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof and an HBV polymerase C- terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; (6) one or more of SEQ ID NOs: 55-113 (immunogenic fragments of SEQ ID NO: 8) and one or more of SEQ ID NOs: 114-172 (immunogenic fragments of SEQ ID NO: 10);
  • an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof, an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof, and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; or
  • Embodiment 25 A fusion protein comprising: an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof.
  • Embodiment 26 The fusion protein of embodiment 25, comprising the amino acid sequence of SEQ ID NO: 174.
  • Embodiment 27 A fusion protein comprising: an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof, an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof.
  • Embodiment 28 The fusion protein of embodiment 27, comprising the amino acid sequence of SEQ ID NO: 175.
  • Embodiment 29. A fusion protein comprising: an N-terminal herpes simplex virus (HSV) glycoprotein (gD) sequence or a variant thereof; an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof; and a C-terminal HSV gD sequence or a variant thereof.
  • HSV herpes simplex virus
  • gD glycoprotein
  • HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof
  • C-terminal HSV gD sequence or a variant thereof a C-terminal HSV gD sequence or a variant thereof.
  • Embodiment 30 The fusion protein of embodiment 29, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 20-54.
  • Embodiment 31 A fusion protein comprising: an N-terminal HSV gD sequence or a variant thereof; an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof; and a C-terminal HSV gD protein sequence or a variant thereof.
  • Embodiment 32 The fusion protein of embodiment 31, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 55-113.
  • Embodiment 33 A fusion protein comprising: an N-terminal HSV gD sequence or a variant thereof; an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; and a C-terminal HSV gD protein sequence or a variant thereof.
  • Embodiment 34 The fusion protein of embodiment 33, wherein the immunogenic fragment comprises any one of SEQ ID NOs: 114-172.
  • Embodiment 35 A fusion protein comprising: an N-terminal HSV gD sequence or a variant thereof; an HBV sequence comprising:
  • HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof;
  • HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof;
  • HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof
  • HBV polymerase C- terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof
  • an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 6 or an immunogenic fragment thereof, an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 8 or an immunogenic fragment thereof, and an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 10 or an immunogenic fragment thereof; or
  • Embodiment 36 A fusion protein comprising: an N-terminal HSV gD sequence or a variant thereof; an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof; and a C-terminal HSV gD sequence or a variant thereof.
  • Embodiment 37 A fusion protein comprising: an N-terminal HSV gD sequence or a variant thereof; an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof; and a C-terminal HSV gD protein sequence or a variant thereof.
  • Embodiment 38 A fusion protein comprising: an N-terminal HSV gD sequence or a variant thereof; an HBV polymerase C-terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, or the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof; and a C-terminal HSV gD protein sequence or a variant thereof.
  • Embodiment 39 A fusion protein comprising: an N-terminal HSV gD sequence or a variant thereof; an HBV sequence comprising:
  • an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof
  • an HBV polymerase C- terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof
  • an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof
  • an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof, an HBV polymerase C- terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof; and a C-terminal HSV gD protein sequence or a variant thereof.
  • Embodiment 40 Embodiment 40.
  • the fusion protein of embodiment 39 wherein the HBV sequence comprises an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 178 or an immunogenic fragment thereof, an HBV polymerase C- terminal domain comprising the amino acid sequence of SEQ ID NO: 179 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 180 or an immunogenic fragment thereof.
  • Embodiment 41 The fusion protein of embodiment 40, wherein the HBV sequence comprises the amino acid sequence of SEQ ID NO: 174.
  • Embodiment 42 The fusion protein of embodiment 39, wherein the HBV sequence comprises an HBV polymerase N-terminal domain comprising the amino acid sequence of SEQ ID NO: 181 or an immunogenic fragment thereof, an HBV polymerase C- terminal domain comprising the amino acid sequence of SEQ ID NO: 182 or an immunogenic fragment thereof, and an HBV Core protein comprising the amino acid sequence of SEQ ID NO: 183 or an immunogenic fragment thereof
  • Embodiment 43 The fusion protein of embodiment 42, wherein the HBV sequence comprises the amino acid sequence of SEQ ID NO: 175.
  • Embodiment 44 The fusion protein of any one of embodiments 29-43, wherein the N- terminal HSV gD sequence comprises the amino acid sequence of SEQ ID NO: 12.
  • Embodiment 45 The fusion protein of any one of embodiments 29-43, wherein the N- terminal HSV gD sequence comprises amino acid residues 26-269 of SEQ ID NO: 12.
  • Embodiment 46 The fusion protein of any one of embodiments 29-45, wherein the C- terminal HSV gD sequence comprises the transmembrane domain of the HSV gD.
  • Embodiment 47 The fusion protein of any one of embodiments 29-46, wherein the C- terminal HSV gD sequence comprises the amino acid sequence of SEQ ID NO: 13.
  • Embodiment 48 The fusion protein of any one of embodiments 29-47, wherein the fusion protein comprises the amino acid sequence of any one of SEQ ID NO: 14 or an immunogenic fragment thereof, SEQ ID NO: 16 or an immunogenic fragment thereof, or SEQ ID NO: 18 or an immunogenic fragment thereof.
  • Embodiment 49 The fusion protein of any one of embodiments 39-47, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO: 185.
  • Embodiment 50 The fusion protein of any one of embodiments 39-47, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO: 187.
  • Embodiment 51 A nucleic acid molecule encoding the fusion protein of any one of embodiments 23-50.
  • Embodiment 52 The nucleic acid molecule of embodiment 51, wherein the nucleic acid molecule comprises the nucleotide sequence of any one of SEQ ID NOs: 15, 17, or 19.
  • Embodiment 53 The nucleic acid molecule of embodiment 51, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 176.
  • Embodiment 54 The nucleic acid molecule of embodiment 51, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 177.
  • Embodiment 55 The nucleic acid molecule of embodiment 51, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 184.
  • Embodiment 56 The nucleic acid molecule of embodiment 51, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 186.
  • Embodiment 57 A vector comprising the nucleic acid molecule of any one of embodiments 51-56.
  • Embodiment 59 The vector of embodiment 58, wherein the adenoviral vector is an AdC6 vector or AdC7 vector.
  • Embodiment 60 A vaccine comprising the vector of any one of embodiments 57-59.
  • Embodiment 61 A method of inducing an immune response to HBV in a subject, the method comprising providing to the subject an effective amount of the fusion protein of any one of embodiments 23-50, the nucleic acid molecule of any one of embodiments 51- 56, the vector of any one of embodiments 57-59, or the vaccine of embodiment 60 to thereby induce an immune response to HBV.
  • Embodiment 62 The method of embodiment 61, wherein the vaccine comprises an AdC6 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof.
  • Embodiment 63 The method of embodiment 62, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC6 vector, a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof.
  • Embodiment 64 The method of embodiment 61, wherein the vaccine comprises an AdC7 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof.
  • Embodiment 65 The method of embodiment 64, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC7 vector, a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of any one of SEQ ID NOs: 14, 16, or 18, or an immunogenic fragment thereof.
  • Embodiment 66 The method of embodiment 61, wherein the vaccine comprises an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185.
  • Embodiment 67 The method of embodiment 66, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC6 vector, a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185.
  • Embodiment 68 The method of embodiment 61, wherein the vaccine comprises an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185.
  • Embodiment 69 The method of embodiment 68, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC7 vector, a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 185.
  • Embodiment 70 The method of embodiment 61, wherein the vaccine comprises an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187.
  • Embodiment 71 The method of embodiment 70, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC6 vector, a vaccine comprising an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187.
  • Embodiment 72 The method of embodiment 61, wherein the vaccine comprises an AdC7 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187.
  • Embodiment 73 The method of embodiment 72, further comprising providing to the subject, subsequent to providing the vaccine comprising the AdC7 vector, a vaccine comprising an AdC6 vector comprising a fusion protein comprising the amino acid sequence of SEQ ID NO: 187.
  • Embodiment 74 The method of any one of embodiments 61-73, wherein the amino acid sequence of any one of SEQ ID NOs: 14, 16, 18, 185, or 187, or an immunogenic fragment thereof, does not contain the N-terminal 25 amino acid signal peptide.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Communicable Diseases (AREA)
  • Molecular Biology (AREA)
  • Mycology (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2021/012630 2020-01-09 2021-01-08 Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same Ceased WO2021142212A1 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
JP2022542413A JP7696909B2 (ja) 2020-01-09 2021-01-08 ヘルペスウイルス糖タンパク質dと融合したb型肝炎ウイルス抗原をコードするアデノウイルスベクター及びその使用方法
CA3166989A CA3166989A1 (en) 2020-01-09 2021-01-08 Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same
IL294387A IL294387A (en) 2020-01-09 2021-01-08 Adenovirus vectors encoding hepatitis b virus antigens fused to herpesvirus glycoprotein d and methods of using them
BR112022013620A BR112022013620A2 (pt) 2020-01-09 2021-01-08 Vetores adenovirais que codificam antígenos virais da hepatite b fundidos à glicoproteína d do vírus do herpes e métodos de uso dos mesmos
CN202180019813.3A CN115335076B (zh) 2020-01-09 2021-01-08 编码与疱疹病毒糖蛋白d融合的乙型肝炎病毒抗原的腺病毒载体及其使用方法
AU2021205936A AU2021205936A1 (en) 2020-01-09 2021-01-08 Adenoviral vectors encoding hepatitis B viral antigens fused to herpes virus glycoprotein D and methods of using the same
PH1/2022/551648A PH12022551648A1 (en) 2020-01-09 2021-01-08 Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same
MX2022008572A MX2022008572A (es) 2020-01-09 2021-01-08 Vectores adenoviricos que codifican antigenos viricos de la hepatitis b fusionados con la glucoproteina d del virus del herpes y metodos de uso de los mismos.
EP21703111.1A EP4087605A1 (en) 2020-01-09 2021-01-08 Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same
CN202511456350.3A CN121221754A (zh) 2020-01-09 2021-01-08 编码与疱疹病毒糖蛋白d融合的乙型肝炎病毒抗原的腺病毒载体及其使用方法
KR1020227027069A KR20220163354A (ko) 2020-01-09 2021-01-08 헤르페스 바이러스 당단백질 d와 융합된 간염 b 바이러스 항원들을 인코딩하는 아데노바이러스 벡터들 및 이를 이용하는 방법
US17/790,259 US12605444B2 (en) 2020-01-09 2021-01-08 Adenoviral vectors encoding hepatitis B viral antigens fused to herpes virus glycoprotein D and methods of using the same
US17/459,313 US11291716B2 (en) 2020-01-09 2021-08-27 Adenoviral vectors encoding hepatitis B viral antigens fused to herpes virus glycoprotein D and methods of using the same
US17/679,356 US11850282B2 (en) 2020-01-09 2022-02-24 Adenoviral vectors encoding hepatitis B viral antigens fused to herpes virus glycoprotein D and methods of using the same
US18/492,945 US12290561B2 (en) 2020-01-09 2023-10-24 Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same
US19/170,785 US20250228934A1 (en) 2020-01-09 2025-04-04 Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same
JP2025097871A JP2025124904A (ja) 2020-01-09 2025-06-11 ヘルペスウイルス糖タンパク質dと融合したb型肝炎ウイルス抗原をコードするアデノウイルスベクター及びその使用方法

Applications Claiming Priority (16)

Application Number Priority Date Filing Date Title
US202062958809P 2020-01-09 2020-01-09
US202062958827P 2020-01-09 2020-01-09
US62/958,809 2020-01-09
US62/958,827 2020-01-09
US202062967242P 2020-01-29 2020-01-29
US202062967104P 2020-01-29 2020-01-29
US62/967,242 2020-01-29
US62/967,104 2020-01-29
US202063064571P 2020-08-12 2020-08-12
US202063064506P 2020-08-12 2020-08-12
US63/064,571 2020-08-12
US63/064,506 2020-08-12
US202063112202P 2020-11-11 2020-11-11
US202063112219P 2020-11-11 2020-11-11
US63/112,202 2020-11-11
US63/112,219 2020-11-11

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/459,313 Continuation US11291716B2 (en) 2020-01-09 2021-08-27 Adenoviral vectors encoding hepatitis B viral antigens fused to herpes virus glycoprotein D and methods of using the same

Publications (1)

Publication Number Publication Date
WO2021142212A1 true WO2021142212A1 (en) 2021-07-15

Family

ID=74505354

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/012630 Ceased WO2021142212A1 (en) 2020-01-09 2021-01-08 Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same

Country Status (13)

Country Link
US (5) US12605444B2 (https=)
EP (1) EP4087605A1 (https=)
JP (2) JP7696909B2 (https=)
KR (1) KR20220163354A (https=)
CN (2) CN121221754A (https=)
AU (1) AU2021205936A1 (https=)
BR (1) BR112022013620A2 (https=)
CA (1) CA3166989A1 (https=)
IL (1) IL294387A (https=)
MX (1) MX2022008572A (https=)
PH (1) PH12022551648A1 (https=)
WO (1) WO2021142212A1 (https=)
ZA (1) ZA202310905B (https=)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP7696909B2 (ja) * 2020-01-09 2025-06-23 ビリオン セラピューティクス,リミティド ライアビリティ カンパニー ヘルペスウイルス糖タンパク質dと融合したb型肝炎ウイルス抗原をコードするアデノウイルスベクター及びその使用方法

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012109404A1 (en) * 2011-02-12 2012-08-16 Globeimmune, Inc. Yeast-based therapeutic for chronic hepatitis b infection

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070054262A1 (en) * 2003-03-28 2007-03-08 Baker Denise M Methods of identifying optimal variants of peptide epitopes
WO2008027394A2 (en) * 2006-08-28 2008-03-06 The Wistar Institute Of Anatomy And Biology Constructs for enhancing immune responses
GB201223386D0 (en) * 2012-12-24 2013-02-06 Immune Targeting Systems Its Ltd Vaccine
EP2959915A1 (en) * 2014-06-23 2015-12-30 Institut Pasteur A dengue virus chimeric polyepitope composed of fragments of non-structural proteins and its use in an immunogenic composition against dengue virus infection
CN105367662B (zh) * 2014-08-29 2021-03-12 汤正好 一种hbv相关的融合蛋白、其制备方法及其应用
EP3439696A4 (en) * 2016-04-06 2019-12-25 University of Washington THERAPEUTIC VACCINE AGAINST THE HEPATITIS B VIRUS (HBV) USING THE HBV CORE ANTIGEN
EP3490610A4 (en) 2016-08-01 2020-05-20 The Wistar Institute Of Anatomy And Biology Compositions and methods of replication deficient adenoviral vectors for vaccine applications
DK4037708T3 (da) * 2019-09-30 2024-09-30 Gilead Sciences Inc HBV-vacciner og fremgangsmåder til at behandle HBV
JP7696909B2 (ja) * 2020-01-09 2025-06-23 ビリオン セラピューティクス,リミティド ライアビリティ カンパニー ヘルペスウイルス糖タンパク質dと融合したb型肝炎ウイルス抗原をコードするアデノウイルスベクター及びその使用方法

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012109404A1 (en) * 2011-02-12 2012-08-16 Globeimmune, Inc. Yeast-based therapeutic for chronic hepatitis b infection

Non-Patent Citations (8)

* Cited by examiner, † Cited by third party
Title
"Remington, The Science and Practice of Pharmacy", 2000, MACK PUBLISHING
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO.
FARINA SFGAO GPXIANG ZQRUX JJBURNETT RMALVIRA MRMARSH JERTL HCWILSON JM: "Replication-defective vector based on a chimpanzee adenovirus", J VIROL, vol. 75, no. 23, December 2001 (2001-12-01), pages 11603 - 13, XP002957497, DOI: 10.1128/JVI.75.23.11603-11613.2001
JIAN LI ET AL: "The prevalence of neutralising antibodies to chimpanzee adenovirus type 6 and type 7 in healthy adult volunteers, patients with chronic hepatitis B and patients with primary hepatocellular carcinoma in China", ARCHIVES OF VIROLOGY, vol. 159, no. 3, 22 September 2013 (2013-09-22), AT, pages 465 - 470, XP055795750, ISSN: 0304-8608, Retrieved from the Internet <URL:http://link.springer.com/article/10.1007/s00705-013-1828-y/fulltext.html> DOI: 10.1007/s00705-013-1828-y *
PERRINE MARTIN ET AL: "TG1050, an immunotherapeutic to treat chronic hepatitis B, induces robust T cells and exerts an antiviral effect in HBV-persistent mice", GUT MICROBIOTA, vol. 64, no. 12, 26 November 2014 (2014-11-26), UK, pages 1961 - 1971, XP055565264, ISSN: 0017-5749, DOI: 10.1136/gutjnl-2014-308041 *
PINTO ARFITZGERALD JCGILES-DAVIS WGAO GPWILSON JMERTL HC: "Induction of CD8+ T cells to an HIV-1 antigen through a prime boost regimen with heterologous El-deleted adenoviral vaccine carriers", J IMMUNOL, vol. 171, no. 12, 15 December 2003 (2003-12-15), pages 6774 - 9, XP002363607
REYES-SANDOVAL AFITZGERALD JCGRANT RROY SXIANG ZQLI YGAO GPWILSON JMERTL HC: "Human immunodeficiency virus type 1-specific immune responses in primates upon sequential immunization with adenoviral vaccine carriers of human and simian serotypes", J VIROL, vol. 78, no. 14, July 2004 (2004-07-01), pages 7392 - 9, XP009037289, DOI: 10.1128/JVI.78.14.7392-7399.2004
ZHENG B ET AL: "Immunogenicity in mice of tandem repeats of an epitope from herpes simplex gD protein when expressed by recombinant adenovirus vectors", VACCINE, ELSEVIER, AMSTERDAM, NL, vol. 11, no. 12, 1 January 1993 (1993-01-01), pages 1191 - 1198, XP023710651, ISSN: 0264-410X, [retrieved on 19930101], DOI: 10.1016/0264-410X(93)90042-V *

Also Published As

Publication number Publication date
EP4087605A1 (en) 2022-11-16
US20220175913A1 (en) 2022-06-09
US12605444B2 (en) 2026-04-21
CN115335076A (zh) 2022-11-11
MX2022008572A (es) 2022-09-23
JP7696909B2 (ja) 2025-06-23
CN121221754A (zh) 2025-12-30
US20250228934A1 (en) 2025-07-17
JP2023510544A (ja) 2023-03-14
US20230063089A1 (en) 2023-03-02
US12290561B2 (en) 2025-05-06
PH12022551648A1 (en) 2024-02-12
KR20220163354A (ko) 2022-12-09
AU2021205936A1 (en) 2022-07-21
CA3166989A1 (en) 2021-07-15
ZA202310905B (en) 2025-06-25
BR112022013620A2 (pt) 2022-09-13
CN115335076B (zh) 2025-10-28
US11291716B2 (en) 2022-04-05
IL294387A (en) 2022-08-01
JP2025124904A (ja) 2025-08-26
US20210393770A1 (en) 2021-12-23
US20240091347A1 (en) 2024-03-21
US11850282B2 (en) 2023-12-26

Similar Documents

Publication Publication Date Title
US20230330215A1 (en) Sars-cov-2 vaccines
US20230128001A1 (en) Hiv antigens and mhc complexes
US20250228934A1 (en) Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same
CN115942942A (zh) 感染性疾病抗原和疫苗
AU2022210420A1 (en) Modified alphavirus vectors
KR20200100686A (ko) B형 간염 면역화 레지멘 및 조성물
Zhang et al. Woodchuck hepatitis virus core antigen-based DNA and protein vaccines induce qualitatively different immune responses that affect T cell recall responses and antiviral effects
US20250121052A1 (en) Sars-cov-2 vaccines
US20240238412A1 (en) Pancoronavirus vaccines
HK40082959A (en) Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same
WO2026030253A1 (en) Human papillomavirus (hpv) vaccines
CN118302195A (zh) 泛冠状病毒疫苗

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21703111

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3166989

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022542413

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022013620

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2021205936

Country of ref document: AU

Date of ref document: 20210108

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021703111

Country of ref document: EP

Effective date: 20220809

ENP Entry into the national phase

Ref document number: 112022013620

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20220708

WWG Wipo information: grant in national office

Ref document number: 202180019813.3

Country of ref document: CN

WWD Wipo information: divisional of initial pct application

Ref document number: 829006

Country of ref document: NZ

Ref document number: 829005

Country of ref document: NZ