WO2020257727A1 - Methods of dosing circular polyribonucleotides - Google Patents
Methods of dosing circular polyribonucleotides Download PDFInfo
- Publication number
- WO2020257727A1 WO2020257727A1 PCT/US2020/038835 US2020038835W WO2020257727A1 WO 2020257727 A1 WO2020257727 A1 WO 2020257727A1 US 2020038835 W US2020038835 W US 2020038835W WO 2020257727 A1 WO2020257727 A1 WO 2020257727A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition
- days
- level
- providing
- circular polyribonucleotide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0083—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the administration regime
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
- A61K48/0016—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the nucleic acid is delivered as a 'naked' nucleic acid, i.e. not combined with an entity such as a cationic lipid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/16—Otologicals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/14—Vasoprotectives; Antihaemorrhoidals; Drugs for varicose therapy; Capillary stabilisers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/67—General methods for enhancing the expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P19/00—Preparation of compounds containing saccharide radicals
- C12P19/26—Preparation of nitrogen-containing carbohydrates
- C12P19/28—N-glycosides
- C12P19/30—Nucleotides
- C12P19/34—Polynucleotides, e.g. nucleic acids, oligoribonucleotides
Definitions
- This present disclosure generally relates to methods of dosing circular polyribonucleotides.
- the methods as disclosed herein generally relate to a method of expressing a protein in a cell or subject comprising providing a composition of circular polyribonucleotide encoding a protein to the cell or subject, a method of binding a protein in a cell or subject comprising providing a composition of a circular polyribonucleotide comprising a binding site to the cell or subject, or both.
- a method of dosing comprise providing multiple doses to a cell or subject. For example, a multiple dosing is a redosing or a staggered dosing.
- a method of redosing of a composition of circular polyribonucleotides comprises providingtwo or more compositions, generally over an extended period of time, to a cell or subject (e.g. a mammal).
- a method of a staggered dosing of a composition of circular polyribonucleotide comprises providing two or more compositions generally over a short time interval.
- the invention features a method of maintaining expression of a protein in a mammal, comprising: (a) providing a first composition comprising a circular polyribonucleotide that encodes the protein to the mammal; and (b) from 6 hours to 90 days following step (a), providing a second composition comprising a circular polyribonucleotide that encodes the protein, to the mammal, thereby maintaining expression of the protein in the mammal.
- the circular polyribonucleotide is an exogenous, synthetic circular polyribonucleotide. In some embodiments, the circular polyribonucleotide lacks a poly-A sequence, a replication element, or both.
- the first composition comprises a first circular polyribonucleotide and the second compositions comprises a second circular polyribonucleotide, wherein the first circular polyribonucleotide and the second circular polyribonucleotide are the same.
- the first composition comprises a first circular polyribonucleotide and the second compositions comprises a second circular polyribonucleotide, wherein the first circular polyribonucleotide and the second compositions comprises a second circular polyribonucleotide, wherein the first circular
- polyribonucleotide and the second circular polyribonucleotide are different.
- providing the second composition occurs after providing the first composition and before a first level of protein expressed by the first composition is substantially undetectable in the mammal. In some embodiments, providing the second composition occurs after providing the first composition and before a first level of protein expressed by the first composition decreases by more than 50% in the mammal.
- the method further comprise providing a third composition of the circular polyribonucleotide to the mammal after the second composition, thereby maintaining expression of the protein in the mammal. In some embodiments, the method further comprise providing a third composition of the circular polyribonucleotide to the mammal after the second composition, thereby restoring expression of the protein in the mammal. In some embodiments, providing the third composition occurs after providing the second composition and before a second level of the protein expressed by the first and second composition is substantially undetectable in the mammal. In some embodiments, providing the third composition occurs after providing the second composition and before a second level of the protein expressed by the first and second composition in the mammal decreases by more than 50%. In some embodiments, the method further comprises providing a fourth, fifth, sixth, seventh, eighth, ninth, or tenth composition of a circular polyribonucleotide encoding the protein.
- the first composition further comprises a pharmaceutically acceptable carrier or excipient. In some embodiments, the first composition further comprises a pharmaceutically acceptable excipient and is free of any carrier. In some embodiments, the second composition further comprises a pharmaceutically acceptable carrier or excipient. In some embodiments, the second composition further comprises a pharmaceutically acceptable excipient and is free of any carrier. In some embodiments, the third composition further comprises a pharmaceutically acceptable carrier or excipient. In some embodiments, the third composition further comprises a pharmaceutically acceptable excipient and is free of any carrier.
- a first level of the protein expressed by the first composition is a highest level of the protein 1-2 days after providing the first composition. In some embodiments, a first level of the protein expressed by the first composition is 40%, 50%, 60%, 70%,
- a second level of the protein is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, or 200% of the highest level of the protein one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing the second composition.
- a third level of the protein is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, or 200% of the highest level of the protein one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing the third composition.
- a subsequent level of the protein expressed after each subsequent composition is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, or 200% of a highest level of the protein one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing each subsequent composition.
- an average level of the protein after providing the second composition is at least 40%, 50%, 60%, 70%, 80%, 90%, 100% or 110% of a first level of protein from the first composition, wherein the average level of the protein is measured from one day after providing the second composition to the day when the protein is substantially undetectable.
- an average level of the protein after providing each subsequent composition after the first composition is at least 40%, 50%, 60%, 70%, 80%, 90%, 100% or 110% of the first level of protein from the first composition, wherein the average level of the protein is measured from one day after providing each subsequent composition to the day when the protein is substantially undetectable.
- a first level of the protein is maintained after providing the first composition and the second composition for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 35 days after providing the first composition. In some embodiments, a first level of the protein is maintained after providing the first composition and the second composition for from 6 hours to 90 days after providing the first composition. In some embodiments, a first level of the protein is maintained after providing the first composition, the second composition, and the third composition of circular polyribonucleotide for from 6 hours to 270 days after providing the first composition. In some embodiments, a first level of the protein is substantially undetectable after providing the first composition and the second composition for 6 hours to 35 days after providing the first composition.
- a first level of the protein is maintained after providing the first composition, the second composition, and the third composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 35 days after providing the first composition.
- a second level of protein in the mammal after providing the second composition is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of protein in the mammal after providing the first composition.
- a third level of protein produced in the mammal after providing the third composition is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of protein in the plurality after providing the first composition.
- the second level of protein 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the second composition of the circular
- polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the protein after providing the first composition.
- a third level of protein 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the third composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the protein after providing the first composition.
- the protein is a therapeutic protein, e.g., erythropoietin.
- the protein e.g., erthryropoietin
- a response e.g., reticulocyte production
- the therapeutic protein is an enzyme replacement protein, a protein for supplementation, a hormone, a cytokine, an antibody, a protein for immunotherapy (e.g. cancer), a cellular
- the protein is an antigen (e.g., tumor antigen, viral antigen, bacterial antigen
- the invention features a method of maintaining expression of a protein in a cell or subject, comprising providing a first composition comprising a circular polyribonucleotide that encodes the protein to the cell or subject; thereby maintaining expression of the protein in the cell or subject;.
- the invention features a a method of maintaining expression of a protein in a cell or subject, comprising from 6 hours to 90 days following step (a), providing a second composition comprising a circular polyribonucleotide that encodes the protein, to the cell or subject; thereby maintaining expression of the protein in the cell or subject;.
- the invention features a method of expressing protein in a cell or a subject comprising providing a first composition comprising a circular polyribonucleotide that encodes a protein to the cell or the subject, wherein the cell or the subject expresses a first level of an encoded protein; and (i) the second level is at least as much as the first level, or (ii) the second level varies by no more than 20% of the first level; thereby maintaining expression of encoded protein in the cell or the subject at least at the first level of the protein.
- the invention features a method of expressing protein in a cell or a subject comprising: providing a second composition comprising a circular polyribonucleotide that encodes a protein to the cell or the subject, wherein the cell or the subject expresses a second level of an encoded protein and (i) the second level is at least as much as the first level, or (ii) the second level varies by no more than 20% of the first level; thereby maintaining expression of encoded protein in the cell or the subject at least at the first level of the protein.
- the invention features a method of expressing a level of a protein in a cell or subject after providing a first composition and a second composition of a circular polyribonucleotide to the cell or subject compared to a level of the protein in the cell or subject after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide, comprising: providing a first composition of circular polyribonucleotide encoding aprotein to a cell or subject, wherein the cell or subject comprises a level of the protein after providing the first composition of the circular polyribonucleotide; and (i) at least the level of the protein after providing the second composition of the circular polyribonucleotide, or (ii) a level of the protein that varies by no more than 20% of the level after providing the second composition of the circular polyribonucleotide; thereby maintaining expression of the level of the protein in the cell or subject after providing the first composition and the second composition of the circular polyribonucleotide;
- the invention features a method of expressing a level of a protein in a cell or subject after providing a first composition and a second composition of a circular polyribonucleotide to the cell or subject compared to a level of the protein in the cell or subject after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide, comprising: providing a second composition of circular polyribonucleotide after the first composition to the cell or subject, wherein the cell or subject comprises (i) at least the level of the protein after providing the second composition of the circular polyribonucleotide, or (ii) a level of the protein that varies by no more than 20% of the level after providing the second composition of the circular polyribonucleotide; thereby maintaining expression of the level of the protein in the cell or subject after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of the protein in the cell or subject after providing the first composition and
- providing the first composition is to a first cell in the subject and providing the second composition is to a second cell in the subject and wherein the first cell and second cell are the same cell or different cells.
- providing the second composition occurs after providing the first composition and before the first level of protein expressed by the first composition is substantially undetectable in the cell or subject.
- providing the second composition occurs after providing the first composition and before the first level of protein expressed by the first composition decreases by more than 50% in the cell or subject.
- providing the second composition occurs after providing the first composition and before the first level of protein expressed by the first composition decreases by 25%-75% in the cell or subject.
- the method further comprises providing a third composition of the circular polyribonucleotide to the cell or subject after the second composition, thereby maintaining expression of the protein in the cell or subject at least at the first level of protein.
- providing the third composition occurs after providing the second composition and (i) before the second level of the protein expressed by the first and second composition is substantially undetectable in the cell or subject, or (ii) before the second level of the protein expressed by the first and second composition in the cell or subject decreases by more than 50%.
- the method further comprises providing a fourth, fifth, sixth, seventh, eighth, ninth, or tenth composition of the circular polyribonucleotide.
- the second composition is provided to the cell or subject at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 9 months, 10 months, 11 months, 12 month, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 19 months, 20 months, 21 months, or 22 months after the level of protein in the cell or subject expressed by the first composition is substantially undetectable.
- the second composition is provided to the cell or subject at least 14 days after the first composition and no more than 90 days after the first composition.
- a first level of the protein is a highest level of the protein one day after providing the first composition. In some embodiments, a first level of the protein is 40%, 50%, 60%,
- a second level of the protein is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of the highest level of the protein one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, or 30 days after providing the second composition.
- a third level of the protein is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of the highest level of the protein one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, or 30 days after providing the third composition.
- each subsequent composition provided after the first composition a subsequent level of the protein expressed after each subsequent composition is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of a highest level of the protein one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, or 30 days after providing each subsequent composition.
- an average level of the protein after providing the second composition is at least 40%, 50%, 60%, 70%, 80%, 90%, 100%, or 110% of the first level, wherein the average level of the protein is measured from one day after providing the second composition to the day when the protein is substantially undetectable.
- an average level of the protein after providing each subsequent composition after the first composition is at least 40%, 50%, 60%, 70%, 80%, 90%, 100%, or 110% of the first level, wherein the average level of the protein is measured from one day after providing each subsequent composition to the day when the protein is substantially undetectable.
- the first level of the protein is maintained after providing the first composition and the second composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 30 days after providing the first composition.
- the first level of the protein is maintained after providing the first composition, the second composition, and the third composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 30 days after providing the first composition.
- the second level of protein in the cell or subject after providing the second composition is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of protein in the cell or subject after providing the first composition.
- a third level of protein produced in the cell or subject after providing the third composition is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of protein in the plurality after providing the first composition.
- the second level of protein 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the second composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the protein after providing the first composition.
- the third level of protein 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days after providing the third composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the protein after providing the first composition.
- the level of the protein in the cell or subject after providing the first composition and the second composition of the circular polyribonucleotide is maintained for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days.
- the level of the protein in the cell or subject after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of the protein in the cell or subject after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- the level of the protein in the cell or subject after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of the protein in the cell or subject after providing the first composition and the second composition of the linear counterpart of the circular for at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days after providing the second composition of the circular polyribonucleotide.
- the protein is a therapeutic protein, e.g., erythropoietin, and/or wherein expression of the protein (e.g., erthyropoietin) induces a response (e.g., reticulocyte production) in the cell or subject.
- the protein is an antigen (e.g., tumor antigen, viral antigen, bacterial antigen).
- the protein is a protein for vaccination.
- the invention features a method of producing a circular polyribonucleotide in a cell or subject comprising: providing a first composition comprising the circular polyribonucleotide to the cell or subject, wherein the cell or subject comprises a first level of circular polyribonucleotide after providing the first composition; and providing a second composition of a circular polyribonucleotide to the cell or subject, wherein the cell or subject comprises a second level of circular polyribonucleotide and (i) the second level of circular polyribonucleotide is at least as much as the first level, or (ii) the second level of circular polyribonucleotide varies by no more than 20% of the first level after providing the second composition; thereby maintaining circular polyribonucleotide in the cell or subject at least at the first level.
- the first composition comprises a first circular
- the polyribonucleotide and the second compositions comprises a second circular polyribonucleotide, wherein: (i) the first circular polyribonucleotide and the second circular polyribonucleotide are the same; or (ii) the first circular polyribonucleotide and the second circular polyribonucleotide are different.
- the first circular polyribonucleotide comprises a first binding site and/or encodes a first protein
- the second circular polyribonucleotide comprise a second binding site and/or encodes a second protein, wherein the first binding site and the second binding site are the same or are different binding sites and/or the first protein and the second protein encode the same protein or different proteins.
- the invention features a method of producing a level of a circular
- polyribonucleotide in a cell or subject after providing a first composition and a second composition of the circular polyribonucleotide to the cell or subject compared to a level of a linear counterpart of the circular polyribonucleotide in the cell or subject after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide, comprising: providing a first composition of the circular polyribonucleotide to the cell or subject, wherein the cell or subject comprises the level of the circular polyribonucleotide after providing the first composition; and providing the second composition of the circular polyribonucleotide to the cell or subject, wherein the cell or subject comprises (i) at least the level of the circular polyribonucleotide after providing the second composition, or (ii) a level of the protein after providing the second composition that varies by no more than 20% of the level of the circular polyribonucleotide; thereby maintaining the level of the circular polyribonucleotide in the
- polyribonucleotide compared to the level of the linear counterpart in the cell or subject after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- providing the second composition occurs after providing the first composition and before the level of circular polyribonucleotide produced by providing the first composition is substantially undetectable in the cell or subject.
- providing the second composition of the circular polyribonucleotide occurs after the first composition and after the level of circular polyribonucleotide in the cell or subject produced by the first composition is substantially undetectable.
- the second composition is provided to the cell or subject at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 9 months, 10 months, 11 months, 12 month, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 19 months, 20 months, 21 months, or 22 months after the level of circular polyribonucleotide produced by the first composition is substantially undetectable.
- the second composition is provided to the cell or subject at least 14 days after the first composition and no more than 90 days after the first composition.
- the method further comprises providing a third composition of circular polyribonucleotide to the cell or subject after the second composition, thereby maintaining the level of circular polyribonucleotide after providing the third composition at least at the first level, and, optionally, wherein providing the third composition occurs after providing the second composition and (i) before the level of circular polyribonucleotide produced by the first and second composition in the cell or subject is substantially undetectable in the cell or subject, or (ii) before the level of circular polyribonucleotide produced by the first and second composition in the cell or subject decreases by more than 50%; or (iii) before the level of circular polyribonucleotide produced by the first and second composition in the cell or subject decreases by 25%-75% in the cell or subject.
- the method further comprises providing a fourth, fifth, sixth, seventh, eighth, ninth, or tenth composition of the circular polyribonucleotide to the cell or subject.
- the first level of the circular polyribonucleotide is a highest level of circular polyribonucleotide one day after providing the first composition. In some embodiments, for each subsequent composition provided after the first composition, a subsequent level of circular
- polyribonucleotide expressed after each subsequent composition is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of a highest level of circular polyribonucleotide one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, or 30 days after providing each subsequent composition.
- an average level of the circular polyribonucleotide after providing the second composition is at least 40%, 50%, 60%, 70%, 80%, or 90% of the first level, wherein the average level of the circular polyribonucleotide is measured from one day after providing the second composition to the day when the circular polyribonucleotide is substantially undetectable.
- an average level of the circular polyribonucleotide after providing each subsequent composition after the first composition is at least 40%, 50%, 60%, 70%, 80%, or 90% of the first level, wherein the average level of the circular polyribonucleotide is measured from one day after providing each subsequent composition to the day when the circular polyribonucleotide is substantially undetectable.
- the first level of the circular polyribonucleotide is maintained after providing the second composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 30 days.
- the second level of circular polyribonucleotide in the cell or subject after providing the second composition is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of circular polyribonucleotide in the cell or subject after providing the first composition.
- the second level of circular polyribonucleotide 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days after providing the second composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of circular polyribonucleotide after providing the first composition.
- a third level of circular polyribonucleotide 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days after providing the third composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of circular polyribonucleotide after providing the first composition.
- the level of circular polyribonucleotide in the cell or subject after providing the first composition and the second composition of the circular polyribonucleotide is maintained for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days.
- the level of circular polyribonucleotide produced by the first composition is 40%, 50%, 60%, 70%, 80%, or 90% of a highest level of the circular polyribonucleotide one day after providing the first composition.
- the level of circular polyribonucleotide produced by the second composition is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of a highest level of circular polyribonucleotide one day after providing the first composition, for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, or 30 days after providing the second composition.
- the level of circular polyribonucleotide in the cell or subject after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of linear counterpart of the circular polyribonucleotide in the cell or subject after providing the first composition and the second composition of the linear counterpart of circular polyribonucleotide.
- the level of circular polyribonucleotide after providing the first composition and the second composition of circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of linear counterpart of circular polyribonucleotide after providing the first composition and the second composition of the linear counterpart of the circular for at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days after providing the second composition of the circular polyribonucleotide.
- a third level of the circular polyribonucleotide is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of the highest level of circular polyribonucleotide one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, or 30 days after providing the third composition.
- the first level of circular polyribonucleotide is maintained after providing the third composition of circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days or 30 days. In some embodiments, the third level of circular
- polyribonucleotide in the cell or subject after providing the third composition is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of circular polyribonucleotide in the plurality after providing the first composition.
- the third level of circular polyribonucleotide 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days after providing the third composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of circular
- the protein e.g., erthypoietin induces a response (e.g., production of reticulocytes) in the subject.
- the protein is an antigen (e.g., viral antigen, bacterial antigen, tumor antigen).
- the invention features a method of binding a target in a cell or subject comprising: providing a first composition comprising a circular polyribonucleotide that comprises a binding site for a target, to the cell or subject, wherein the target binds to the binding site at a first level; and providing a second composition comprising the circular polyribonucleotide that comprises a binding site for a target to the cell or subject, wherein the target binds to the binding site at a second level and (i) the second level is at least as much as the first level, or (ii) the second level varies by no more than 20% of the first level;
- the invention features a method of binding a target in a cell or subject after providing a first composition and a second composition of a circular polyribonucleotide to the cell or subject compared to a level of binding to the target in the cell or subject after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide, comprising: (a) providing a first composition of the circular polyribonucleotide comprising binding site to the cell or subject, wherein the cell or subject comprises the level of the binding to the target after providing the first composition of the circular polyribonucleotide; and (b) providing the second composition of the circular polyribonucleotide after the first composition to the cell or subject, wherein the cell or subject comprises (i) at least the level of the binding to the target after providing the second composition of the circular polyribonucleotide, or (ii) a level of the binding to a target that varies by no more than 20% of the level after providing
- providing the second composition occurs after providing the first composition and before the first level of binding by the first composition is substantially undetectable in the cell or subject. In some embodiments, wherein providing the second composition occurs after providing the first composition and before the first level of binding by the first composition decreases by more than 50% in the cell or subject. In some embodiments, wherein providing the second composition occurs after providing the first composition and before the first level of binding by the first composition decreases by 25%-75% in the cell or subject.
- the method further comprises providing a third composition of the circular polyribonucleotide to the cell or subject after the second composition, thereby maintaining binding of the target in the cell or subject at least at the first level of binding.
- providing the third composition occurs after providing the second composition and before the second level of the binding of the target in the cell or subject by the first and second composition is substantially undetectable in the cell or subject.
- providing the third composition occurs after providing the second composition and before the second level of the binding by the first and second composition in the cell or subject decreases by more than 50%.
- the method further comprises providing a fourth, fifth, sixth, seventh, eighth, ninth, or tenth composition of the circular polyribonucleotide.
- providing the second composition of circular polyribonucleotide occurs after the first composition and after the level of binding by the first composition is substantially undetectable.
- the second composition is provided to the cell or subject at least 6 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 9 months, 10 months, 11 months, 12 month, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 19 months, 20 months, 21 months, or 22 months after the level of binding by the first composition is substantially undetectable.
- the second composition is provided to the cell or subject at 14 days after the first composition and no more than 90 days after the first composition.
- the first level of binding is the highest level of binding one day after providing the first composition.
- the first level of the binding is 40%, 50%, 60%, 70%, 80%, or 90% of the highest level of binding one day after providing the first composition.
- the second level of binding is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of a highest level of binding one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, 40, or 45 days after providing the second composition.
- the third level of binding is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of a highest level of binding one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, or 30 days after providing the third composition.
- a subsequent level of binding after each subsequent composition is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of the highest level of binding one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, or 30 days after providing each subsequent composition.
- an average level of binding after providing the second composition is at least 40%, 50%, 60%, 70%, 80%, 90%, 100%, or 110% of the first level, wherein the average level of binding is measured from one day after providing the second composition to the day when the binding is substantially undetectable.
- an average level of binding after providing each subsequent composition after the first composition is at least 40%, 50%, 60%, 70%, 80%, 90%, 100%, or 110% of the first level, wherein the average level of binding is measured from one day after providing each subsequent composition to the day when the binding is substantially undetectable.
- the first level of the binding is maintained after providing the first composition and the second composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 30 days after providing the first composition
- the second level of binding in the cell or subject after providing the second composition is at least 1%
- the second level of binding 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days after providing the second composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the binding after providing the first composition.
- the level of binding in the cell or subject after providing the first composition and the second composition of the circular polyribonucleotide is maintained for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days.
- the level of binding in the cell or subject after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of binding in the cell or subject after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide
- the level of binding in the cell or subject after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of binding in the cell or subject after providing the first composition and the second composition of the linear counterpart of the circular for at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days after providing the second composition of the circular polyribonucleotide.
- the first level of the binding is maintained after providing the first composition, second composition, and third composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 30 days after providing the first composition
- a third level of binding in the cell or subject after providing the third composition is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of binding after providing the first composition.
- a third level of binding 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days after providing the third composition of the circular polyribonucleotide is at least 1%, 5%,
- the circular polyribonucleotide of the first composition and the circular polyribonucleotide of the second composition are the same. In some embodiments, the circular polyribonucleotide of the first composition and the circular polyribonucleotide of the second composition are different.
- the first composition and the second composition comprise about the same amount of the circular polyribonucleotide.
- the first composition comprises a higher amount of the circular polyribonucleotides than the second composition.
- the first composition comprises a higher amount of the circular polyribonucleotides than a third, fourth, fifth, sixth, seventh, eighth, ninth, or tenth composition.
- an amount of circular polyribonucleotide of the second composition varies by no more than 1%, 5%, 10%, 15%, 20%, or 25% of an amount of circular polyribonucleotide of the first composition.
- an amount of circular polyribonucleotide of the second composition is no more than 1%, 5%, 10%, 15%, 20%, or 25% less than an amount of circular polyribonucleotide of the first composition
- the first composition further comprises a pharmaceutically acceptable carrier or excipient.
- the second composition further comprises a pharmaceutically acceptable carrier or excipient.
- the third composition further comprises a pharmaceutically acceptable carrier or excipient.
- the cell is an animal cell (e.g., a mammalian cell, e.g., a human cell). In some embodiments, the cell is a plurality of cells in a subject.
- the first composition and/or the second composition comprises no more than 1 ng/ml, 5 ng/ml, 10 ng/ml, 15 ng/ml, 20 ng/ml, 25 ng/ml, 30 ng/ml, 35 ng/ml, 40 ng/ml, 50 ng/ml, 60 ng/ml, 70 ng/ml, 80 ng/ml, 90 ng/ml, 100 ng/ml, 200 ng/ml, 300 ng/ml, 400 ng/ml, 500 ng/ml, 600 ng/ml, 1 pg/ ml, 10 pg/ml, 50 pg/ml, 100 pg/ml, 200 g/ml, 300 pg/ml, 400 pg/ml, 500 pg/ml, 600 pg/ml, 700 pg/ml, 800 pg/ml, 900 pg/ml,
- the first composition and/or the second composition comprises at least 30% (w/w), 40% (w/w), 50% (w/w), 60% (w/w), 70% (w/w), 80% (w/w), 85% (w/w), 90% (w/w), 91% (w/w), 92% (w/w), 93% (w/w), 94% (w/w), 95% (w/w), 96% (w/w), 97% (w/w), 98% (w/w), or 99% (w/w) circular polyribonucleotide molecules relative to the total ribonucleotide molecules in the first composition and/or the second composition.
- the subject is an animal (e.g., a mammal). In some embodiments, the subject is a human. In some embodiments, the protein is an antigen (e.g., tumor antigen, bacterial antigen, viral antigen).
- an antigen e.g., tumor antigen, bacterial antigen, viral antigen.
- the invention generally features a method of producing a circular
- polyribonucleotide in a cell comprising: providing a first composition comprising the circular polyribonucleotide to the cell, wherein the cell comprises a first level of the circular polyribonucleotide after providing the first composition; and providing a second composition of the circular
- polyribonucleotide and the second level of circular polyribonucleotide is at least as much as the first level after providing the second composition; thereby maintaining the circular polyribonucleotide in the cell at least at the first level.
- the invention generally features a method of producing a circular polyribonucleotide in a mammal comprising: providing a first composition comprising the circular polyribonucleotide to the mammal, wherein the mammal comprises a first level of the circular polyribonucleotide after providing the first composition; and providing a second composition of the circular polyribonucleotides to the mammal, wherein the mammal comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide is at least as much as the first level after providing the second composition; thereby maintaining the circular polyribonucleotide in the mammal at least at the first level.
- the invention generally features a method of producing a level of a circular polyribonucleotide in a cell after providing a first composition and a second composition of the circular polyribonucleotide to the cell compared to a level of a linear counterpart of the circular polyribonucleotide in the cell after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide, comprising: providing a first composition of the circular polyribonucleotide to the cell, wherein the cell comprises the level of the circular polyribonucleotide after providing the first composition; and providing the second composition of the circular polyribonucleotide to the cell, wherein the cell comprises at least the level of the circular polyribonucleotide after providing the second composition; thereby maintaining the level of the circular polyribonucleotide in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of the linear counterpart
- the invention generally features a method of producing a level of a circular polyribonucleotide in a mammal after providing a first composition and a second composition of the circular polyribonucleotide to the mammal compared to a level of a linear counterpart of the circular polyribonucleotide in the mammal after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide, comprising: providing a first composition of the circular polyribonucleotide to the mammal, wherein the mammal comprises the level of the circular polyribonucleotide after providing the first composition; and providing the second composition of the circular polyribonucleotide to the mammal, wherein the mammal comprises at least the level of the circular polyribonucleotide after providing the second composition; thereby maintaining the level of the circular polyribonucleotide in the mammal after providing the first composition and the second composition of the circular poly
- the invention generally features a method of binding at target in a cell comprising: providing a first composition comprising the circular polyribonucleotide to the cell, wherein the cell comprises a first level of binding after providing the first composition; and providing a second composition of the circular polyribonucleotides to the cell, wherein the cell comprises a second level of binding and the second level of binding is at least as much as the first level of binding after providing the second composition; thereby maintaining the binding in the cell at least at the first level.
- the invention generally features a method of binding at target in a mammal comprising: providing a first composition comprising the circular polyribonucleotide to the mammal, wherein the mammal comprises a first level of binding after providing the first composition; and providing a second composition of the circular polyribonucleotides to the mammal, wherein the mammal comprises a second level of binding and the second level of binding is at least as much as the first level of binding after providing the second composition; thereby maintaining the binding in the mammal at least at the first level.
- the invention generally features a method of binding a target in a cell after providing a first composition and a second composition of the circular polyribonucleotide to the cell compared to a level of binding in the cell after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide, comprising: providing a first composition of the circular polyribonucleotide to the cell, wherein the cell comprises the level of binding after providing the first composition; and providing the second composition of the circular polyribonucleotide to the cell, wherein the cell comprises at least the level of binding after providing the second composition; thereby maintaining the level of binding in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of binding in the cell after providing the first composition and the second composition of the linear counterpart of the circular
- the invention generally features a method of binding a target in a mammal after providing a first composition and a second composition of the circular polyribonucleotide to the mammal compared to a level of binding in the mammal after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide, comprising: providing a first composition of the circular polyribonucleotide to the mammal, wherein the mammal comprises the level of binding after providing the first composition; and providing the second composition of the circular polyribonucleotide to the mammal, wherein the mammal comprises at least the level of binding after providing the second composition; thereby maintaining the level of binding in the mammal after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of binding in the mammal after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- the terms“circRNA” or“circular polyribonucleotide” or“circular RNA” are used interchangeably and mean a polyribonucleotide molecule that has a structure having no free ends (i.e., no free 3’ and/or 5’ ends), for example a polyribonucleotide molecule that forms a circular or end-less structure through covalent or non-co valent bonds.
- aptamer sequence is a non-naturally occurring or synthetic oligonucleotide that specifically binds to a target molecule.
- an aptamer is from 20 to 500 nucleotides.
- an aptamer binds to its target through secondary structure rather than sequence homology.
- the term“encryptogen” is a nucleic acid sequence or structure of the circular polyribonucleotide that aids in reducing, evading, and/or avoiding detection by an immune cell and/or reduces induction of an immune response against the circular polyribonucleotide.
- the term“expression sequence” is a nucleic acid sequence that encodes a product, e.g., a peptide or polypeptide, or a regulatory nucleic acid.
- An exemplary expression sequence that codes for a peptide or polypeptide comprises a plurality of nucleotide triads, each of which code for an amino acid and is termed as a“codon”.
- exogenous when used with reference to a biomolecule (such as a circular RNA) means that the biomolecule was introduced into a host genome, cell or organism by the hand of man.
- a circular RNA that is added into an existing genome, cell, tissue or subject using recombinant DNA techniques and/or methods for internalizing a biomolecule into a cell is exogenous to the existing nucleic acid sequence, cell, tissue or subject, and any progeny of the nucleic acid sequence, cell, tissue or subject that retain the biomolecule.
- the term“immunoprotein binding site” is a nucleotide sequence that binds to an immunoprotein.
- the immunoprotein binding site aids in masking the circular polyribonucleotide as exogenous, for example, the immunoprotein binding site is bound by a protein (e.g., a competitive inhibitor) that prevents the circular polyribonucleotide from being recognized and bound by an immunoprotein, thereby reducing or avoiding an immune response against the circular polyribonucleotide.
- immunoprotein is any protein or peptide that is associated with an immune response, e.g., such as against an immunogen, e.g., the circular polyribonucleotide.
- immunoprotein include T cell receptors (TCRs), antibodies (immunoglobulins), major histocompatibility complex (MHC) proteins, complement proteins, and RNA binding proteins.
- the term“modified ribonucleotide” means any ribonucleotide analog or derivative that has one or more chemical modifications to the chemical composition of an unmodified natural ribonucleotide, such as a natural unmodified nucleotide adenosine (A), uridine (U), guanine (G), cytidine (C).
- the chemical modifications of the modified ribonucleotide are modifications to any one or more functional groups of the ribonucleotide, such as, the sugar the nucleobase, or the intemucleoside linkage (e.g. to a linking phosphate / to a phosphodiester linkage / to the phosphodiester backbone).
- the phrase“quasi-helical structure” is a higher order structure of the circular polyribonucleotide, wherein at least a portion of the circular polyribonucleotide folds into a helical structure.
- the phrase“quasi-double-stranded secondary structure” is a higher order structure of the circular polyribonucleotide, wherein at least a portion of the circular polyribonucleotide creates an internal double strand.
- regulatory element is a moiety, such as a nucleic acid sequence, that modifies expression of an expression sequence within the circular polyribonucleotide.
- the term“repetitive nucleotide sequence” is a repetitive nucleic acid sequence within a stretch of DNA or RNA or throughout a genome.
- the repetitive nucleotide sequence includes poly CA or poly TG (UG) sequences.
- the repetitive nucleotide sequence includes repeated sequences in the Alu family of introns.
- the term“replication element” is a sequence and/or motifs useful for replication or that initiate transcription of the circular polyribonucleotide.
- the term“stagger element” is a moiety, such as a nucleotide sequence, that induces ribosomal pausing during translation.
- the stagger element may include a chemical moiety, such as glycerol, a non nucleic acid linking moiety, a chemical modification, a modified nucleic acid, or any combination thereof.
- the term“substantially resistant” means one that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% resistance as compared to a reference.
- stoichiometric translation means a substantially equivalent production of expression products translated from the circular polyribonucleotide.
- stoichiometric translation of the circular polyribonucleotide can mean that the expression products of the two expression sequences can have substantially equivalent amounts, e.g., amount difference between the two expression sequences (e.g., molar difference) can be about 0, or less than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, or 20%.
- translation initiation sequence is a nucleic acid sequence that initiates translation of an expression sequence in the circular polyribonucleotide.
- termination element is a moiety, such as a nucleic acid sequence, that terminates translation of the expression sequence in the circular polyribonucleotide.
- translation efficiency means a rate or amount of protein or peptide production from a ribonucleotide transcript.
- translation efficiency can be expressed as amount of protein or peptide produced per given amount of transcript that codes for the protein or peptide, e.g., in a given period of time, e.g., in a given translation system, e.g., an in vitro translation system like rabbit reticulocyte lysate, or an in vivo translation system like a eukaryotic cell or a prokaryotic cell.
- circularization efficiency is a measurement of resultant circular polyribonucleotide versus its starting material.
- the term“immunogenic” is a potential to induce an immune response to a substance.
- an immune response may be induced when an immune system of an organism or a certain type of immune cells is exposed to an immunogenic substance.
- the term“non- immunogenic” is a lack of or absence of an immune response above a detectable threshold to a substance.
- no immune response is detected when an immune system of an organism or a certain type of immune cells is exposed to a non -immunogenic substance.
- a non- immunogenic circular polyribonucleotide as provided herein does not induce an immune response above a pre -determined threshold when measured by an immunogenicity assay.
- a non-immunogenic polyribonucleotide as provided herein can lead to production of an innate immune response at a level lower than a
- the predetermined threshold can be, for instance, at most 1.5 times, 2 times, 3 times, 4 times, 5 times, 6 times, 7 times, 8 times, 9 times, or 10 times the level of a marker(s) produced by an innate immune response for a control reference.
- the term“substantially undetectable” can refer to the level of the circular polyribonucleotide or the protein expressed from the circular polyribonucleotide that is lower than the level detectable by a relevant detection technique (e.g., chromatography (column, paper, gel, HPLC, UHPLC, IC, SEC, etc.), electrophoresis (UREA PAGE, chip-based, polyacrylamide gel, RNA, capillary, c-IEF, etc.), fluorescence-based detection techniques, etc.).
- a relevant detection technique e.g., chromatography (column, paper, gel, HPLC, UHPLC, IC, SEC, etc.), electrophoresis (UREA PAGE, chip-based, polyacrylamide gel, RNA, capillary, c-IEF, etc.), fluorescence-based detection techniques, etc.
- linear counterpart is a polyribonucleotide molecule (and its fragments) having the same or similar nucleotide sequence (e.g., 100%, 95%, 90%, 85%, 80%, 75%, or any percentage therebetween of sequence similarity) as a circular polyribonucleotide and having two free ends (i.e., the uncircularized version (and its fragments) of the circularized polyribonucleotide).
- the linear counterpart e.g., a pre -circularized version
- the linear counterpart is a polyribonucleotide molecule (and its fragments) having the same or similar nucleotide sequence (e.g., 100%, 95%, 90%, 85%, 80%, 75%, or any percentage therebetween sequence similarity) and same or similar nucleic acid modifications as a circular polyribonucleotide and having two free ends (i.e., the uncircularized version (and its fragments) of the circularized polyribonucleotide).
- the linear counterpart is a polyribonucleotide molecule (and its fragments) having the same or similar nucleotide sequence (e.g., 100%, 95%, 90%, 85%, 80%, 75%, or any percentage therebetween of sequence similarity) and different or no nucleic acid modifications as a circular polyribonucleotide and having two free ends (i.e., the uncircularized version (and its fragments) of the circularized polyribonucleotide).
- a fragment of the polyribonucleotide molecule that is the linear counterpart is any portion of linear counterpart polyribonucleotide molecule that is shorter than the linear counterpart polyribonucleotide molecule.
- the linear counterpart further comprises a 5’ cap. In some embodiments, the linear counterpart further comprises a poly adenosine tail. In some embodiments, the linear counterpart further comprises a 3’ UTR. In some embodiments, the linear counterpart further comprises a 5’ UTR.
- conjugation moiety refers to a modified nucleotide comprising a functional group for use in a method of conjugation.
- the term“carrier” means a compound, composition, reagent, or molecule that facilitates the transport or delivery of a composition (e.g., a circular polyribonucleotide) into a cell by a covalent modification of the circular polyribonucleotide, via a partially or completely encapsulating agent, or a combination thereof.
- a composition e.g., a circular polyribonucleotide
- Non-limiting examples of carriers include carbohydrate carriers (e.g., an anhydride- modified phytoglycogen or glycogen-type material), nanoparticles (e.g., a nanoparticle that encapsulates or is covalently linked binds to the circular polyribonucleotide), liposomes, fusosomes, ex vivo differentiated reticulocytes, exosomes, protein carriers (e.g., a protein covalently linked to the circular polyribonucleotide), or cationic carriers (e.g., a cationic lipopolymer or transfection reagent).
- carbohydrate carriers e.g., an anhydride- modified phytoglycogen or glycogen-type material
- nanoparticles e.g., a nanoparticle that encapsulates or is covalently linked binds to the circular polyribonucleotide
- liposomes e.g., fusosomes, ex vivo differentiated
- naked delivery means a formulation for delivery to a cell without the aid of a carrier and without covalent modification to a moiety that aids in delivery to a cell.
- a naked delivery formulation is free from any transfection reagents, cationic carriers, carbohydrate carriers, nanoparticle carriers, or protein carriers.
- naked delivery formulation of a circular polyribonucleotide is a formulation that comprises a circular polyribonucleotide without covalent modification and is free from a carrier.
- diluent means a vehicle comprising an inactive solvent in which a composition described herein (e.g., a composition comprising a circular polyribonucleotide) may be diluted or dissolved.
- a diluent can be an RNA solubilizing agent, a buffer, an isotonic agent, or a mixture thereof.
- a diluent can be a liquid diluent or a solid diluent.
- Non-limiting examples of liquid diluents include water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3- butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, com, germ, olive, castor, and sesame oils), glycerol, tetrahydrofiirfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and 1,3- butanediol.
- solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3- butylene glycol, dimethylform
- Non -limiting examples of solid diluents include calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, or powdered sugar.
- a measurable change is a shift or change in a phenotype (e.g., cellular phenotype, physical phenotype, molecular phenotype) or any characteristic that informs that a stimulus is working, and includes, for example, a change in cell morphology, an increase or decrease on production of a cell type, an increase or decrease in muscle mass, after exposure to the stimulus.
- a phenotype e.g., cellular phenotype, physical phenotype, molecular phenotype
- any characteristic that informs that a stimulus is working includes, for example, a change in cell morphology, an increase or decrease on production of a cell type, an increase or decrease in muscle mass, after exposure to the stimulus.
- a stimulus is a protein (e.g., erythropoietin expressed from a circular polyribonucleotide) or a circular polyribonucleotide comprising a binding site
- the response or response level is a measurable shift in a phenotype (e.g., increased production or level of reticulocytes in the subject) after exposure to the protein or circular polyribonucleotide comprising a binding site in the subject.
- FIG. 1 shows that after injection into mice, circular RNA was detected at higher levels than linear RNA in livers of mice at 3, 4, and 7 days post-injection.
- FIG. 2A and FIG. 2B show that after injection of circular RNA or linear RNA expressing Gaussia Luciferase into mice, Gaussia Luciferase activity was detected in plasma at 1, 2,7, 11, 16, and 23 days post-dosing of circular RNA, while its activity was only detected in plasma at 1, and 2 days post dosing of modified linear RNA.
- FIG. 3 show that after injection of RNA, circular RNA but not linear RNA, was detected in the liver and spleen at 16 days post-administration of RNA.
- FIG. 4 show that after injection of RNA, linear RNA but not circular RNA, showed
- FIG. 5 shows experimental data demonstrating increased persistence of Gaussia luciferase expression in mice following redosing with a circular polyribonucleotide (“Endless”) as compared to a linear polyribonucleotide counterpart (“Linear”).
- FIG. 6 shows experimental data demonstrating increased persistence of Gaussia luciferase expression in mice following staggered dosing with a circular polyribonucleotide (“Endless 3 doses”) as compared to staggered dosing a linear polyribonucleotide counterpart (“Linear 3 doses”), or a single dose with the circular polyribonucleotide (“Endless”), or a single dose with a linear polyribonucleotide counterpart (“Linear”).
- FIG. 7 shows experimental data demonstrating increased persistence of Gaussia luciferase expression in mice following a single dose of a circular polyribonucleotide (“Endless RNA”) as compared to a single dose of a linear polyribonucleotide counterpart (“Linear RNA”), staggered dosing with a linear polyribonucleotide counterpart (“3 doses Linear RNA”) as compared to a single dose (“Linear RNA”), or staggered dosing with a circular polyribonucleotide (“3 doses Endless RNA”) as compared a single dose (“Endless RNA”).
- Endless RNA a circular polyribonucleotide
- FIG. 8 shows circular polyribonucleotide administered intravenously, with carrier (TransIT) and without carrier (Unformulated), expressed protein in vivo for prolong periods for time, with levels of protein activity in the plasma at multiple days post injection.
- FIG. 9 shows circular polyribonucleotide administered intramuscularly, without a carrier, expressed protein in vivo for prolonged periods of time, with levels of protein activity in the plasma at multiple days post injection.
- FIG. 10 shows circular polyribonucleotide administered intravenously, expressed protein in vivo for prolonged periods of time, with levels of protein activity in the plasma at multiple days post injection and could be redosed at least 5 times.
- FIG. 11 shows circular polyribonucleotide expressed protein in vivo for prolonged periods of time with increased elvels of protein acitivty in the plasma after multiple continuous injections.
- FIG. 12 shows an increased number of reticulocytes was detected in whole blood at 3, 5, 7, 14,
- FIG. 13 shows an increased number of reticulocytes was detected in whole blood at 3, 5, 7, 14,
- FIG. 14 shows an increase in reticulocyte count was detected for circular RNA dosing and mRNA dosing when unformulated compared to the vehicle only control.
- FIG. 15 shows an increase in reticulocyte count was detected for circular RNA dosing and mRNA dosing when TransIT-formulated compared to the vehicle only control.
- FIG. 16 shows a schematic of an exemplary in vitro production process of a circular RNA that contains a start-codon, an ORF (open reading frame) coding for GFP, a stagger element (2A), an encryptogen, and an IRES (internal ribosome entry site).
- ORF open reading frame
- 2A stagger element
- IRES internal ribosome entry site
- FIG. 17 shows a schematic of an exemplary in vivo production process of a circular RNA.
- FIG. 18 shows design of an exemplary circular RNA that comprises a start-codon, an ORF coding for GFP, a stagger element (2A), and an encryptogen.
- FIG. 19A and FIG. 19B are schematics demonstrating in vivo stoichiometric protein expression of two different circular RNAs.
- FIG. 20 is a graph showing qRT-PCR analysis of immune related genes from 293T cells transfected with circular RNA or linear RNA.
- FIG. 21 is a schematic demonstrating in vivo protein expression in mouse model from exemplary circular RNAs.
- FIG. 22 is a schematic demonstrating in vivo biodistribution of an exemplary circular RNA in a mouse model.
- FIG. 23 is a schematic demonstrating in vivo protein expression in mouse model from an exemplary circular RNA that harbors an encryptogen (intron).
- FIG. 24 is a denaturing PAGE gel image demonstrating exemplary circular RNA after an exemplary purification process.
- FIG. 25 is a Western blot image demonstrating expression of Flag protein ( ⁇ 15 kDa) by an exemplary circular RNA that lacks IRES, cap, 5’ and 3’ UTRs.
- This invention relates generally to methods of dosing circular polyribonucleotides.
- the methods of dosing as disclosed herein generally relate to expressing a level of a protein or producing a level of a circular polyribonucleotide in cell after providing at least two compositions of circular
- the circular polyribonucleotide encodes the protein.
- the methods of dosing as disclosed herein also generally relate to binding of a target in a cell cell after providing at least two compositions of circular polyribonucleotides, wherein the circular polyribonucleotide encodes the protein.
- the circular polyribonucleotide is an exogenous, synthetic circular
- the invention relates to a method of expressing a protein in a cell comprising: providing a first composition comprising a circular polyribonucleotide that encodes the protein to the cell, wherein the cell expresses a first level of the protein; and providing a second composition comprising the circular polyribonucleotide to the cell, wherein the cell expresses a second level of the protein and the second level is at least as much as the first level; thereby maintaining expression of the protein in the cell at least at the first level of the protein.
- a method of expressing a protein in a cell comprises: providing a first composition comprising a circular polyribonucleotide that encodes the protein to the cell, wherein the cell expresses a first level of the protein; and providing a second composition comprising the circular polyribonucleotide to the cell, wherein the cell expresses a second level of the protein and the second level varies by no more than 20% of the first level; thereby
- a method of producing a circular polyribonucleotide in a cell comprises: providing a first composition comprising the circular polyribonucleotide to the cell, wherein the cell comprises a first level of the circular polyribonucleotide after providing the first composition; and providing a second composition of the circular polyribonucleotide to the cell, wherein the cell comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide is at least as much as the first level; thereby maintaining the circular polyribonucleotide in the cell at least at the first level.
- a method of producing a circular polyribonucleotide in a cell comprises: providing a first composition comprising the circular polyribonucleotide to the cell, wherein the cell comprises a first level of the circular polyribonucleotide after providing the first composition; and providing a second composition of the circular polyribonucleotides to the cell, wherein the cell comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide varies by no more than 20% of the first level after providing the second composition; thereby maintaining the circular polyribonucleotide in the cell at least at the first level.
- a method of producing a circular polyribonucleotide in a cell comprises: providing a first composition comprising the circular
- the cell comprises a first level of the circular polyribonucleotide after providing the first composition; and providing a second composition of the circular
- providing the second composition occurs after providing the first composition and before the first level of protein expressed by the first composition is substantially undetectable in the cell.
- the invention relates to a method of expressing a level of a protein in a cell after providing a first composition and a second composition of a circular polyribonucleotide to the cell compared to a level of the protein in the cell after providing a first composition and a second composition of a linear counterpart of the circular polyribonucleotide, comprising: providing a first composition of the circular polyribonucleotide encoding the protein to the cell, wherein the cell comprises the level of the protein after providing the first composition of the circular polyribonucleotide; and providing the second composition of the circular polyribonucleotide after the first composition to the cell, wherein the cell comprises at least the level of the protein after providing the second composition of the circular polyribonucleotide; thereby maintaining expression of the level of the protein in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of the protein in the cell after providing the first composition and the
- polyribonucleotide to the cell compared to a level of the protein in the cell after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing a first composition of the circular polyribonucleotide encoding the protein to the cell, wherein the cell comprises the level of the protein after providing the first composition of the circular
- the cell comprises a level of the protein that varies by no more than 20% of the level after providing the second composition of of the circular polyribonucleotide; thereby maintaining expression of the level of the protein in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of the protein in the cell after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- a method of producing a level of a circular polyribonucleotide in a cell after providing a first composition and a second composition of the circular polyribonucleotide to the cell compared to a level of a linear counterpart of the circular polyribonucleotide in the cell after providing a first composition and a second composition of the linear counterpart of the circular polyribonucleotide comprises: providing a first composition of the circular polyribonucleotide to the cell, wherein the cell comprises the level of the circular polyribonucleotide after providing the first composition; and providing the second composition of the circular polyribonucleotide to the cell, wherein the cell comprises at least the level of the circular polyribonucleotide after providing the second composition; thereby maintaining the level of the circular polyribonucleotide in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of the linear counterpart in the cell after providing the first composition and the
- a method of producing a level of a circular polyribonucleotide in a cell after providing a first composition and a second composition of the circular polyribonucleotide to the cell compared to a level of a linear counterpart of the circular polyribonucleotide in the cell after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide comprises: providing a first composition of the circular polyribonucleotide to the cell, wherein the cell comprises a level of the circular polyribonucleotide after providing the first composition; and providing the second composition of the circular polyribonucleotide to to the cell, wherein the cell comprises a level of the protein after providing the second composition that varies by no more than 20% of the level of the circular polyribonucleotide after providing the first composition; thereby maintaining the level of the circular polyribonucleotide in the cell after providing the first composition and the second composition of the circular polyribonucleotide
- providing the second composition of the circular polyribonucleotide occurs after the first composition and after the level of protein in the cell expressed by the first composition is substantially undetectable.
- the circular polyribonucleotides used in the methods described herein may comprise one or more expression sequences. In some embodiments, at least one of the expression sequences encodes a protein.
- the protein may be an intracellular protein, a membrane protein, or a secreted protein.
- the protein may be a therapeutic protein.
- the therapeutic protein may have an activity, for example has antioxidant activity, binding, cargo receptor activity, catalytic activity, molecular carrier activity, molecular function regulator, molecular transducer activity, nutrient reservoir activity, protein tag, structural molecule activity, toxin activity, transcription regulator activity, translation regulator activity, or transporter activity.
- the methods described herein may be therapeutic or veterinary methods for treating a subject.
- the methods described herein may be used to treat a disease in the plurality of cells.
- the methods described herein are used to treat a disease resulting from a non-functional, poorly functional, or poorly expressed protein or gene product.
- the methods described herein are used to treat a genetic disease (e.g., a mutation, a substitution, a deletion, an expansion, or a recombination), a cancer, a neurodegenerative disease, a cardiovascular disease, a pulmonary disease, a renal disease, a liver disease, a genetic disease, a vascular disease, ophthalmic disease, musculoskeletal disease, lymphatic disease, auditory and inner ear disease, a metabolic disease, an inflammatory disease, an autoimmune disease, or an infectious disease.
- a genetic disease e.g., a mutation, a substitution, a deletion, an expansion, or a recombination
- a cancer e.g., a mutation, a substitution, a deletion, an expansion, or a recombination
- a cancer e.g., a mutation, a substitution,
- polyribonucleotide is disclosed herein.
- the composition can comprise a circular polyribonucleotide encoding a protein.
- the composition can comprise a circular polyribonucleotide comprises a binding site.
- a method of dosing can be redosing of a composition of circular polyribonucleotides in two or more doses, generally over an extended period of time.
- a method of dosing can be a staggered dosing of a composition over a short time interval.
- the composition further comprises a pharmaceutically acceptable carrier or excipient.
- the protein from the circular polyribonucleotide can be expressed in a cell.
- the method comprises providing (e.g., administering) at least a first composition and a second composition to the cells or subject (e.g., a mammal, e.g., a human).
- the method further comprises providing (e.g., administering) a third composition, fourth composition, fifth composition, sixth composition, seventh composition, eighth composition, ninth composition, tenth composition, or more.
- additional compositions are provided for the duration of the life of the cell.
- additional compositions are provided (e.g., administered) while the cell or subject obtains a benefit from the composition.
- a plurality of compositions are provided (e.g., administered) in a staggered dosing regimen in which any composition provided (e.g., administered) after a previous composition is provided (e.g., administered) before the level of the protein or the circular polyribonucleotide from the previous composition in the plurality is substantially undetectable in the cell or subject (e.g., a mammal).
- the second composition is provided (e.g., administered) after the first composition is provided (e.g., administered) and before the level of the protein or the circular polyribonucleotide from the first composition in the plurality is substantially undetectable in the cell or subject (e.g., mammal).
- a plurality of compositions are provided in a redosing regimen in which any composition provided (e.g., administered) after a previous composition, is provided (e.g., administered) after the level of the protein or the circular
- the polyribonucleotide from the previous composition in the plurality is substantially undetectable in the cell or subject (e.g., mammal).
- the second composition is provided (e.g., administered) after the first composition is provided (e.g., administered) and after the level of the protein or the circular polyribonucleotide from the first composition in the cell or subject is substantially undetectable in the cell or subject.
- a first composition in a staggered regimen or redosing regimen comprises a first amount of a circular polyribonucleotide.
- a second composition in a staggered regimen or redosing regimen comprises a second amount of a circular polyribonucleotide.
- a third composition, a fourth composition, a fifth composition, a sixth composition, a seventh composition, an eighth composition, a ninth composition, a tenth composition, or more in a staggered regimen or redosing regimen comprises a third, fourth, fifth, sixth, seventh, eighth, ninth, tenth or more amount of a circular polyribonucleotide.
- the second amount of the circular polyribonucleotide is the same as the first amount of the circular polyribonucleotide.
- the third amount of the circular polyribonucleotide is the same as the first amount of the circular polyribonucleotide.
- the fourth, fifth, sixth, seventh, eighth, ninth, tenth, or more amount of the circular polyribonucleotide is the same as the first amount of the circular
- the second amount of the circular polyribonucleotide is less than the first amount of the circular polyribonucleotide.
- the third amount of the circular polyribonucleotide is less than the first amount of the circular polyribonucleotide.
- the fourth, fifth, sixth, seventh, eighth, ninth, tenth, or more amount of the circular polyribonucleotide is less than the first amount of the circular polyribonucleotide.
- the second amount of the circular polyribonucleotide is greater than the first amount of the circular polyribonucleotide.
- the third amount of the circular polyribonucleotide is greater than the first amount of the circular polyribonucleotide. In some embodiments, the fourth, fifth, sixth, seventh, eighth, ninth, tenth, or more amount of the circular polyribonucleotide is greater than the first amount of the circular polyribonucleotide. In some embodiments, an amount of circular
- polyribonucleotide of the second composition varies by no more than 1%, 5%, 10%, 15%, 20%, or 25% of an amount of circular polyribonucleotide of the first composition. In some embodiments, an amount of circular polyribonucleotide of the second composition is no more than 1%, 5%, 10%, 15%, 20%, or 25% less than an amount of circular polyribonucleotide of the first composition. In some embodiments, an amount of circular polyribonucleotide of a second composition is from 0.1-fold to 1000-fold higher than an amount of circular polyribonucleotide of a first composition.
- an amount of circular polyribonucleotide of a second composition is 0.1-fold, 1-fold, 5-fold, 10-fold, 100-fold, or 1000- fold higher than an amount of circular polyribonucleotide of a first composition.
- an amount of circular polyribonucleotide of a subsequent composition e.g., a composition administered after a first composition
- an amount of circular polyribonucleotide of a second composition is from 0.1 -fold to 1000-fold lower than an amount of circular polyribonucleotide of a first composition. In some embodiments, an amount of circular polyribonucleotide of a second composition is 0.1-fold, 1-fold, 5-fold, 10-fold, 100-fold, or 1000-fold lower than an amount of circular polyribonucleotide of a first composition.
- an amount of circular polyribonucleotide of a subsequent composition is 0.1-fold, 1-fold, 5-fold, 10-fold, 100-fold, or 1000-fold lower than an amount of circular polyribonucleotide of a first composition. In some embodiments, an amount of circular polyribonucleotide of a subsequent composition (e.g., after a first composition of an amount of circular polyribonucleotide) is from 0.1 -fold to 1000-fold higher or lower than an amount of circular
- polyribonucleotide of a first composition In some embodiments, an amount of circular
- polyribonucleotide of a subsequent composition is 0.1 -fold, 1-fold, 5 -fold, 10-fold, 100-fold, or 1000-fold higher or lower than an amount of circular polyribonucleotide of a first composition.
- a first composition comprises 1-fold circular polyribonucleotide
- a second composition comprises 5 -fold circular polyribonucleotide compared to the first composition
- a third composition comprises 0.2-fold circular polyribonucleotide compared to the first composition.
- the second composition comprises at least 5- fold circular polyribonucleotide compared to an amount of circular polyribonucleotide of a first composition.
- the first composition comprises a higher amount of the circular polyribonucleotide than the second composition. In some embodiments, the first composition comprises a higher amount of the circular polyribonucleotides than the third, fourth, fifth, sixth, seventh, eighth, ninth, or tenth composition.
- the first composition further comprises a pharmaceutically acceptable carrier or excipient.
- the second composition further comprises a pharmaceutically acceptable carrier or excipient.
- the third composition, fourth composition, fifth composition, sixth composition, seventh composition, eighth composition, ninth composition, tenth composition, or more further comprises a pharmaceutically acceptable carrier or excipient.
- the first composition further comprises a pharmaceutically acceptable excipient and is free of any carrier.
- the second composition further comprises a pharmaceutically acceptable excipient and is free of any carrier.
- the third composition, fourth composition, fifth composition, sixth composition, seventh composition, eighth composition, ninth composition, tenth composition, or more further comprises a pharmaceutically acceptable excipient and is free of any carrier.
- the composition as described herein (e.g., a first composition, a second composition, a third composition, etc.) is delivered to a subject (e.g., a mammal).
- a method of delivering a composition e.g., a first composition, a second composition, a third composition, etc.
- a method of delivering a composition comprises parenterally administering to a subject in need thereof, the composition (e.g., a first composition, a second composition, a third composition, etc.) as described herein to the subject in need thereof.
- a method of delivering a composition comprises administering parenterally the composition to the subject.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- the composition comprises a carrier.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- parenteral administration is intravenously, intramuscularly, ophthalmically, or topically.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- the composition is administered orally.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- composition, a second composition, a third composition, etc. is administered nasally.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- the composition is administered by inhalation.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- the composition is administered topically.
- the composition is administered opthalmically.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- the composition is administered by injection.
- the composition (e.g., a first compositionm a second composition, a third composition, etc.) is administered by infusion.
- the administration can be systemic administration or local administration.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- the composition is administered parenterally.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- the composition e.g., a first composition, a second composition, a third composition, etc.
- the composition is administered via intraocular administration, intracochlear (inner ear) administration, or intratracheal administration.
- any of the methods of delivery as described herein are performed with a carrier. In some embodiments, any methods of delivery as described herein are performed without the aid of a carrier.
- a composition of a circular polyribonucleotide as described herein can induce a response in a subject.
- a method of inducing a response in a subject comprises providing (e.g., administering) a composition that comprises a circular polyribonucleotide comprising a binding site and/or encoding a protein, for inducing a response level in the subject.
- a method of inducing a response comprises providing (e.g., administering) a circular polyribonucleotide encoding erythropoietin to a subject, wherein expression of the erythropoietin from the circular polyribonucleotide in the subject induces production of reticulocytes in the subject.
- a method of inducing a response level in a subject comprises (a) providing (e.g., administering) a first composition comprising a circular polyribonucleotide as described herein that induces the response, and from 14 days to 90 days following step (a), providing (e.g., administering) a second compostion comprising a circular polyribonucleotide as described herein, to the subject, thereby inducing the response level in the subject after providing the first composition and the second composition.
- a composition of a circular polyribonucleotide encodes a therapeutic protein for inducing a response or a response level in a subject after administration.
- a composition of a circular polyribonucleotide encoding erthyropoietin is provided to a subject for inducing production of reticulocytes in the subject.
- a method of inducing reticulocytes in a subject comprises (a) providing (e.g., administering) a first composition comprising a circular polyribonucleotide that encodes erthyropoietin to the subject; and (b) from 6 hours to 90 days after step (a), providing (e.g., administering) a second composition comprising a circular polyribonucleotide that encodes erthyropoietin to the subject, thereby inducing production of reticulocytes in the subject.
- the method comprises providing (e.g., administering) the second composition from 6 hours to 30 days after step (a). In some embodiments, the method comprises providing (e.g., administering) the second composition from 14 days to 90 days after step (a). In some embodiments, the response level from providing a circular polyribonucleotide comprising a binding site or encoding a protein is greater than the response level from a linear counterpart polyribonucleotide.
- a method of inducing a response level in a subject after providing a first composition and a second composition of a circular polyribonucleotide to the subject compared to a response level in the subject after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide encoding a protein that induces a response level, to the subject, wherein the subject comprises a response level after the first composition of the circular polyribonucleotide is provided; and providing (e.g., administering) a second composition of the circular polyribonucleotide encoding a protein after the first composition to the subject, wherein the subject comprises at least the response level after the second composition of the circular polyribonucleotide is provided; thereby maintaining the response level in the subject after the first composition and the second composition of the circular polyribonucleotide are provided (e.
- a method of inducing a level of reticulocyte production in a subject after providing a first composition and a second composition of a circular polyribonucleotide to the subject compared to a level of reticulocyte production in the subject after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide encoding a erthyropoietin to the subject, wherein the subject comprises a level of reticulocyte production after the first composition of the circular polyribonucleotide is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular
- polyribonucleotide encoding erthyropoietin after the first composition to the subject, wherein the subject comprises at least the level of reticulocyte production after the second composition of the circular polyribonucleotide is provided (e.g., administered); thereby maintaining the level of reticulocyte production in the subject after the first composition and the second composition of the circular polyribonucleotide are provided (e.g., administered) compared to the level of reticulocyte production in the subject after the first composition and the second composition of the linear counterpart of the circular polyribonucleotide are provided (e.g., administered).
- a composition of the circular polyribonucleotide as described here (e.g., a first composition, a second composition, a third composition, etc.) used for a method of dosing (e.g., staggered dosing or redosing) comprises no more than 1 ng/ml, 5 ng/ml, 10 ng/ml, 15 ng/ml, 20 ng/ml, 25 ng/ml, 30 ng/ml, 35 ng/ml, 40 ng/ml, 50 ng/ml, 60 ng/ml, 70 ng/ml, 80 ng/ml, 90 ng/ml, 100 ng/ml, 200 ng/ml, 300 ng/ml, 400 ng/ml, 500 ng/ml, 600 ng/ml, 1 pg / ml, 10 pg/ml, 50 pg/ml, 100 pg/ml,
- a composition of the circular polyribonucleotide as described here comprises at least 30% (w/w), 40% (w/w), 50% (w/w), 60% (w/w), 70% (w/w), 80% (w/w), 85% (w/w), 90% (w/w), 91% (w/w), 92% (w/w), 93% (w/w), 94% (w/w), 95% (w/w), 96% (w/w), 97% (w/w), 98% (w/w), or 99% (w/w) circular polyribonucleotide molecules relative to the total ribonucleotide molecules in the composition of circular polyribonucleotides (e.g., a pharmaceutical composition as described herein).
- a method of staggered dosing to produce a level of circular polyribonucleotide, express a level of a protein, or produce a level of binding to a target in a plurality of cells after providing the plurality of cells with at least two compositions of circular polyribonucleotide is disclosed herein.
- polyribonucleotide is disclosed herein.
- the at least two compositions of circular polyribonucleotide are the same compositions.
- the at least two compositions of circular polyribonucleotide are different compositions.
- the same compositions comprise circular polyribonucleotides encoding the same proteins or comprising the same binding sites.
- the different compositions comprise circular polyribonucleotides encoding different proteins or comprising different binding sites, or a combination thereof.
- a method of maintaining expression of a protein in a mammal comprises: (a) providing (e.g., administering) a first composition comprising a circular polyribonucleotide that encodes the protein to the mammal (e.g., a human); and (b) from 6 hours to 90 days following step (a), providing (e.g., administering) a second composition comprising a circular polyribonucleotide that encodes the protein, to the mammal, thereby maintaining expression of the protein in the mammal.
- a method of maintaining expression of an antigen in a mammal comprises: (a) providing (e.g., administering) a first composition comprising a circular polyribonucleotide that encodes the antigen to the mammal; and (b) from 6 hours to 90 days following step (a), providing (e.g., administering) a second composition comprising a circular polyribonucleotide that encodes the antigen, to the mammal, thereby maintaining expression of the protein in the mammal.
- the circular polyribonucleotide is an exogenous, synthetic circular polyribonucleotide. In some embodiments, the circular polyribonucleotide lacks a poly-A sequence, a replication element, or both.
- providing (e.g., administering) the second composition is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, or 90 days, or any time therebetween, after step (a).
- providing (e.g., administering) the second composition is from 6 hours to 45 days, after step (a).
- providing (e.g., administering) the second composition is from 6 hours to 30 days, after step (a).
- providing (e.g., administering) the second composition is from 6 hours to 30 days plus the half-life of the protein encoded by the circular polyribonucleotide, after step (a). In some embodiments, providing (e.g., administering) the second composition is from 14 days to 30 days plus the half-life of the protein encoded by the circular polyribonucleotide, after step (a). In some embodiments, providing (e.g., administering) the second composition is from 14 days to 65 days plus the half-life of the protein encoded by the circular polyribonucleotide, after step (a). In some embodiments, providing (e.g., administering) the second composition is from 21 days to 41 days plus the half-life of the protein encoded by the circular polyribonucleotide, after step (a).
- the first composition comprises a first circular polyribonucleotide and the second compositions comprises a second circular polyribonucleotide, wherein the first circular polyribonucleotide and the second circular polyribonucleotide are the same.
- the first composition comprises a first circular polyribonucleotide and the second compositions comprises a second circular polyribonucleotide, wherein the first circular polyribonucleotide and the second circular polyribonucleotide are different.
- the first composition comprises a first circular polyribonucleotide encoding a first protein and the second compositions comprises a second circular polyribonucleotide encoding a second protein, wherein the first protein and the second protein are the same protein.
- the first composition comprises a first circular polyribonucleotide encoding a first protein and the second compositions comprises a second circular polyribonucleotide encoding a second protein, wherein the first protein and the second protein are different proteins.
- the first composition comprises a first circular polyribonucleotide comprising a first binding site and the second compositions comprises a second circular polyribonucleotide comprising a second binding site, wherein the first binding site and the second binding site are the same binding site.
- the first composition comprises a first circular polyribonucleotide comprising a first binding site and the second compositions comprises a second circular polyribonucleotide comprising a second binding site, wherein the first binding site and the second binding site are different binding sites.
- the first composition comprises a first circular polyribonucleotide encoding a protein and a second circular polyribonucleotide comprising a binding site.
- providing the second composition occurs after providing the first composition and before a first level of protein expressed by the first composition is substantially undetectable in the mammal (e.g., a human).
- providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before a first level of protein expressed by the first composition decreases by more than 50% in the mammal.
- providing(e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before a first level of protein expressed by the first composition is substantially undetectable in the mammal.
- providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before a first level of protein expressed by the first composition decreases 25% to 75% in the mammal.
- the method further comprise providing (e.g., administering) a third composition of the circular polyribonucleotide to the mammal after the second composition, thereby maintaining expression of the protein in the mammal.
- providing (e.g., administering) the third composition occurs after the second composition is provided (e.g., administered) and before a second level of the protein expressed by the first and second composition is substantially undetectable in the mammal.
- providing (e.g., administering) the third composition occurs after the second composition is provided (e.g., administered) and before a second level of the protein expressed by the first and second composition in the mammal decreases by 25% to 75% .
- a method of producing a circular polyribonucleotide in a subject comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a first level of the circular polyribonucleotide after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a second level of the circular
- polyribonucleotide and the second level of circular polyribonucleotide is at least as much as the first level; thereby maintaining the circular polyribonucleotide in the subject (e.g., mammal) at least at the first level.
- a method of producing a circular polyribonucleotide in a subject comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a first level of the circular polyribonucleotide after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotides to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a second level of the circular
- polyribonucleotide and the second level of circular polyribonucleotide varies by no more than 20% of the first level after the second composition is provided (e.g., administered); thereby maintaining the circular polyribonucleotide in the subject (e.g., mammal) at least at the first level.
- a method of producing a circular polyribonucleotide in a subject comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a first level of the circular polyribonucleotide after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotides to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide varies by no more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% of the first level after the second composition is provided (e.g.
- the a first level of the protein is maintained after providing the first composition and the second composition for from 6 hours to 90 days after the first composition is provided. In some embodiments, a first level of the protein is maintained after providing the first composition, the second composition, and the third composition of the circular polyribonucleotide for from 6 hours to 270 days after the first composition is provided. In some embodiments, a first level of the protein is substantially undetectable after the first composition and the second composition are provided for 6 hours to 35 days after the first composition is provided.
- the second composition can be provided after providing the first composition and before the level of circular polyribonucleotide from the first composition in the subject (e.g., mammal) is substantially undetectable in the subject (e.g., mammal).
- providing the second composition occurs after the first composition is provided and before the first level of circular polyribonucleotide produced by the first composition decreases by more than 50% in the subject (e.g., mammal).
- providing the second composition occurs after the first composition is provided and before the first level of circular polyribonucleotide produced by the first composition decreases by 25% to 75% in the subject (e.g., mammal).
- providing the second composition occurs after the first composition is provided and before the first level of circular polyribonucleotide produced by the first composition decreases by more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% in the subject (e.g., mammal).
- a method of producing a circular polyribonucleotide in a mammal comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the mammal, wherein the mammal comprises a first level of the circular polyribonucleotide after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotide to the mammal, wherein the mammal comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide is at least as much as the first level; thereby maintaining the circular
- a method of producing a circular polyribonucleotide in a mammal comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the mammal, wherein the mammal comprises a first level of the circular polyribonucleotide after the first composition is provided; and providing (e.g., administering) a second composition of the circular polyribonucleotides to the mammal, wherein the mammal comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide varies by no more than 20% of the first level after the second composition is provided (e.g., administered); thereby maintaining the circular polyribonucleotide in the mammal at least at the first level.
- a method of producing a circular polyribonucleotide in a mammal comprises: providing (e.g, administering) a first composition comprising the circular polyribonucleotide to the mammal, wherein the mammal comprises a first level of the circular polyribonucleotide after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotides to the mammal, wherein the mammal comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide varies by no more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% of the first level after the second composition is provided (e.g., administered); thereby maintaining the circular polyribonucleotide in the mammal at least at the first level.
- the second composition can be provided after the first composition is provided and before the level of circular polyribonucleotide from the first composition in the mammal is substantially undetectable in the mammal.
- providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before the first level of circular polyribonucleotide produced by the first composition decreases by more than 50% in the mammal.
- providing (e.g., administering) the second composition occurs after the first composition is administered) and before the first level of circular polyribonucleotide produced by the first composition decreases 25% to 75% in the mammal.
- providing (e.g, administering) the second composition occurs after the first composition is provided (e.g., administered) and before the first level of circular polyribonucleotide produced by the first composition decreases by more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% in the mammal.
- a method of expressing a protein in a subject comprises: providing (e.g., administering) a first composition comprising a circular
- polyribonucleotide that encodes the protein to the subject (e.g., mammal), wherein the subject (e.g., mammal) expresses a first level of an encoded protein; and providing (e.g., administering) a second composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) expresses a second level of an encoded protein and the second level is at least as much as the first level; thereby maintaining expression of encoded protein in the subject (e.g., mammal) at least at the first level of encoded protein.
- a method of expressing a protein in a subject comprises: providing (e.g., administering) a first composition comprising a circular polyribonucleotide that encodes the protein to the subject (e.g., mammal), wherein the subject (e.g., mammal) expresses a first level of an encoded protein; and providing (e.g., administering) a second composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) expresses a second level of an encoded protein and the second level is at least as much as the first level; thereby maintaining expression of encoded protein in the subject (e.g., mammal) at a similar level compared to the first level of encoded protein.
- a method of expressing a protein in a subject comprises: providing (e.g., administering) a first composition comprising a circular polyribonucleotide that encodes the protein to the subject (e.g., mammal), wherein the subject (e.g., mammal) expresses a first level of the protein; and providing (e.g., administering) a second composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) expresses a second level of the protein and the second level varies by no more than 20% of the first level; thereby maintaining expression of the protein in the subject (e.g., mammal) at least at the first level of the protein.
- a method of expressing a protein in a subject comprises: providing (e.g., administering) a first composition comprising a circular polyribonucleotide that encodes the protein to the subject (e.g., mammal), wherein the subject (e.g., mammal) expresses a first level of the protein; and providing (e.g., administering) a second composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) expresses a second level of the protein and the second level varies by no more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% of the first level; thereby maintaining expression of the protein in the subject (e.g., mammal) at least at the first level of the protein.
- the second composition can be provided (e.g., administered) after the first composition is provided (e.g., administered) and before the level of protein produced by the first composition is substantially undetectable in the subject (e.g., mammal).
- the second composition is provided (e.g., administered) after the first composition is provided (e.g., administered) and before the first level of protein expressed by the first composition decreases by more than 50% in the subject (e.g., mammal).
- the second composition is provided (e.g., administered) after the first composition is provided (e.g., administered) and before the first level of protein expressed by the first composition decreases by 25% to 75% in the subject (e.g., mammal).
- providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before the first level of protein expressed by the first composition decreases by more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% in the subject (e.g., mammal).
- a method of expressing a protein in a mammal comprises: providing (e.g., administering) a first composition comprising a circular polyribonucleotide that encodes the protein to the mammal, wherein the mammal expresses a first level of the protein; and providing (e.g., administering) a second composition comprising the circular polyribonucleotide to the mammal, wherein the mammal expresses a second level of the protein and the second level is at least as much as the first level; thereby maintaining expression of the protein in the mammal at least at the first level of the protein.
- a method of expressing a protein in a mammal comprises: providing (e.g., administering) a first composition comprising a circular polyribonucleotide that encodes the protein to the mammal, wherein the mammal expresses a first level of the protein; and providing (e.g., administering) a second composition comprising the circular polyribonucleotide to the mammal, wherein the mammal expresses a second level of the protein and the second level varies by no more than 20% of the first level; thereby maintaining expression of the protein in the mammal at least at the first level of the protein.
- a method of expressing a protein in a mammal comprises:
- a first composition comprising a circular polyribonucleotide that encodes the protein to the mammal, wherein the mammal expresses a first level of the protein
- a second composition comprising the circular polyribonucleotide to the mammal, wherein the mammal expresses a second level of the protein and the second level varies by no more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% of the first level; thereby maintaining expression of the protein in the mammal at least at the first level of the protein.
- the second composition can be provided (e.g., administered) after the first composition is provided (e.g., administered) and before the level of protein produced by the first composition is substantially undetectable in the mammal.
- the second composition is provided (e.g., administered) after the first composition is provided (e.g., administered) and before the first level of protein expressed by the first composition decreases by more than 50% in the mammal.
- the second composition is provided (e.g., administered) after the first composition is provided (e.g., administered) and before the first level of protein expressed by the first composition decreases by 25% to 75% in the mammal.
- providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before the first level of protein expressed by the first composition decreases by more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% in the mammal.
- a method of binding a target in a cell comprises: providing a first composition comprising the circular polyribonucleotide to the cell, wherein the cell comprises a first level of binding afterthe first composition is provided; and providing a second composition of the circular polyribonucleotide to the cell, wherein the cell comprises a second level of binding and the second level of binding is at least as much as the first level; thereby maintaining the binding to the target in the cell at least at the first level.
- a method of binding to a target in a cell comprises:
- a first composition comprising the circular polyribonucleotide to the cell, wherein the cell comprises a first level of binding after the first composition is provided; and providing a second composition of the circular polyribonucleotides to the cell, wherein the cell comprises a second level of binding and the second level of binding varies by no more than 20% of the first level after providing the second composition; thereby maintaining the binding of the target in the cell at least at the first level.
- a method of binding to a target in a cell comprises: providing a first composition comprising the circular polyribonucleotide to the cell, wherein the cell comprises a first level of the binding after the first composition is provided; and providing a second composition of the circular polyribonucleotides to the cell, wherein the cell comprises a second level of binding and the second level of binding varies by no more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% of the first level after providing the second composition; thereby maintaining the binding to a target in the cell at least at the first level.
- the second composition can be provided after the first composition is provided and before the level of binding from the first composition in the cell is substantially undetectable in the cell.
- providing the second composition occurs after the first composition is provided and before the first level of binding produced by the first composition decreases by more than 50% in the cell. In some embodiments, providing the second composition occurs afterthe first composition is provided and before the first level of binding produced by the first composition decreases by 25% to 75% in the cell. In some embodiments, providing the second composition occurs afterthe first composition is provided and before the first level of binding produced by the first composition decreases by more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% in the cell. In some embodiments, a method of binding a target in a cell comprises: providing a first composition comprising the circular
- the cell comprises a first level of binding after the first composition is provided; and providing a second composition of the circular polyribonucleotide to the cell, wherein the cell comprises a second level of binding and the second level of binding is at least as much as the first level; thereby maintaining the binding to the target in the cell at least at the first level.
- a method of binding to a target in a cell comprises: providing a first composition comprising the circular polyribonucleotide to the cell, wherein the cell comprises a first level of binding after the first composition is provided; and providing a second composition of the circular polyribonucleotides to the cell, wherein the cell comprises a second level of binding and the second level of binding varies by no more than 20% of the first level after providing the second composition; thereby maintaining the binding of the target in the cell at least at the first level.
- a method of binding to a target in a cell comprises: providing a first composition comprising the circular polyribonucleotide to the cell, wherein the cell comprises a first level of the binding after the first composition is provided; and providing a second composition of the circular polyribonucleotides to the cell, wherein the cell comprises a second level of binding and the second level of binding varies by no more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% of the first level after providing the second composition; thereby maintaining the binding to a target in the cell at least at the first level.
- the second composition can be provided after the first composition is provided and before the level of binding from the first composition in the cell is substantially undetectable in the cell.
- providing the second composition occurs after the first composition is provided and before the first level of binding produced by the first composition decreases by more than 50% in the cell. In some embodiments, providing the second composition occurs after the first composition is provided and before the first level of binding produced by the first composition decreases by 25% to 75% in the cell. In some embodiments, providing the second composition occurs after the first composition is provided and before the first level of binding produced by the first composition decreases by more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% in the cell.
- a method of binding a target in a subject comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a first level of binding after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a second level of binding and the second level of binding is at least as much as the first level; thereby maintaining the binding to the target in the subject (e.g., mammal) at least at the first level.
- a method of binding to a target in a subject comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a first level of binding after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotides to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a second level of binding and the second level of binding varies by no more than 20% of the first level after the second composition is provided (e.g., administered); thereby maintaining the binding of the target in the subject (e.g., mammal) at least at the first level.
- a method of binding to a target in a subject comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a first level of the binding after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotides to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a second level of binding and the second level of binding varies by no more than 1%, 5%,
- the second composition is provided (e.g., administered); thereby maintaining the binding to a target in the subject (e.g., mammal) at least at the first level.
- a target in the subject e.g., mammal
- the second composition can be provided (e.g., administered) after the first composition is provided (e.g., administered) and before the level of binding from the first composition in the subject (e.g., mammal) is substantially undetectable in the subject (e.g., mammal).
- providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before the first level of binding produced by the first composition decreases by more than 50% in the subject (e.g., mammal).
- providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before the first level of binding produced by the first composition decreases by 25% to 75% in the subject (e.g., mammal). In some embodiments, providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before the first level of binding produced by the first composition decreases by more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% in the subject (e.g., mammal).
- a method of binding a target in a subject comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a first level of binding after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a second level of binding and the second level of binding is at least as much as the first level; thereby maintaining the binding to the target in the subject (e.g., mammal) at least at the first level.
- a method of binding to a target in a subject comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a first level of binding after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotides to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a second level of binding and the second level of binding varies by no more than 20% of the first level after the second composition is provided (e.g., administered); thereby maintaining the binding of the target in the subject (e.g., mammal) at least at the first level.
- a method of binding to a target in a subject comprises: providing (e.g., administering) a first composition comprising the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a first level of the binding after the first composition is provided (e.g., administered); and providing (e.g., administering) a second composition of the circular polyribonucleotides to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a second level of binding and the second level of binding varies by no more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% of the first level after the second composition is provided (e.g., administered); thereby maintaining the binding to a target in the subject (e.g., mammal) at least at the first level.
- the second composition can be provided (e.g., administered) after the first composition is provided (e.g., administered) and before the level of binding from the first composition in the subject (e.g., mammal) is substantially undetectable in the subject (e.g., mammal).
- providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before the first level of binding produced by the first composition decreases by more than 50% in the subject (e.g., mammal).
- providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before the first level of binding produced by the first composition decreases by 25% to 75% in the subject (e.g., mammal). In some embodiments, providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and before the first level of binding produced by the first composition decreases by more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% in the subject (e.g., mammal).
- the first composition and second composition in the staggered dosing regimen or method may be followed by one or more additional composition of the circular
- the one or more additional compositions comprise a third, a fourth, a fifth, a sixth, a seventh, an eighth, a ninth, a tenth or more compositions.
- a third composition of the circular polyribonucleotide is provided (e.g., administered) to the cell or subject (e.g., mammal, e.g., a human) after the second composition, thereby maintaining the level of the circular polyribonucleotide, protein, or binding after the third composition is provided at least at the first level.
- the third composition is provided (e.g., administered) after the second composition and before the level of the circular polyribonucleotide, protein, or binding produced by the first and second composition in the cell or subject (e.g., mammal) is substantially undetectable in the cell or subject (e.g., mammal).
- the third composition is provided (e.g., administered) after the first composition is provided (e.g., administered) and before the first level of circular polyribonucleotide produced by, protein expressed by, or binding produced by the first composition decreases by more than 50% in the cell or subject (e.g., mammal). In some embodiments, the third composition is provided (e.g., administered) after the first composition is provided (e.g., administered) and before the first level of circular polyribonucleotide produced by, protein expressed by, or binding produced by the first composition decreases by 25% to 75% in the cell or subject (e.g., mammal).
- the third composition is provided (e.g., administered) after the first composition is provided (e.g., administered) and before the first level of circular polyribonucleotide produced by, protein expressed by, or binding produced by the first composition decreases by more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% in the cell or subject (e.g., mammal).
- the one or more additional compositions can be provided after providing a previous composition and before the level of circular polyribonucleotide, binding, or protein produced by the previous composition(s) is substantially undetectable in the cell or subject (e.g., mammal).
- the one or mroe additional compositions is provided (e.g., administered) after a previous composition is provided (e.g., adminiistered) and before the level of circular polyribonucleotide, binding, or protein produced by the previous composition(s) decreases by more than 50% in the cell or subject (e.g., mammal).
- the one or mroe additional compositions is provided (e.g., administered) after a previous composition is provided (e.g., adminiistered) and before the level of circular polyribonucleotide, binding, or protein produced by the previous composition(s) decreases by more than 50% in the cell or subject (e.g., mammal).
- the one or mroe additional compositions is provided (e.g., administered) after a previous composition is provided (e.g., adminiistered) and before the level of circular polyribonucleotide, binding, or protein produced by the previous composition(s) decreases by more than 50% in the cell or
- the one or mroe additional composition is provided (e.g., administered) after a previous composition is provided (e.g., administered) and before the level of circular polyribonucleotide, binding, or protein produced by the previous composition(s) decreases by 25% to 75% in the cell or subject (e.g., mammal).
- a previous composition e.g., administered
- the level of circular polyribonucleotide, binding, or protein produced by the previous composition(s) decreases by 25% to 75% in the cell or subject (e.g., mammal).
- the one or mroe additional composition e.g., administered
- compositions is provided (e.g., administered) after a previous composition is provided (e.g., administered) and before the level of circular polyribonucleotide, binding, or protein produced by the previous composition(s) decreases by more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% in the cell or subject (e.g., mammal).
- the second composition is administered to or provided to the cell or subject (e.g., mammal) before a level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- the second composition is administered to or provided to the cell or subject (e.g., mammal) before a level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- the third composition of the one or more additional doses is administered to or provided to the cell or subject (e.g., mammal) before the level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- the fourth, the fifth, the sixth, the seventh, the eighth, the ninth, the tenth or more compositions of the one or more additional is administered to or provided to the cell or subject (e.g., mammal) before the level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- the fourth, the fifth, the sixth, the seventh, the eighth, the ninth, the tenth or more compositions of the one or more additional composition is administered to or provided to the cell or subject (e.g., mammal) before the level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- compositions are administered to or provided to the cell or subject (e.g., mammal) before the level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- a composition is administered to or provided to a cell or subject (e.g., mammal) after a time interval following administering or providing a preceding compostion to the cell or subject (e.g., mammal).
- a second composition may be administered to or provided to a cell or subject (e.g., mammal) after a first time interval following administering or providing a first composition to the cell or subject (e.g., mammal);
- a third composition may be administered to or provided to the cell or subject (e.g., mammal) after a second time interval following administering or providing the second composition to the cell or subject (e.g., mammal);
- a fourth composition may be administered to or provided to cell or subject (e.g., mammal) after a third time interval following administering or providing the third composition to the cell or subject (e.g., mammal); or a fifth, sixth, seventh, eighth, ninth, or more composition may be administered to or provided to the cell or subject (e.g., mammal) after a fourth, fifth, sixth, seventh, eighth, ninth, or more time interval following administering or providing the fourth, fifth, sixth, seventh, eighth, ninth, or more composition to the cell or subject (e.g.
- the second time interval is longer than the first time interval.
- the third time interval is longer than the first time interval.
- the fourth time interval is longer than the first time interval.
- the fifth, sixth, seventh, eighth, ninth, or more time interval is longer than the first time interval.
- the second time interval is the same as the first time interval.
- the third time interval is the same as the first time interval.
- the fourth time interval is the same as the first time interval.
- the fifth, sixth, seventh, eighth, ninth, or more time interval is the same as the first time interval.
- the second time interval is shorter than the first time interval.
- the third time interval is shorter than the first time interval. In some embodiments, the fourth time interval is shorter than the first time interval. In some embodiments, the fifth, sixth, seventh, eighth, ninth, or more time interval is shorter than the first time interval. In some embodiments, the second time interval is longer than the first time interval. In some embodiments, the third time interval is longer than the second time interval. In some embodiments, the fourth time interval is longer than the third time interval.
- the first level of the circular polyribonucleotide is the highest level of the circular polyribonucleotide 1-2 days after providing the first composition.
- the highest level of circular polyribonucleotide 1-2 days after providing the first composition for example, the peak amount of circular polyribonucleotide from 24 hours to 48 hours (e.g., 1-2 days) after providing the first composition.
- the first level of the circular polyribonucleotide is 40%, 50%, 60%, 70%, 80%, or 90% of the highest level of the circular polyribonucleotide 1-2 days after providing the first composition.
- the second level of the circular polyribonucleotide is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, or 200% of the highest level of the circular polyribonucleotide 1-2 days after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing the second composition.
- the second level of the circular polyribonucleotide is at least 1-fold, 5-fold, 10-fold, 100-fold, or 1000-fold higher than the highest level of the circular
- the third level of the circular polyribonucleotide is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, or 200% of the highest level of the circular polyribonucleotide 1-2 days after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing the third composition.
- the third level of the circular polyribonucleotide is least 1-fold, 5-fold, 10-fold, 100-fold, or 1000-fold higher than the highest level of the circular polyribonucleotide 1-2 days after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing the third composition.
- a subsequent level of the circular polyribonucleotide expressed after each subsequent composition is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, or 200% of the highest level of the circular polyribonucleotide 1-2 days after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing each subsequent composition.
- a subsequent level of the circular polyribonucleotide expressed after each subsequent composition is at least 1-fold, 5-fold, 10-fold, 100-fold, or 1000-fold higher than the highest level of the circular polyribonucleotide 1-2 days after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8,
- an average level of the circular polyribonucleotide after providing the second composition is at least 40%, 50%, 60%, 70%, 80%, or 90% of the first level, wherein the average level of the circular polyribonucleotide is measured from one day after providing the second composition to the day when the circular polyribonucleotide is substantially undetectable.
- an average level of the circular polyribonucleotide after providing each subsequent composition after the first composition is at least 40%, 50%, 60%, 70%, 80%, or 90% of the first level, wherein the average level of the circular polyribonucleotide is measured from one day after providing each subsequent composition to the day when the circular polyribonucleotide is substantially undetectable.
- the first level of the circular polyribonucleotide is maintained after providing the second composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 35 days. In some embodiments, the first level of the circular polyribonucleotide is maintained after providing the second composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 35 days.
- the first level of the circular polyribonucleotide is maintained after providing the third composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 35 days.
- the second level of circular polyribonucleotide in the cell or subject (e.g., mammal) after providing the second composition is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of circular
- the third level of circular polyribonucleotide in the cell or subject (e.g., mammal) after providing the third composition is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of circular polyribonucleotide in the plurality after providing the first composition.
- the second level of circular polyribonucleotide 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days,
- 30 days, 40 days, or 45 days after providing the second composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the circular polyribonucleotide after providing the first composition.
- the third level of circular polyribonucleotide 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the third composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the circular polyribonucleotide after providing the first composition.
- the first level of the binding is maintained after providing the second composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days,
- the first level of binding is maintained after providing the third composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 35 days.
- the second level of binding in the cell or subject (e.g., mammal) after providing the second composition is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of binding in the cell or subject (e.g., mammal) after providing the first composition.
- the third level of binding in the cell or subject (e.g., mammal) after providing the third composition is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of binding in the plurality after providing the first composition.
- the first level of the protein is the highest level of the protein 1-2 days after providing the first composition.
- the highest level of protein 1-2 days after providing the first composition for example, the peak amount of protein expressed from the circular polyribonucleotide from 24 hours to 48 hours (e.g., 1-2 days) after providing the first composition.
- the first level of the protein is 40%, 50%, 60%, 70%, 80%, or 90% of the highest level of the protein 1-2 days after providing the first composition.
- the second level of the protein is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, or 200% of the highest level of the protein 1-2 days after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing the second composition.
- the second level of the protein is at least 1-fold, 5-fold, 10-fold, 100-fold, or 1000- fold higher than the highest level of the protein 1-2 days after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing the second composition.
- the third level of the protein is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%,
- the third level of the protein is at least 1-fold, 5 -fold, 10-fold, 100-fold, or 1000-fold higher than the highest level of the protein 1-2 days after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing the third composition.
- a subsequent level of the protein expressed after each subsequent composition is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, or 200% of the highest level of the protein 1-2 days after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing each subsequent composition.
- a subsequent level of the protein expressed after each subsequent composition is at least 1-fold, 5-fold, 10-fold, 100-fold, or 1000-fold higher than the highest level of the protein 1-2 days after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing each subsequent composition.
- an average level of the protein after providing the second composition is at least 40%, 50%, 60%, 70%, 80%, or 90% of the first level, wherein the average level of the protein is measured from one day after providing the second composition to the day when the protein is substantially undetectable.
- an average level of the protein after providing each subsequent composition after the first composition is at least 40%, 50%, 60%, 70%, 80%, or 90% of the first level, wherein the average level of the protein is measured from one day after providing each subsequent composition to the day when the protein is substantially undetectable.
- the first level of the protein is maintained after providing the first composition and the second composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 35 days after the first composition is provided. In some embodiments, the first level of the protein is maintained after providing the first composition, second composition, and third composition of the circular polyribonucleotide for at least 6 hours, 1 day, 2 days, 3 days, 5 days, 7 days, 14 days, 21 days, 28 days, or 35 days after the first composition is provided.
- the second level of protein in the cell or subject (e.g., mammal) after providing the second composition is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of protein in the cell or subject (e.g., mammal) after the first composition is provided.
- the third level of protein in the cell or subject (e.g., mammal) after providing the third composition is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of protein in the plurality after the first composition is provided.
- the second level of protein 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the second composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the protein after the first composition is provided.
- the third level of protein 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the third composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the protein after the first composition is provided.
- the level of the protein of the first composition is maintained after providing the second composition of the circular polyribonucleotide for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days.
- the level of the protein of the first composition is maintained after providing the third composition of the circular polyribonucleotide for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days.
- the level of the protein of the first composition is maintained after providing the fourth composition, fifth composition, sixth composition, seventh composition, eighth composition, nine composition, tenth composition or more of the circular polyribonucleotide for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days.
- the level of the protein that is maintained is the level of the protein in cell or subject (e.g., mammal) at day 1 after the first composition is provided.
- the level of the circular polyribonucleotide in the cell or subject (e.g., mammal) after the first composition is maintained after providing the second composition of the circular polyribonucleotide for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days.
- the level of the circular polyribonucleotide in the cell or subject (e.g., mammal) after the first composition is maintained after providing the third composition of the circular
- polyribonucleotide for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days.
- the level of the circular polyribonucleotide in the cell or subject (e.g., mammal) after the first composition is maintained after providing the fourth composition, fifth composition, sixth composition, seventh composition, eighth composition, nine composition, tenth composition or more of the circular polyribonucleotide for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days.
- the level of protein in the cell or subject (e.g., mammal) after providing the second composition of the circular polyribonucleotide is from 1% to 5%, from 5% to 10%, from 10% to 15%, from 15% to 20%, from 20% to 25%, from 25% to 30%, from 30% to 35%, from 35% to 40%, from 40% to 45%, from 45% to 50%, from 50% to 55%, from 55% to 60%, from 60% to 65%, from 65% to 70%, from 70% to 75%, from 75% to 80%, from 80% to 85%, from 85% to 90%, from 90% to 92%, from 92% to 94%, from 94% to 95%, from 95% to 96%, from 96% to 97%, from 97% to 98%, from 98% to 99%, from 10% to 30%, from 10% to 40%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 40% to 50%, from 40% to 60%, from 40% to 40% to
- the level of circular polyribonucleotide in cell or subject (e.g., mammal) after providing the second composition of the circular polyribonucleotide is from 1% to 5%, from 5% to 10%, from 10% to 15%, from 15% to 20%, from 20% to 25%, from 25% to 30%, from 30% to 35%, from 35% to 40%, from 40% to 45%, from 45% to 50%, from 50% to 55%, from 55% to 60%, from 60% to 65%, from 65% to 70%, from 70% to 75%, from 75% to 80%, from 80% to 85%, from 85% to 90%, from 90% to 92%, from 92% to 94%, from 94% to 95%, from 95% to 96%, from 96% to 97%, from 97% to 98%, from 98% to 99%, from 10% to 30%, from 10% to 40%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 40% to 50%, from 40% to 60%,
- polyribonucleotide is disclosed herein.
- polyribonucleotide a level of binding, or express protein in a subject (e.g., a mammal, e.g., a human) after providing the cell with at least two compositions of circular polyribonucleotide is disclosed herein.
- the at least two compositions of circular polyribonucleotide are the same compositions. In some embodiments, the at least two compositions of circular polyribonucleotide are different compositions. In some embodiments, the same compositions comprise circular
- the different compositions comprise circular polyribonucleotides encoding different proteins or comprising different binding sites.
- the first composition comprises a first circular polyribonucleotide encoding a first protein and the second compositions comprises a second circular polyribonucleotide encoding a second protein, wherein the first protein and the second protein are the same protein.
- the first composition comprises a first circular polyribonucleotide encoding a first protein and the second compositions comprises a second circular polyribonucleotide encoding a second protein, wherein the first protein and the second protein are the same protein.
- the first composition comprises a first circular polyribonucleotide encoding a first protein and the second compositions comprises a second circular polyribonucleotide encoding a second protein, wherein the first protein and the second protein are the same protein.
- the first composition comprises a first circular polyribonucleotide encoding a first protein and the second compositions comprises a
- the polyribonucleotide encoding a first protein and the second compositions comprises a second circular polyribonucleotide encoding a second protein, wherein the first protein and the second protein are different proteins.
- the first composition comprises a first circular
- the polyribonucleotide comprising a first binding site and the second compositions comprises a second circular polyribonucleotide comprising a second binding site, wherein the first binding site and the second binding site are the same binding site.
- the first composition comprises a first circular polyribonucleotide comprising a first binding site and the second compositions comprises a second circular polyribonucleotide comprising a second binding site, wherein the first binding site and the second binding site are different binding sites.
- the first composition comprises a first circular polyribonucleotide encoding a protein and the second compositions comprises a second circular polyribonucleotide comprising a binding site.
- a method of maintaining expression of a protein in a mammal comprises: (a) providing (e.g., administering) a first composition comprising a circular polyribonucleotide that encodes the protein to the mammal; and (b) from 6 hours to 90 days following step (a), providing (e.g., administering) a second composition comprising a circular polyribonucleotide that encodes the protein, to the mammal, thereby maintaining expression of the protein in the mammal.
- providing (e.g., administering) the second composition occurs after the first composition is provided (e.g., administered) and after the first level of the protein expressed by the first composition is substantially undectable in the mammal.
- the method further comprises providing (e.g., administering) a third composition of the circular polyribonucleotide to the mammal after the second composition, thereby restoring the protein in the mammal.
- a method of maintaining expression of an antigen in a mammal comprises: (a) providing (e.g., administering) a first composition comprising a circular polyribonucleotide that encodes the antigen to the mammal; and (b) from 6 hours to 90 days following step (a), providing (e.g., administering) a second composition comprising a circular polyribonucleotide that encodes the antigen, to the mammal, thereby maintaining expression of the protein in the mammal.
- providing (e.g., administering) the second composition is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, or 90 days, any time therebetween, after step (a).
- providing (e.g., administering) the second composition is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50, 55, 60,
- providing (e.g., administering) the second composition is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
- providing (e.g., administering) the second composition is from 6 hours to 45 days, after step (a). In some embodiments, providing (e.g., administering) the second composition is from 6 hours to 30 days, after step (a). In some embodiments, providing (e.g., administering) the second composition is from 6 hours to 65 days, after step (a). In some embodiments, providing (e.g., administering) the second composition is from 30 days to 45 days, after step (a). In some embodiments, providing (e.g., administering) the second composition is from 14 days to 30 days, after step (a).
- providing (e.g., administering) the second composition is from 14 days to 45 days, after step (a). In some embodiments, providing (e.g., administering) the second composition is from 30 days to 65 days, after step (a). In some embodiments, providing (e.g, administering) the second composition is from 30 days to 90 days, after step (a).
- the a first level of the protein is maintained after providing (e.g., administering) the first composition and the second composition for from 6 hours to 90 days after the first composition is provided (e.g., administered). In some embodiments, a first level of the protein is maintained after providing (e.g., administering) the first composition, the second composition, and the third composition of the circular polyribonucleotide for from 6 hours to 270 days after the first composition is provided (e.g., administered). In some embodiments, a first level of the protein is substantially undetectable after providing (e.g., administering) the first composition and the second composition for 6 hours to 35 days after the first composition is provided (e.g., administered).
- a method of expressing a level of a protein in a cell after providing a first composition and a second composition of a circular polyribonucleotide to a cell compared to a level of the protein in a cell after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing a first composition of a circular polyribonucleotide encoding a protein to a cell, wherein the cell comprises a level of the protein after the first composition of the circular polyribonucleotide is provided; and providing a second composition of circular
- the cell comprises at least the level of the protein after the second composition of the circular polyribonucleotide is provided; thereby maintaining expression of the level of the protein in the cell after the first composition and the second composition of the circular polyribonucleotide are provided compared to the level of the protein in the cell after the first composition and the second composition of a linear counterpart of the circular polyribonucleotide are provided.
- a method of expressing a level of a protein in a cell after a first composition and a second composition of circular polyribonucleotide are provided to a cell compared to a level of the protein in a cell after a first composition and second composition of a linear counterpart of the circular polyribonucleotide are provided comprises: providing a first composition of circular polyribonucleotide encoding a protein to a cell, wherein the cell comprises a level of the protein after the first composition of circular polyribonucleotide is provided; and providing the second composition of circular polyribonucleotide after the first composition to a cell, wherein the cell comprises a level of the protein that varies by no more than 20% of the level after the second composition of circular polyribonucleotide is provided; thereby maintaining expression of the level of protein in a cell after the first composition is provided and the second composition of circular polyribonucleotide compared to a level of the protein in a cell after the
- a method of expressing a level of a protein in a subject (e.g., mammal) after providing a first composition and a second composition of a circular polyribonucleotide to the subject (e.g., mammal) compared to a level of the protein in the subject (e.g., mammal) after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing (e.g., administering) a first composition of circular polyribonucleotide encoding a protein to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a level of the protein after the first composition of the circular polyribonucleotide is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular polyribonucleotide after the first composition to the subject (e.g., mammal), wherein
- a method of expressing a level of a protein in a subject (e.g., mammal) after providing a first composition and a second composition of a circular polyribonucleotide to the subject (e.g., mammal) compared to a level of the protein in the subject (e.g., mammal) after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide encoding the protein to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a level of the protein after the first composition of the circular polyribonucleotide is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular polyribonucleotide after the first composition to the subject (e.g., mammal), wherein the subject (e.g., administer
- a method of expressing a level of a protein in a cell after providing a first composition and a second composition of a circular polyribonucleotide to the cell compared to a level of the protein in the cell after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing a first composition of the circular polyribonucleotide
- polyribonucleotide encoding the protein to the cell, wherein the cell comprises the level of the protein after the first composition of the circular polyribonucleotide is provided; and providing the second composition of the circular polyribonucleotide after the first composition to the cell, wherein the cell comprises a level of the protein that varies by no more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% of the level after the second composition of the circular polyribonucleotide is provided; thereby maintaining expression of the level of the protein in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of the protein in the cell after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- a method of expressing a level of a protein in a subject (e.g., mammal) after providing a first composition and a second composition of a circular polyribonucleotide to the subject (e.g., mammal) compared to a level of the protein in the subject (e.g., mammal) after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide encoding the protein to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a level of the protein after the first composition of the circular polyribonucleotide is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular polyribonucleotide after the first composition to the subject (e.g., mammal), wherein
- the second composition can be provided after providing the first composition and after the level of protein produced by the first composition is substantially undetectable in the cell or subject (e.g., mammal).
- the second composition is provided to the cell or subject (e.g., mammal) at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks,
- the second composition is provided to the cell or subject (e.g., mammal) from 1 minute to 20 years, or any time therebetween, after the level of protein in the cell or subject (e.g., mammal) produced by the first composition is substantially undetectable. In some embodiments, the second composition is provided to the cell or subject (e.g., mammal) at least 1 minute,
- the second composition is provided to the cell or subject (e.g., mammal) from from 1 minute to 20 years, or any time therebetween.
- the cell or subject e.g., mammal
- a method of producing a level of a circular polyribonucleotide in a cell after providing a first composition and a second composition of the circular polyribonucleotide to the cell compared to a level of a linear counterpart of the circular polyribonucleotide in the cell after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide comprises: providing a first composition of the circular polyribonucleotide to the cell, wherein the cell comprises the level of the circular polyribonucleotide after providing the first composition; and providing the second composition of the circular polyribonucleotide to the cell, wherein the cell comprises at least the level of the circular polyribonucleotide after providing the second composition; thereby maintaining the level of the circular polyribonucleotide in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of the linear counterpart in the cell after providing the first
- a method of producing a level of a circular polyribonucleotide in a cell after providing a first composition and a second composition of the circular polyribonucleotide to the cell compared to a level of a linear counterpart of the circular polyribonucleotide in the cell after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide comprises: providing a first composition of the circular polyribonucleotide to the cell, wherein the cell comprises a level of the circular polyribonucleotide after the first composition is provided; and providing the second composition of the circular polyribonucleotide to the cell, wherein the cell comprises a level of the protein after providing the second composition that varies by no more than 20% of the level of the circular polyribonucleotide; thereby maintaining the level of the circular polyribonucleotide in the cell after the first composition and the second composition of the circular polyribonucleotide are provided compared to the
- a method of producing a level of a circular polyribonucleotide in a subject after providing a first composition and a second composition of the circular
- polyribonucleotide to the subject compared to a level of a linear counterpart of the circular polyribonucleotide in the subject (e.g., mammal) after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide, comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a level of the circular polyribonucleotide after the first composition is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises at least the level of the circular polyribonucleotide after the second composition is provided (e.g., administered); thereby maintaining the level of the circular poly
- a method of producing a level of a circular polyribonucleotide in a subject (e.g., mammal) after providing a first composition and a second composition of the circular polyribonucleotide to the subject (e.g., mammal) compared to a level of a linear counterpart of the circular polyribonucleotide in the subject (e.g., mammal) after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide to the subject (e.g., mammal, e.g., a human), wherein the subject (e.g., mammal) comprises a level of the circular polyribonucleotide after the first composition is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular polyribonucleotide to the subject
- a method of producing a level of a circular polyribonucleotide in a cell after providing a first composition and a second composition of the circular polyribonucleotide to the cell compared to a level of a linear counterpart of the circular polyribonucleotide in the cell after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide comprises: providing a first composition of the circular polyribonucleotide to the cell, wherein the cell comprises a level of the circular polyribonucleotide after the first composition is provided; and providing the second composition of the circular polyribonucleotide to the cell, wherein the cell comprises a level of the protein after the second composition is provided that varies by no more than 1%, 5%, 15%, 20%,
- a method of producing a level of a circular polyribonucleotide in a subject after providing a first composition and a second composition of the circular polyribonucleotide to the subject (e.g., mammal) compared to a level of a linear counterpart of the circular polyribonucleotide in the subject (e.g., mammal) after providing a first composition and second composition of the linear counterpart of the circular polyribonucleotide, comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises a level of the circular polyribonucleotide after the first composition is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular polyribonucleot
- polyribonucleotide compared to the level of the linear counterpart in the subject (e.g., mammal) after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- the circular polyribonucleotide is an exogenous, synthetic circular polyribonucleotide. In some embodiments, the circular polyribonucleotide lacks a poly-A sequence, a replication element, or both.
- the first composition comprises a first circular polyribonucleotide and the second compositions comprises a second circular polyribonucleotide, wherein the first circular polyribonucleotide and the second circular polyribonucleotide are the same.
- the first composition comprises a first circular polyribonucleotide and the second compositions comprises a second circular polyribonucleotide, wherein the first circular polyribonucleotide and the second circular polyribonucleotide are different.
- the second composition can be provided after providing the first composition and before the level of circular polyribonucleotide in the cell or subject (e.g., mammal, e.g., a human) from the first composition is substantially undetectable in the cell or subject (e.g., mammal, e.g., a human).
- the cell or subject e.g., mammal, e.g., a human
- the second composition is provided (e.g., administered) to the cell or subject (e.g., mammal, e.g., a human) at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 10 months, or 1 year after the level of the circular polyribonucleotide in the cell or subject (e.g., mammal) produced by the first composition is substantially undetectable.
- the cell or subject e.g., mammal, e.g., a human
- the second composition is provided (e.g., administered) to the cell or subject (e.g., mammal, e.g., a human) from 1 minute to 20 years, or any time therebetween, after the level of circular polyribonucleotide in the cell or subject (e.g., mammal) produced by the first composition is substantially undetectable.
- the second composition is provided to the cell or subject (e.g., mammal, e.g., a human) at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks,
- the second composition is provided (e.g., administered) to the cell or subject (e.g., mammal, eg., a human) from from 1 minute to 20 years, or any time therebetween.
- the cell or subject e.g., mammal, eg., a human
- a method binding a target in a cell after providing a first composition and a second composition of a circular polyribonucleotide to the cell compared to a level of binding in the cell after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing a first composition of the circular polyribonucleotide encoding the protein to the cell, wherein the cell comprises the level of binding after providing the first composition of the circular polyribonucleotide; and providing the second composition of the circular
- the cell comprises at least the level of binding after providing the second composition of the circular polyribonucleotide; thereby maintaining expression of the level of binding in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of binding in the cell after providing the first composition and the second composition of the linear counterpart of the circular
- a method of binding to a target in a cell after providing a first composition and a second composition of a circular polyribonucleotide to the cell compared to a level of the protein in the cell after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing a first composition of the circular polyribonucleotide
- polyribonucleotide encoding the protein to the cell, wherein the cell comprises the level of the protein after providing the first composition of the circular polyribonucleotide; and providing the second composition of the circular polyribonucleotide after the first composition to the cell, wherein the cell comprises a level of binding that varies by no more than 20% of the level after providing the second composition of the circular polyribonucleotide; thereby maintaining the level of binding in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of the protein in the cell after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- a method binding a target in a subject (e.g., mammal, e.g., a human) after providing a first composition and a second composition of a circular polyribonucleotide to the subject (e.g., mammal) compared to a level of binding in the subject (e.g., mammal) after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide encoding the protein to the subject (e.g., mammal, e.g., a human), wherein the subject (e.g., mammal) comprises a level of binding after the first composition of the circular polyribonucleotide is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular polyribonucleotide after the first composition to the subject
- a method of binding to a target in a subject (e.g., mammal) after providing a first composition and a second composition of a circular polyribonucleotide to the subject (e.g., mammal) compared to a level of the protein in the subject (e.g., mammal) after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide encoding the protein to the subject (e.g., mammal, e.g., human), wherein the subject (e.g., mammal) comprises a level of the protein after the first composition of the circular polyribonucleotide is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular polyribonucleotide after the first composition to the subject (e.g., mammal), wherein
- a method for producing a level of binding in a cell after providing a first composition and a second composition of a circular polyribonucleotide to the cell compared to a level of binding in the cell after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing a first composition of the circular polyribonucleotide
- polyribonucleotide comprising a binding site to the cell, wherein the cell comprises alevel of binding after the first composition of the circular polyribonucleotide is provided; and providing the second composition of the circular polyribonucleotide after the first composition to the cell, wherein the cell comprises a level of binding that varies by no more than 1%, 5%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% of the level after the second composition of the circular polyribonucleotide is provided; thereby maintaining expression of the level of binding in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of binding in the cell after providing the first composition and the second composition of the linear counterpart of the circular
- a method binding a target in a subject (e.g., mammal, e.g., human) after providing a first composition and a second composition of a circular polyribonucleotide to the subject (e.g., mammal) compared to a level of binding in the subject (e.g., mammal) after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide encoding the protein to the subject (e.g., mammal, e.g., a human), wherein the subject (e.g., mammal) comprises a level of binding after the first composition of the circular polyribonucleotide is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular polyribonucleotide after the first composition to the subject (e
- a method of binding to a target in a subject (e.g., mammal) after providing a first composition and a second composition of a circular polyribonucleotide to the subject (e.g., mammal) compared to a level of the protein in the subject (e.g., mammal) after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprises: providing (e.g., administering) a first composition of the circular polyribonucleotide encoding the protein to the subject (e.g., mammal), wherein the subject (e.g., mammal) comprises alevel of the protein after the first composition of the circular polyribonucleotide is provided (e.g., administered); and providing (e.g., administering) the second composition of the circular polyribonucleotide after the first composition to the subject (e.g., mammal), wherein the subject (e.g., administering) the second
- the second composition can be provided after providing the first composition and after the level of protein produced by the first composition is substantially undetectable in the cell or subject (e.g., mammal).
- the second composition is provided (e.g., administered) to the cell or subject (e.g., mammal, e.g., a human) at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 10 months, or 1 year after the level of binding in the cell or subject (e.g., mammal) produced by the first composition is substantially undetectable.
- the second composition is provided (e.g., administered) to the cell or subject (e.g., mammal, e.g. a human) from 1 minute to 20 years, or any time therebetween, after the level of binding in the cell or subject (e.g., mammal) produced by the first composition is substantially undetectable.
- the cell or subject e.g., mammal, e.g. a human
- the second composition is provided (e.g., administered) to the cell or subject (e.g., mammal, e.g., a human) at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 10 months, or 1 year after the first composition and less than 20 years, 15 years, or 10 years after the first composition.
- the second composition is provided (e.g., administered) to the cell or subject (e.g., mammal, e.g., a human) from 1 minute to 20 years, or any time therebetween.
- the first composition and second composition in the redosing regimen or method may be followed by one or more additional compositions of the circular polyribonucleotide.
- the one or more additional compositions comprise a third, a fourth, a fifth, a sixth, a seventh, an eighth, a ninth, a tenth or more compositions.
- the one or more additional compositions can be provided after providing a previous composition and after the level of circular polyribonucleotide, binding or protein produced by the previous composition(s) is substantially undetectable in the plurality of cells (e.g., in a subject).
- the one or more additional compositions is provided to the plurality at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months,
- the one or more additional compositions can be provided after providing a previous composition.
- the one or more additional compositions is provided to cell or subject (e.g., a mammal) at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 10 months, or 1 year after providing the previous composition(s).
- the one or more additional compositions is provided to cell or subject (e.g., a mammal) from 1 minute to 20 years after providing the previous composition(s). In some embodiments, the one or more additional compositions is provided to cell or subject (e.g., a mammal) at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 10 months, or 1 year, but no more than 20 years, 15 years, or 10 years after providing the previous composition(s).
- the second composition is administered to or provided to the cell or subject (e.g., mammal, e.g., a human) after a level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- the second composition is provided to the cell or subject (e.g., mammal) at least 1 minute,
- the third composition of the one or more additional compositions is administered to or provided to the cell or subject (e.g., mammal) after the level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- the third composition of the one or more additional compositions is administered to or provided to the cell or subject (e.g., mammal) at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 10 months, or 1 year after a level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- a level of the protein in the cell or subject e.g., mammal
- the fourth, the fifth, the sixth, the seventh, the eighth, the ninth, the tenth or more compositions of the one or more additional compositions are administered to or provided to the cell or subject (e.g., mammal) after the level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- the cell or subject e.g., mammal
- the level of the protein in the cell or subject e.g., mammal
- the fourth, the fifth, the sixth, the seventh, the eighth, the ninth, the tenth or more compositions of the one or more additional compositions are administered to or provided to the cell or subject (e.g., mammal) at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 10 months, or 1 year after a level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- the cell or subject e.g., mammal
- compositions as described above are administered or provided to the cell or subject (e.g., mammal) from 1 minute to 20 years after a level of the protein in the cell or subject (e.g., mammal) returns to about the level of the protein before administering or providing the first composition.
- a level of the protein in the cell or subject e.g., mammal
- the second composition is administered to or provided to the cell after providing the first composition.
- the second composition is provided to the cellat least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks,
- the third composition of the one or more additional compositions is administered to or provided to the cell after providing the first composition. In some embodiments, the third composition of the one or more additional compositions is administered to or provided to the cell at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, 10 months, or 1 year after providing the first composition.
- the fourth, the fifth, the sixth, the seventh, the eighth, the ninth, the tenth or more compositions of the one or more additional compositions are administered to or provided to the cell after providing the first composition. In some embodiments, the fourth, the fifth, the sixth, the seventh, the eighth, the ninth, the tenth or more compositions of the one or more additional composition sare administered to or provided to the cell at least 1 minute, 1 hour, 1 day, 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks,
- compositions as described above are administered or provided to the cell or subject (e.g., mammal) from 1 minute to 20 years after providing the first composition.
- a composition is administered to or provided to a cell or subject (e.g., mammal) after a time interval following administering or providing a preceding composition to the cell or subject (e.g., mammal).
- a second composition may be administered to or provided to a cell or subject (e.g., mammal) after a first time interval following administering or providing a first composition to the cell or subject (e.g., mammal);
- a third composition may be administered to or provided to the cell or subject (e.g., mammal) after a second time interval following administering or providing the second composition to the cell or subject (e.g., mammal);
- a fourth composition may be administered to or provided to the cell or subject (e.g., mammal) after a third time interval following administering or providing the third composition to the cell or subject (e.g., mammal); or a fifth, sixth, seventh, eighth, ninth, or more composition may be administered to or provided to the cell
- the second time interval is longer than the first time interval.
- the third time interval is longer than the first time interval.
- the fourth time interval is longer than the first time interval.
- the fifth, sixth, seventh, eighth, ninth, or more time interval is longer than the first time interval.
- the second time interval is the same as the first time interval.
- the third time interval is the same as the first time interval.
- the fourth time interval is the same as the first time interval.
- the fifth, sixth, seventh, eighth, ninth, or more time interval is the same as the first time interval.
- the second time interval is shorter than the first time interval.
- the third time interval is shorter than the first time interval. In some embodiments, the fourth time interval is shorter than the first time interval. In some embodiments, the fifth, sixth, seventh, eighth, ninth, or more time interval is shorter than the first time interval. In some embodiments, the second time interval is longer than the first time interval. In some embodiments, the third time interval is longer than the second time interval. In some embodiments, the fourth time interval is longer than the third time interval.
- the level of the protein in the cell or subject (e.g., mammal) after providing the first composition and the second composition of the circular polyribonucleotide is maintained for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days.
- the level of the protein in the cell or subject (e.g., mammal) after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of the protein in the cell or subject (e.g., mammal) after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- the level of the protein in the cell or subject (e.g., mammal) after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of the protein in the cell or subject (e.g., mammal) after providing the first composition and the second composition of the linear counterpart of the circular for at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the second composition of the circular polyribonucleotide.
- the level of the circular polyribonucleotide in the cell or subject after providing the first composition and the second composition of the circular
- polyribonucleotide is maintained for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days.
- the level of the circular polyribonucleotide in the cell or subject after providing the first composition and the second composition of the circular
- polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of the linear counterpart of the circular polyribonucleotide in the cell or subject (e.g., mammal) after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- the level of the circular polyribonucleotide in the plurality after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of the linear counterpart of the circular
- the level of binding in the cell or subject (e.g., mammal) after providing the first composition and the second composition of the circular polyribonucleotide is maintained for at least 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, or 30 days.
- the level of binding in the cell or subject (e.g., mammal) after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of binding in the cell or subject (e.g., mammal) after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- the level of the circular polyribonucleotide in the plurality after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of binding in the plurality after providing the first composition and the second composition of the linear counterpart of the circular for at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the second composition of the circular polyribonucleotide.
- the circular polyribonucleotides described herein and compositions or pharmaceutical compositions thereof may be used in therapeutic and veterinary methods of dosing to produce a level of circular polyribonucleotide, a level of binding to a target, or a level of protein in a plurality of cells after providing the plurality with at least two doses of circular polyribonucleotide.
- the circular polyribonucleotide is non-immunogenic in a mammal, e.g., a human.
- the circular polyribonucleotide is capable of replicating or replicates in a cell from an aquaculture animal (fish, crabs, shrimp, oysters etc.), a mammalian cell, e.g., a cell from a pet or zoo animal (cats, dogs, lizards, birds, lions, tigers and bears etc.), a cell from a farm or working animal (horses, cows, pigs, chickens etc.), a human cell, cultured cells, primary cells or cell lines, stem cells, progenitor cells, differentiated cells, germ cells, cancer cells (e.g., tumorigenic, metastic), non-tumorigenic cells (normal cells), fetal cells, embryonic cells, adult cells, mitotic cells, non-mitotic cells, or any combination thereof.
- an aquaculture animal fish, crabs, shrimp, oysters etc.
- a mammalian cell e.g., a cell from a pet or zoo animal (cats, dogs
- the invention includes a cell comprising the circular polyribonucleotide described herein, wherein the cell is a cell from an aquaculture animal (fish, crabs, shrimp, oysters etc.), a mammalian cell, e.g., a cell from a pet or zoo animal (cats, dogs, lizards, birds, lions, tigers and bears etc.), a cell from a farm or working animal (horses, cows, pigs, chickens etc.), a human cell, a cultured cell, a primary cell or a cell line, a stem cell, a progenitor cell, a differentiated cell, a germ cell, a cancer cell (e.g., tumorigenic, metastic), a non-tumorigenic cell (normal cells), a fetal cell, an embryonic cell, an adult cell, a mitotic cell, a non-mitotic cell, or any combination thereof.
- the cell is modified to comprise the
- the circular polyribonucleotide includes sequences for expression products.
- the circular polyribonucleotide comprises a binding site for binding to a target.
- the circular polyribonucleotide is provided to a plurality of cells via any of the dosing, staggered dosing, or redosing methods described herein.
- the circular polyribonucleotide as described herein induces a response or response level in a subject.
- polyribonucleotide are expressed in one or more of cells in the plurality of cells.
- the circular polyribonucleotide has a half-life of at least that of a linear counterpart, e.g., linear expression sequence, or linear circular polyribonucleotide. In some embodiments, the circular polyribonucleotide has a half-life that is increased over that of a linear counterpart. In some embodiments, the half-life is greater by about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, or greater.
- the circular polyribonucleotide has a half-life or persistence in a cell for at least about 1 hr to about 30 days, or at least about 2 hrs, 6 hrs, 12 hrs, 18 hrs, 24 hrs, 2 days, 3, days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days, 28 days, 29 days, 30 days, 60 days, or longer or any time therebetween.
- the circular polyribonucleotide has a half-life or persistence in a cell for no more than about 10 mins to about 7 days, or no more than about 1 hr, 2 hrs, 3 hrs, 4 hrs, 5 hrs, 6 hrs, 7 hrs, 8 hrs, 9 hrs, 10 hrs, 11 hrs, 12 hrs, 13 hrs, 14 hrs, 15 hrs, 16 hrs, 17 hrs, 18 hrs, 19 hrs, 20 hrs, 21 hrs, 22 hrs, 24 hrs, 36 hrs, 48 hrs, 60 hrs, 72 hrs, 4 days, 5 days, 6 days, 7 days, or any time therebetween.
- the circular polyribonucleotide has a half-life or persistence in a cell while the cell is dividing. In some embodiments, the circular polyribonucleotide has a half-life or persistence in a cell post division. In certain embodiments,
- the circular polyribonucleotide has a half-life or persistence in a dividing cell for greater than about 10 minutes to about 30 days, or at least about 1 hr, 2 hrs, 3 hrs, 4 hrs, 5 hrs, 6 hrs, 7 hrs, 8 hrs,
- the circular polyribonucleotide modulates a cellular function, e.g., transiently or long term.
- the cellular function is stably altered, such as a modulation that persists for at least about 1 hr to about 30 days, or at least about 2 hrs, 6 hrs, 12 hrs, 18 hrs, 24 hrs, 2 days, 3, days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days,
- the cellular function is transiently altered, e.g., such as a modulation that persists for no more than about 30 mins to about 7 days, or no more than about 1 hr, 2 hrs, 3 hrs, 4 hrs, 5 hrs, 6 hrs, 7 hrs, 8 hrs, 9 hrs, 10 hrs, 11 hrs, 12 hrs, 13 hrs, 14 hrs, 15 hrs, 16 hrs, 17 hrs, 18 hrs, 19 hrs, 20 hrs,
- the circular polyribonucleotide is at least about 20 nucleotides, at least about 30 nucleotides, at least about 40 nucleotides, at least about 50 nucleotides, at least about 75 nucleotides, at least about 100 nucleotides, at least about 200 nucleotides, at least about 300 nucleotides, at least about 400 nucleotides, at least about 500 nucleotides, at least about 1,000 nucleotides, at least about 2,000 nucleotides, at least about 5,000 nucleotides, at least about 6,000 nucleotides, at least about 7,000 nucleotides, at least about 8,000 nucleotides, at least about 9,000 nucleotides, at least about 10,000 nucleotides, at least about 12,000 nucleotides, at least about 14,000 nucleotides, at least about 15,000 nucleotides, at least about 16,000 nucleotides, at least about 17,000
- the circular polyribonucleotide may be of a sufficient size to accommodate a binding site for a ribosome.
- the maximum size of a circular polyribonucleotide can be as large as is within the technical constraints of producing a circular polyribonucleotide, and/or using the circular polyribonucleotide. While not being bound by theory, it is possible that multiple segments of RNA may be produced from DNA and their 5' and 3' free ends annealed to produce a "string" of RNA, which ultimately may be circularized when only one 5' and one 3' free end remains. In some
- the maximum size of a circular polyribonucleotide may be limited by the ability of packaging and delivering the RNA to a target. In some embodiments, the size of a circular polyribonucleotide
- polyribonucleotide is a length sufficient to encode useful polypeptides, and thus, lengths of at least 20,000 nucleotides, at least 15,000 nucleotides, at least 10,000 nucleotides, at least 7,500 nucleotides, or at least 5,000 nucleotides, at least 4,000 nucleotides, at least 3,000 nucleotides, at least 2,000 nucleotides, at least 1,000 nucleotides, at least 500 nucleotides, at least 400 nucleotides, at least 300 nucleotides, at least 200 nucleotides, or at least 100 nucleotides may be useful.
- the circular polyribonucleotide comprises one or more expression sequences and is configured for persistent expression in a cell of a subject in vivo.
- the circular polyribonucleotide is configured such that expression of the one or more expression sequences in the cell at a later time point is equal to or higher than an earlier time point.
- the expression of the one or more expression sequences can be either maintained at a relatively stable level or can increase overtime.
- the expression of the expression sequences can be relatively stable for an extended period of time.
- the expression of the one or more expression sequences in the cell over a time period of at least 7, 8, 9, 10, 12, 14, 16, 18, 20, 22, 23 or more days does not decrease by 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, or 5%.
- the expression of the one or more expression sequences in the cell is maintained at a level that does not vary by more than 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, or 5% for at least 7, 8, 9, 10, 12, 14, 16, 18, 20, 22, 23 or more days.
- dosing methods that produce a level of protein from an expression sequence in a cell after providing the cell with at least two compositions of circular polyribonucleotide wherein the circular polyribonucleotide encode the protein.
- the circular polyribonucleotide comprises at least one expression sequence that encodes a peptide or polypeptide.
- peptide may include, but is not limited to, small peptide, peptidomimetic (e.g., peptoid), amino acids, and amino acid analogs.
- the peptide may be linear or branched.
- Such peptide may have a molecular weight less than about 5,000 grams per mole, a molecular weight less than about 2,000 grams per mole, a molecular weight less than about 1,000 grams per mole, a molecular weight less than about 500 grams per mole, and salts, esters, and other pharmaceutically acceptable forms of such compounds.
- peptide may include, but is not limited to, a neurotransmitter, a hormone, a drug, a toxin, a viral or microbial particle, a synthetic molecule, and agonists or antagonists thereof.
- the polypeptide may be linear or branched.
- the polypeptide may have a length from about 5 to about 40,000 amino acids, about 15 to about 35,000 amino acids, about 20 to about 30,000 amino acids, about 25 to about 25,000 amino acids, about 50 to about 20,000 amino acids, about 100 to about 15,000 amino acids, about 200 to about 10,000 amino acids, about 500 to about 5,000 amino acids, about 1,000 to about 2,500 amino acids, or any range therebetween.
- the polypeptide has a length of less than about 40,000 amino acids, less than about 35,000 amino acids, less than about 30,000 amino acids, less than about 25,000 amino acids, less than about 20,000 amino acids, less than about 15,000 amino acids, less than about 10,000 amino acids, less than about 9,000 amino acids, less than about 8,000 amino acids, less than about 7,000 amino acids, less than about 6,000 amino acids, less than about 5,000 amino acids, less than about 4,000 amino acids, less than about 3,000 amino acids, less than about 2,500 amino acids, less than about 2,000 amino acids, less than about 1,500 amino acids, less than about 1,000 amino acids, less than about 900 amino acids, less than about 800 amino acids, less than about 700 amino acids, less than about 600 amino acids, less than about 500 amino acids, less than about 400 amino acids, less than about 300 amino acids, or less may be useful.
- a peptide or polypeptide include, but are not limited to, fluorescent tag or marker, antigen, peptide therapeutic, synthetic or analog peptide from naturally-bioactive peptide, agonist or antagonist peptide, anti-microbial peptide, pore-forming peptide, a bicyclic peptide, a targeting or cytotoxic peptide, a degradation or self-destruction peptide, and degradation or self-destruction peptides.
- Peptides useful in the invention described herein also include antigen-binding peptides, e.g., antigen binding antibody or antibody-like fragments, such as single chain antibodies, nanobodies (see, e.g., Steeland et al. 2016. Nanobodies as therapeutics: big opportunities for small antibodies. Drug Discov Today: 21(7): 1076-113).
- antigen binding peptides may bind a cytosolic antigen, a nuclear antigen, an intra-organellar antigen.
- the circular polyribonucleotide comprises one or more RNA expression sequences, each of which may encode a polypeptide.
- the polypeptide may be produced in substantial amounts.
- the polypeptide may be any proteinaceous molecule that can be produced.
- a polypeptide can be a polypeptide that can be secreted from a cell, or localized to the cytoplasm, nucleus or membrane compartment of a cell.
- polypeptides include, but are not limited to, at least a portion of a viral envelope protein, metabolic regulatory enzymes (e.g., that regulate lipid or steroid production), an antigen, a toleragen, a cytokine, a toxin, enzymes whose absence is associated with a disease, and polypeptides that are not active in an animal until cleaved (e.g., in the gut of an animal), and a hormone.
- the circular polyribonucleotide includes an expression sequence encoding a protein e.g., a therapeutic protein.
- the expression product of the expression sequence is a protein, e.g., a therapeutic protein.
- therapeutic proteins that can be expressed from the circular polyribonucleotide disclosed herein have antioxidant activity, binding, cargo receptor activity, catalytic activity, molecular carrier activity, molecular function regulator, molecular transducer activity, nutrient reservoir activity, protein tag, structural molecule activity, toxin activity, transcription regulator activity, translation regulator activity, or transporter activity.
- therapeutic proteins may include, but are not limited to, an enzyme replacement protein, a protein for supplementation, a protein vaccination, antigens (e.g. tumor antigens, viral, bacterial), hormones, cytokines, antibodies, immunotherapy (e.g.
- cellular reprogramming/transdifferentiation factor e.g., influences susceptibility to an immune response/signal
- immune effector e.g., influences susceptibility to an immune response/signal
- a regulated death effector protein e.g., an inducer of apoptosis or necrosis
- a non-lytic inhibitor of a tumor e.g., an inhibitor of an oncoprotein
- an epigenetic modifying agent epigenetic enzyme, a transcription factor, a DNA or protein modification enzyme, a DNA-intercalating agent, an efflux pump inhibitor, a nuclear receptor activator or inhibitor, a proteasome inhibitor, a competitive inhibitor for an enzyme, a protein synthesis effector or inhibitor, a nuclease, a protein fragment or domain, a ligand or a receptor, and a CRISPR system or component thereof.
- the therapeutic protein is an antigen.
- an antigen is a tumor antigen, a bacterial antigen, or a viral antigen.
- exemplary proteins that can be expressed from the circular polyribonucleotide disclosed herein include human proteins, for instance, receptor binding protein, hormone, growth factor, growth factor receptor modulator, and regenerative protein (e.g., proteins implicated in proliferation and differentiation, e.g., therapeutic protein, for wound healing).
- exemplary proteins that can be expressed from the circular polyribonucleotide disclosed herein include EGF (epithelial growth factor).
- exemplary proteins that can be expressed from the circular polyribonucleotide disclosed herein include enzymes, for instance, oxidoreductase enzymes, metabolic enzymes, mitochondrial enzymes, oxygenases, dehydrogenases, ATP-independent enzyme, and desaturases.
- exemplary proteins that can be expressed from the circular polyribonucleotide disclosed herein include an intracellular protein or cytosolic protein.
- the circular polyribonucleotide expresses a phenylalanine hydroxylase.
- the circular polyribonucleotide expresses a NanoLuc® luciferase (nLuc).
- exemplary proteins that can be expressed from the circular polyribonucleotide include enzymes, for instance, oxidoreductase enzymes, metabolic enzymes, mitochondrial enzymes, oxygenases, dehydrogenases, ATP-independent enzyme, and desaturases.
- exemplary proteins that can be expressed from the circular polyribonucleotide disclosed herein
- polyribonucleotide disclosed herein include a secreted protein, for instance, a secretary enzyme.
- the circular polyribonucleotide expresses an erythropoietin.
- the circular polyribonucleotide expresses a secretary protein that can have a short half-life therapeutic in the blood, or can be a protein with a subcellular localization signal, or protein with secretory signal peptide.
- the circular polyribonucleotide expresses a Gaussia Luciferase (gLuc).
- exemplary proteins that can be expressed from the circular polyribonucleotide disclosed herein include a membrane protein, or a transmembrane protein.
- the circular polyribonucleotide expresses a transmembrane receptor, e.g., a G-protein-coupled receptor (GPCR), a receptor tyrosine kinase (RTK), an antigen receptor, or a chimeric antigen receptor.
- GPCR G-protein-coupled receptor
- RTK receptor tyrosine kinase
- the circular polyribonucleotide expresses a non-human protein, for instance, a fluorescent protein, an energy- transfer acceptor, or a protein-tag like Flag, Myc, or His.
- exemplary proteins that can be expressed from the circular polyribonucleotide include a GFP.
- the circular polyribonucleotide expresses tagged proteins, .e.g., fusion proteins or engineered proteins containing a protein tag, e.g., chitin binding protein (CBP), maltose binding protein (MBP), Fc tag, glutathione-S- transferase (GST), AviTag (GLNDIFEAQKIEWHE), Calmodulin-tag
- tagged proteins e.g., fusion proteins or engineered proteins containing a protein tag, e.g., chitin binding protein (CBP), maltose binding protein (MBP), Fc tag, glutathione-S- transferase (GST), AviTag (GLNDIFEAQKIEWHE), Calmodulin-tag
- MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP Softag 1 ( SLAELLNAGLGGS) ; Softag 3 (TQDPSRVG); Spot-tag (PDRVRAVSHWSS); Strep-tag (Strep-tag II: WSHPQFEK); TC tag (CCPGCC); Ty tag (EVHTN QDPLD) ; V5 tag (GKPIPNPLLGLD ST) ; VSV-tag (YTDIEMNRLGK) ; or Xpress tag (DLYDDDDK).
- the circular polyribonucleotide expresses an antibody, e.g., an antibody fragment, or a portion thereof. In some embodiments, the antibody expressed by the circular polyribonucleotide
- polyribonucleotide can be of any isotype, such as IgA, IgD, IgE, IgG, IgM.
- the circular polyribonucleotide expresses a portion of an antibody, such as a light chain, a heavy chain, a Fc fragment, a CDR (complementary determining region), a Fv fragment, or a Fab fragment, a further portion thereof.
- the circular polyribonucleotide expresses one or more portions of an antibody.
- the circular polyribonucleotide can comprise more than one expression sequence, each of which expresses a portion of an antibody, and the sum of which can constitute the antibody.
- the circular polyribonucleotide comprises one expression sequence coding for the heavy chain of an antibody, and another expression sequence coding for the light chain of the antibody.
- the light chain and heavy chain can be subject to appropriate modification, folding, or other post-translation modification to form a functional antibody.
- dosing methods that produce a level of protein in a cell after providing the cell with at least two compositions of circular polyribonucleotide wherein the circular polyribonucleotide encode the protein.
- a protein can be an intracellular protein, a membrane protein, or a secreted protein.
- a protein can be a polypeptide that can be secreted from a cell, or localized to the cytoplasm, nucleus or membrane compartment of a cell.
- a protein can include, but is not limited to, at least a portion of a viral envelope protein, metabolic regulatory enzymes (e.g., that regulate lipid or steroid production), an antigen, a toleragen, a cytokine, a toxin, enzymes whose absence is associated with a disease, and polypeptides that are not active in an animal until cleaved (e.g., in the gut of an animal), and a hormone.
- the protein is a therapeutic protein.
- the therapeutic protein can have antioxidant activity, binding, cargo receptor activity, catalytic activity, molecular carrier activity, molecular function regulator, molecular transducer activity, nutrient reservoir activity, protein tag, structural molecule activity, toxin activity, transcription regulator activity, translation regulator activity, or transporter activity.
- Some examples of therapeutic proteins may include, but are not limited to, an enzyme replacement protein, a protein for supplementation, a protein vaccination, antigens (e.g. tumor antigens, viral, bacterial), hormones, cytokines, antibodies, immunotherapy (e.g.
- cellular reprogramming/transdifferentiation factor e.g., influences susceptibility to an immune response/signal
- immune effector e.g., influences susceptibility to an immune response/signal
- a regulated death effector protein e.g., an inducer of apoptosis or necrosis
- a non-lytic inhibitor of a tumor e.g., an inhibitor of an oncoprotein
- an epigenetic modifying agent epigenetic enzyme, a transcription factor, a DNA or protein modification enzyme, a DNA-intercalating agent, an efflux pump inhibitor, a nuclear receptor activator or inhibitor, a proteasome inhibitor, a competitive inhibitor for an enzyme, a protein synthesis effector or inhibitor, a nuclease, a protein fragment or domain, a ligand or a receptor, and a CRISPR system or component thereof.
- the therapeutic protein is Human Factor VIII, Human Factor IX, REP1, adenosine deaminase, human NGF, nuclear-encoded ND4, SECRA2a, SUMOl, VEGF, PDE6A, p53, PBFD, ARSA, ABCD1, APOE4, RPGR, DCLREIC, VEGF 165, PDGF- B, gamma-sarcoglycan, dystrophin, LAMP2B, CNGB3, Retinitis Pigmentosa GTPase Regulator, or CLN6.
- the protein includes human proteins, for instance, receptor binding protein, hormone, growth factor, growth factor receptor modulator, and regenerative protein (e.g., proteins implicated in proliferation and differentiation, e.g., therapeutic protein, for wound healing).
- the protein is EGF (epithelial growth factor).
- an exemplary protein is an enzyme, for instance, oxidoreductase enzyme, metabolic enzyme, mitochondrial enzyme, oxygenase, dehydrogenase, ATP -independent enzyme, and desaturase.
- exemplary proteins disclosed herein include an intracellular protein or cytosolic protein.
- exemplary proteins include a secretory protein, for instance, a secretory enzyme.
- a secretory protein can have a short half-life therapeutic in the blood, or can be a protein with a subcellular localization signal, or protein with secretory signal peptide.
- the protein is a non-human protein, for instance, a fluorescent protein, an energy-transfer acceptor, or a protein-tag like Flag, Myc, or His.
- the protein is a tagged protein, .e.g., fusion protein or engineered protein containing a protein tag, e.g., chitin binding protein (CBP), maltose binding protein (MBP), Fc tag, glutathione-S-transferase (GST), AviTag (GFNDIFEAQKIEWHE), Calmodulin-tag
- CBP chitin binding protein
- MBP maltose binding protein
- Fc tag Fc tag
- GST glutathione-S-transferase
- GST glutathione-S-transferase
- GST glutathione-S-transferase
- GST glutathione-S-transferase
- GST glutathione-S-transferase
- GST glutathione-S-transferase
- GST glutathione-S-transferase
- GST glutathione-S-transferase
- GST glut
- MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP Softag 1 ( SLAELLNAGLGGS) ; Softag 3 (TQDPSRVG); Spot-tag (PDRVRAVSHWSS); Strep-tag (Strep-tag II: WSHPQFEK); TC tag (CCPGCC); Ty tag (EVHTN QDPLD) ; V5 tag (GKPIPNPLLGLD ST) ; VSV-tag (YTDIEMNRLGK) ; or Xpress tag (DLYDDDDK).
- protein is an antibody, e.g., an antibody fragment, or a portion thereof.
- the antibody can be of any isotype, such as IgA, IgD, IgE, IgG, IgM.
- the protein is a portion of an antibody, such as a light chain, a heavy chain, a Fc fragment, a CDR (complementary determining region), a Fv fragment, or a Fab fragment, a further portion thereof.
- protein is one or more portions of an antibody.
- the circular polyribonucleotide can comprise more than one expression sequence, each of which expresses a portion of an antibody, and the sum of which can constitute the antibody.
- the circular polyribonucleotide comprises one expression sequence coding for the heavy chain of an antibody, and another expression sequence coding for the light chain of the antibody.
- the light chain and heavy chain can be subject to appropriate modification, folding, or other post-translation modification to form a functional antibody.
- the present invention includes a method for protein expression, comprising translating at least a region of the circular polyribonucleotide provided herein.
- Protein expression may occur in one or more cells, for example a cell after providing a first composition, a second composition, a third composition, a fourth composition, a fifth composition, a sixth composition, a seventh composition, an eighth composition, a ninth composition, or a tenth compositionto the cell.
- the methods for protein expression comprises translation of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% of the total length of the circular polyribonucleotide into polypeptides.
- the methods for protein expression comprises translation of the circular polyribonucleotide into polypeptides of at least 5 amino acids, at least 10 amino acids, at least 15 amino acids, at least 20 amino acids, at least 50 amino acids, at least 100 amino acids, at least 150 amino acids, at least 200 amino acids, at least 250 amino acids, at least 300 amino acids, at least 400 amino acids, at least 500 amino acids, at least 600 amino acids, at least 700 amino acids, at least 800 amino acids, at least 900 amino acids, or at least 1000 amino acids.
- the methods for protein expression comprises translation of the circular polyribonucleotide into polypeptides of about 5 amino acids, about 10 amino acids, about 15 amino acids, about 20 amino acids, about 50 amino acids, about 100 amino acids, about 150 amino acids, about 200 amino acids, about 250 amino acids, about 300 amino acids, about 400 amino acids, about 500 amino acids, about 600 amino acids, about 700 amino acids, about 800 amino acids, about 900 amino acids, or about 1000 amino acids.
- the methods comprise translation of the circular polyribonucleotide into continuous polypeptides as provided herein, discrete polypeptides as provided herein, or both.
- the translation of the at least a region of the circular polyribonucleotide takes place in vitro, such as rabbit reticulocyte lysate. In some embodiments, the translation of the at least a region of the circular polyribonucleotide takes place in vivo, for instance, after transfection of a eukaryotic cell, or transformation of a prokaryotic cell such as a bacteria. In some embodiments, the translation takes place in one or more cells, for example after providing a composition of the circular polyribonucleotide to a cell.
- the present disclosure provides methods of in vivo expression of one or more expression sequences in a subject, comprising: administering a circular polyribonucleotide to a cell of the subject wherein the circular polyribonucleotide comprises the one or more expression sequences; and expressing the one or more expression sequences from the circular polyribonucleotide in the cell.
- the circular polyribonucleotide is configured such that expression of the one or more expression sequences in the cell at a later time point is equal to or higher than an earlier time point.
- the circular polyribonucleotide expresses of the one or more expression sequences in the cell over a time period of at least 7, 8, 9, 10, 12, 14, 16, 18, 20, 22, 23 or more days does not decrease by greater than about 40%. In some embodiments, the circular polyribonucleotide expresses of the one or more expression sequences in the cell is maintained at a level that does not vary by more than about 40% for at least 7, 8, 9, 10, 12, 14, 16, 18, 20, 22, 23 or more days. In some embodiments, the administration of the circular polyribonucleotide is conducted using any delivery method described herein. In some embodiments, the circular polyribonucleotide is administered to the subject via intravenous injection.
- the administration of the circular polyribonucleotide includes, but is not limited to, prenatal administration, neonatal administration, postnatal administration, oral, by injection (e.g., intravenous, intraarterial, intraperotoneal, intradermal, intracranial, intrathecal, intralymphatic, subcutaneous and intramuscular), by ophthalmic administration, by intracochlear (inner ear) administration, by intranasal administration, by intratracheal administration, and through inhaled admsintration.
- injection e.g., intravenous, intraarterial, intraperotoneal, intradermal, intracranial, intrathecal, intralymphatic, subcutaneous and intramuscular
- ophthalmic administration e.g., intravenous, intraarterial, intraperotoneal, intradermal, intracranial, intrathecal, intralymphatic, subcutaneous and intramuscular
- intracochlear inner ear
- intranasal administration by intratracheal administration
- the methods for protein expression comprise modification, folding, or other post-translation modification of the translation product.
- the methods for protein expression comprise post-translation modification in vivo or in a cell, e.g., via cellular machinery.
- the circular polyribonucleotide encodes at least one binding site.
- the at least one binding site can bind a target, such as protein, RNA, or DNA.
- the at least one binding site be a protein binding site, an RNA binding site, or a DNA binding site.
- the at least one binding site confers at least one therapeutice characteristic to the cell.
- the at least one binding site confers nucleic acid (e.g., the circular polyribonucleotide as described herein) localization to a cell.
- the at least one binding site confers nucleic acid activity (e.g., is a miRNA binding site that results in nucleic acid degradation in cells comprising the miRNA) to the cell comprising the circular polyribonucleotide.
- the at least one binding site binds to a cell receptor on a surface of a cell.
- a circular polyribonucleotide is internalized into the cell as described herein when the at least one binding site binds to a cell receptor on the surface of the cell.
- the at least binding site hybridizes to a linear polynucleotide that aids in
- the linear polynucleotide comprises a region that hybridizes to the at least one binding site of the circular polyribonucleotide and a region that binds to a cell receptor on the surface of the cell.
- the region of the linear polyribonucleotide that binds to the cell receptor results in internalization of the linear
- a circRNA comprises a binding site.
- a binding site can comprise an aptamer.
- a circRNA comprises at least two binding sites.
- a circRNA can comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more binding sites.
- circRNA described herein is a molecular scaffold that binds one or more targets, or one or more binding moieties of one or more targets.
- Each target may be, but is not limited to, a different or the same nucleic acids (e.g., RNAs, DNAs, RNA-DNA hybrids), small molecules (e.g. , drugs), aptamers, polypeptides, proteins, lipids, carbohydrates, antibodies, viruses, virus particles, membranes, multi- component complexes, cells, cellular moieties, any fragments thereof, and any combination thereof.
- the one or more binding sites binds to the same target.
- the one or more binding sites bind to one or more binding moieties of the same target.
- the one or more binding sites bind to one or more different targets. In some embodiments, the one or more binding sites bind to one or more binding moieties of different targets. In some embodiments, a circRNA acts as a scaffold for one or more binding one or more targets. In some embodiments, a circRNA acts as a scaffold for one or more binding moieties of one or more targets. In some embodiments, a circRNA modulates cellular processes by specifically binding to one or more one or more targets. In some embodiments, a circRNA modulates cellular processes by specifically binding to one or more binding moieties of one or more targets. In some embodiments, a circRNA modulates cellular processes by specifically binding to one or more targets.
- a circRNA described herein includes binding sites for one or more specific targets of interest. In some embodiments, circRNA includes multiple binding sites or a combination of binding sites for each target of interest. In some embodiments, circRNA includes multiple binding sites or a combination of binding sites for each binding moiety of interest. For example, a circRNA can include one or more binding sites for a polypeptide target. In some embodiments, a circRNA includes one or more binding sites for a polynucleotide target, such as a DNA or RNA, an mRNA target, an rRNA target, a tRNA target, or a genomic DNA target.
- a circRNA comprises a binding site for a single-stranded DNA. In some instances, a circRNA comprises a binding site for double-stranded DNA. In some instances, a circRNA comprises a binding site for an antibody. In some instances, a circRNA comprises a binding site for a virus particle. In some instances, a circRNA comprises a binding site for a small molecule. In some instances, a circRNA comprises a binding site that binds in or on a cell. In some instances, a circRNA comprises a binding site for a RNA-DNA hybrid. In some instances, a circRNA comprises a binding site for a methylated polynucleotide.
- a circRNA comprises a binding site for an unmethylated polynucleotide. In some instances, a circRNA comprises a binding site for an aptamer. In some instances, a circRNA comprises a binding site for a polypeptide. In some instances, a circRNA comprises a binding site for a polypeptide, a protein, a protein fragment, a tagged protein, an antibody, an antibody fragment, a small molecule, a virus particle (e.g., a virus particle comprising a transmembrane protein), or a cell. In some instances, a circRNA comprises a binding site for a binding moiety on a single-stranded DNA.
- a circRNA comprises a binding site for a binding moiety on a double-stranded DNA. In some instances, a circRNA comprises a binding site for a binding moiety on an antibody. In some instances, a circRNA comprises a binding site for a binding moiety on a virus particle. In some instances, a circRNA comprises a binding site for a binding moiety on a small molecule. In some instances, a circRNA comprises a binding site for a binding moiety in or on a cell. In some instances, a circRNA comprises a binding site for a binding moiety on a RNA-DNA hybrid.
- a circRNA comprises a binding site for a binding moiety on a methylated polynucleotide. In some instances, a circRNA comprises a binding site for a binding moiety on an unmethylated polynucleotide. In some instances, a circRNA comprises a binding site for a binding moiety on an aptamer. In some instances, a circRNA comprises a binding site for a binding moiety on a polypeptide.
- a circRNA comprises a binding site for a binding moiety on a polypeptide, a protein, a protein fragment, a tagged protein, an antibody, an antibody fragment, a small molecule, a virus particle (e.g., a virus particle comprising a transmembrane protein), or a cell.
- a virus particle e.g., a virus particle comprising a transmembrane protein
- a binding site binds to a portion of a target comprising at least two amide bonds. In some instances, a binding site does not bind to a portion of a target comprising a phosphodiester linkage. In some instances, a portion of the target is not DNA or RNA. In some instances, a binding moiety comprises at least two amide bonds. In some instances, a binding moiety does not comprise a phosphodiester linkage. In some instances, a binding moiety is not DNA or RNA.
- the circRNAs provided herein can include one or more binding sites for binding moieties on a complex.
- the circRNAs provided herein can include one or more binding sites for targets to form a complex.
- the circRNAs provided herein can act as a scaffold to form a complex between a circRNA and a target.
- a circRNA forms a complex with a single target.
- a circRNA forms a complex with two targets.
- a circRNA forms a complex with three targets.
- a circRNA forms a complex with four targets.
- a circRNA forms a complex with five or more targets.
- a circRNA forms a complex with a complex of two or more targets. In some embodiments, a circRNA forms a complex with a complex of three or more targets. In some embodiments, two or more circRNAs form a complex with a single target. In some embodiments, two or more circRNAs form a complex with two or more targets. In some embodiments, a first circRNA forms a complex with a first binding moiety of a first target and a second different binding moiety of a second target. In some embodiments, a first circRNA forms a complex with a first binding moiety of a first target and a second circRNA forms a complex with a second binding moiety of a second target.
- a circRNA can include a binding site for one or more antibody- polypeptide complexes, polypeptide -polypeptide complexes, polypeptide-DNA complexes, polypeptide- RNA complexes, polypeptide-aptamer complexes, virus particle-antibody complexes, virus particle- polypeptide complexes, virus particle-DNA complexes, virus particle-RNA complexes, virus particle- aptamer complexes, cell-antibody complexes, cell-polypeptide complexes, cell-DNA complexes, cell- RNA complexes, cell-aptamer complexes, small molecule-polypeptide complexes, small molecule-DNA complexes, small molecule-aptamer complexes, small molecule-cell complexes, small molecule-virus particle complexes, and combinations thereof.
- a circRNA can include a binding site for one or more binding moieties on one or more antibody-polypeptide complexes, polypeptide -polypeptide complexes, polypeptide-DNA complexes, polypeptide-RNA complexes, polypeptide-aptamer complexes, virus particle -antibody complexes, virus particle-polypeptide complexes, virus particle-DNA complexes, virus particle-RNA complexes, virus particle-aptamer complexes, cell-antibody complexes, cell-polypeptide complexes, cell- DNA complexes, cell-RNA complexes, cell-aptamer complexes, small molecule-polypeptide complexes, small molecule-DNA complexes, small molecule-aptamer complexes, small molecule-cell complexes, small molecule-virus particle complexes, and combinations thereof.
- a binding site binds to a polypeptide, protein, or fragment thereof. In some embodiments, a binding site binds to a domain, a fragment, an epitope, a region, or a portion of a polypeptide, protein, or fragment thereof of a target. For example, a binding site binds to a domain, a fragment, an epitope, a region, or a portion of an isolated polypeptide, a polypeptide of a cell, a purified polypeptide, or a recombinant polypeptide. For example, a binding site binds to a domain, a fragment, an epitope, a region, or a portion of an antibody or fragment thereof.
- a binding site binds to a domain, a fragment, an epitope, a region, or a portion of a transcription factor.
- a binding site binds to a domain, a fragment, an epitope, a region, or a portion of a receptor.
- a binding site binds to a domain, a fragment, an epitope, a region, or a portion of a transmembrane receptor.
- Binding sites may bind to a domain, a fragment, an epitope, a region, or a portion of isolated, purified, and/or recombinant polypeptides.
- Binding sites can bind to a domain, a fragment, an epitope, a region, or a portion of a mixture of analytes (e.g., a lysate).
- a binding site binds to a domain, a fragment, an epitope, a region, or a portion of from a plurality of cells or from a lysate of a single cell.
- a binding site can bind to a binding moiety of a target.
- a binding moiety is on a polypeptide, protein, or fragment thereof.
- a binding moiety comprises a domain, a fragment, an epitope, a region, or a portion of a polypeptide, protein, or fragment thereof.
- a binding moiety comprises a domain, a fragment, an epitope, a region, or a portion of an isolated polypeptide, a polypeptide of a cell, a purified polypeptide, or a recombinant polypeptide.
- a binding moiety comprises a domain, a fragment, an epitope, a region, or a portion of an antibody or fragment thereof.
- a binding moiety comprises a domain, a fragment, an epitope, a region, or a portion of a transcription factor.
- a binding moiety comprises a domain, a fragment, an epitope, a region, or a portion of a receptor.
- a binding moiety comprises a domain, a fragment, an epitope, a region, or a portion of a transmembrane receptor.
- Binding moieties may be on or comprise a domain, a fragment, an epitope, a region, or a portion of isolated, purified, and/or recombinant polypeptides.
- Binding moieties include binding moieties on or a domain, a fragment, an epitope, a region, or a portion of a mixture of analytes (e.g., a lysate).
- binding moieties are on or comprise a domain, a fragment, an epitope, a region, or a portion of from a plurality of cells or from a lysate of a single cell.
- a binding site binds to a domain, a fragment, an epitope, a region, or a portion of a chemical compound (e.g., small molecule).
- a binding binds to a domain, a fragment, an epitope, a region, or a portion of a drug.
- a binding site binds to a domain, a fragment, an epitope, a region, or a portion of a compound.
- a binding moiety binds to a domain, a fragment, an epitope, a region, or a portion of an organic compound.
- a binding site binds to a domain, a fragment, an epitope, a region, or a portion of a small molecule with a molecular weight of 900 Daltons or less. In some instances, a binding site binds to a domain, a fragment, an epitope, a region, or a portion of a small molecule with a molecular weight of 500 Daltons or more.
- the portion the small molecule that the binding site binds to may be obtained, for example, from a library of naturally occurring or synthetic molecules, including a library of compounds produced through combinatorial means, i.e. a compound diversity combinatorial library. Combinatorial libraries, as well as methods for their production and screening, are known in the art and described in: US 5,741,713; 5,734,018;
- a binding site can bind to a binding moiety of a small molecule.
- a binding moiety is on or comprises a domain, a fragment, an epitope, a region, or a portion of a small molecule.
- a binding moiety is on or comprises a domain, a fragment, an epitope, a region, or a portion of a drug.
- a binding moiety is on or comprises a domain, a fragment, an epitope, a region, or a portion of a compound.
- a binding moiety is on or comprises a domain, a fragment, an epitope, a region, or a portion of an organic compound.
- a binding moiety is on or comprises a domain, a fragment, an epitope, a region, or a portion of a small molecule with a molecular weight of 900 Daltons or less. In some instances, a binding moiety is on or comprises a domain, a fragment, an epitope, a region, or a portion of a small molecule with a molecular weight of 500 Daltons or more. Binding moieties may be obtained, for example, from a library of naturally occurring or synthetic molecules, including a library of compounds produced through combinatorial means, i.e. a compound diversity combinatorial library.
- a binding site can bind to a domain, a fragment, an epitope, a region, or a portion of a member of a specific binding pair (e.g., a ligand).
- a binding site can bind to a domain, a fragment, an epitope, a region, or a portion of monovalent (monoepitopic) or polyvalent (polyepitopic).
- a binding site can bind to an antigenic or haptenic portion of a target.
- a binding site can bind to a domain, a fragment, an epitope, a region, or a portion of a single molecule or a plurality of molecules that share at least one common epitope or determinant site.
- a binding site can bind to a domain, a fragment, an epitope, a region, or a portion of a part of a cell (e.g., a bacteria cell, a plant cell, or an animal cell).
- a binding site can bind to a target that is in a natural environment (e.g., tissue), a cultured cell, or a microorganism (e.g., a bacterium, fungus, protozoan, or virus), or a lysed cell.
- a binding site can bind to a portion of a target that is modified (e.g., chemically), to provide one or more additional binding sites such as, but not limited to, a dye (e.g., a fluorescent dye), a polypeptide modifying moiety such as a phosphate group, a carbohydrate group, and the like, or a polynucleotide modifying moiety such as a methyl group.
- a binding site can bind to a binding moiety of a member of a specific binding pair.
- a binding moiety can be on or comprise a domain, a fragment, an epitope, a region, or a portion of a member of a specific binding pair (e.g., a ligand).
- a binding moiety can be on or comprise a domain, a fragment, an epitope, a region, or a portion of monovalent (monoepitopic) or polyvalent (polyepitopic).
- a binding moiety can be antigenic or haptenic.
- a binding moiety can be on or comprise a domain, a fragment, an epitope, a region, or a portion of a single molecule or a plurality of molecules that share at least one common epitope or determinant site.
- a binding moiety can be on or comprise a domain, a fragment, an epitope, a region, or a portion of a part of a cell (e.g., a bacteria cell, a plant cell, or an animal cell).
- a binding moiety can be either in a natural environment (e.g., tissue), a cultured cell, or a microorganism (e.g., a bacterium, fungus, protozoan, or virus), or a lysed cell.
- a binding moiety can be modified (e.g., chemically), to provide one or more additional binding sites such as, but not limited to, a dye (e.g., a fluorescent dye), a polypeptide modifying moiety such as a phosphate group, a carbohydrate group, and the like, or a polynucleotide modifying moiety such as a methyl group.
- a binding site binds to a domain, a fragment, an epitope, a region, or a portion of a molecule found in a sample from a host.
- a binding site can bind to a binding moeity of a molecule found in a sample from a host.
- a binding moiety is on or comprises a domain, a fragment, an epitope, a region, or a portion of a molecule found in a sample from a host.
- a sample from a host includes a body fluid (e.g., urine, blood, plasma, serum, saliva, semen, stool, sputum, cerebral spinal fluid, tears, mucus, and the like).
- a sample can be examined directly or may be pretreated to render a binding moiety more readily detectible.
- Samples include a quantity of a substance from a living thing or formerly living things.
- a sample can be natural, recombinant, synthetic, or not naturally occurring.
- a binding site can bind to any of the above that is expressed from a cell naturally or recombinantly, in a cell lysate or cell culture medium, an in vitro translated sample, or an immunoprecipitation from a sample (e.g., a cell lysate).
- a binding moiety can be any of the above that is expressed from a cell naturally or recombinantly, in a cell lysate or cell culture medium, an in vitro translated sample, or an
- immunoprecipitation from a sample e.g., a cell lysate.
- a binding site binds to a target expressed in a cell-free system or in vitro.
- a binding site binds to a target in a cell extract.
- a binding site binds to a target in a cell extract with a DNA template, and reagents for transcription and translation.
- a binding site can bind to a binding moiety of a a target expressed in a cell-free system or in vitro.
- a binding moiety of a target is expressed in a cell-free system or in vitro.
- a binding moiety of a target is in a cell extract.
- a binding moiety of a target is in a cell extract with a DNA template, and reagents for transcription and translation.
- exemplary sources of cell extracts that can be used include wheat germ, Escherichia coli, rabbit reticulocyte, hyperthermophiles, hybridomas, Xenopus oocytes, insect cells, and mammalian cells (e.g., human cells).
- Exemplary cell-free methods that can be used to express target polypeptides (e.g., to produce target polypeptides on an array) include Protein in situ arrays (PISA), Multiple spotting technique (MIST), Self-assembled mRNA translation, Nucleic acid programmable protein array (NAPPA), nanowell NAPPA, DNA array to protein array (DAP A), membrane-free DAPA, nanowell copying and mIR -microintaglio printing, and pMAC-protein microarray copying ( See Kilb et al., Eng. Life Sci. 2014, 14, 352-364).
- PISA Protein in situ arrays
- MIST Multiple spotting technique
- NAPPA Nucleic acid programmable protein array
- DAP A DNA array to protein array
- membrane-free DAPA membrane-free DAPA
- nanowell copying and mIR -microintaglio printing See Kilb et al., Eng. Life Sci. 2014, 14, 352-364
- a binding site binds to a target that is synthesized in situ (e.g. , on a solid substrate of an array) from a DNA template.
- a binding site can bind to binding moiety of a target that is synthesized in situ.
- a binding moiety of a target is synthesized in situ (e.g. , on a solid substrate of an array) from a DNA template.
- a plurality of binding moieties is synthesized in situ from a plurality of corresponding DNA templates in parallel or in a single reaction.
- Exemplary methods for in situ target polypeptide expression include those described in Stevens, Structure 8(9): R177-R185 (2000); Katzen et al., Trends Biotechnol. 23(3): 150-6. (2005); He et al, Curr. Opin. Biotechnol. 19(1):4— 9. (2008); Ramachandran et al., Science 305(5680): 86-90. (2004); He et al., Nucleic Acids Res. 29(15):E73-3 (2001); Angenendt et al., Mol.
- a binding site binds to a nucleic acid target comprising a span of at least 6 nucleotides, for example, least 8, 9, 10, 12, 15, 20, 25, 30, 40, 50, or 100 nucleotides. In some instances, a binding site binds to a protein target comprising a contiguous stretch of nucleotides. In some instances, a binding site binds to a protein target comprising a non-contiguous stretch of nucleotides. In some instances, a binding site binds to a nucleic acid target comprising a site of a mutation or functional mutation, including a deletion, addition, swap, or truncation of the nucleotides in a nucleic acid sequence.
- a binding site can bind to a binding moiety of a nucleic acid target.
- a binding moiety of a nucleic acid target comprises a span of at least 6 nucleotides, for example, least 8, 9, 10, 12, 15, 20, 25, 30, 40, 50, or 100 nucleotides.
- a binding moiety of a protein target comprises a contiguous stretch of nucleotides.
- a binding moiety of a protein target comprises a non-contiguous stretch of nucleotides.
- a binding moiety of a nucleic acid target comprises a site of a mutation or functional mutation, including a deletion, addition, swap, or truncation of the nucleotides in a nucleic acid sequence.
- a binding site binds to a protein target comprising a span of at least 6 amino acids, for example, least 8, 9, 10, 12, 15, 20, 25, 30, 40, 50, or 100 amino acids. In some instances, a binding site binds to a protein target comprising a contiguous stretch of amino acids. In some instances, a binding site binds to a protein target comprising a non-contiguous stretch of amino acids. In some instances, a binding site binds to a protein target comprising a site of a mutation or functional mutation, including a deletion, addition, swap, or truncation of the amino acids in a polypeptide sequence. A binding site can bind to a binding moiety of a protein target.
- a binding moiety of a protein target comprises a span of at least 6 amino acids, for example, least 8, 9, 10, 12, 15, 20, 25, 30, 40, 50, or 100 amino acids.
- a binding moiety of a protein target comprises a contiguous stretch of amino acids.
- a binding moiety of a protein target comprises a non contiguous stretch of amino acids.
- a binding moiety of a protein target comprises a site of a mutation or functional mutation, including a deletion, addition, swap, or truncation of the amino acids in a polypeptide sequence.
- a binding site binds to a domain, a fragment, an epitope, a region, or a portion of a membrane bound protein.
- a binding site can bind to a binding moiety of a membrane bound protein.
- a binding moiety is on or comprises a domain, a fragment, an epitope, a region, or a portion of a membrane bound protein.
- Exemplary membrane bound proteins include, but are not limited to, GPCRs (e.g., adrenergic receptors, angiotensin receptors, cholecystokinin receptors, muscarinic acetylcholine receptors, neurotensin receptors, galanin receptors, dopamine receptors, opioid receptors, erotonin receptors, somatostatin receptors, etc.), ion channels (e.g., nicotinic acetylcholine receptors, sodium channels, potassium channels, etc.), non-excitable and excitable channels, receptor tyrosine kinases, receptor serine/threonine kinases, receptor guanylate cyclases, growth factor and hormone receptors (e.g., epidermal growth factor (EGF) receptor), and others.
- GPCRs e.g., adrenergic receptors, angiotensin receptors, cholecystokinin receptors
- the binding site can bind to a domain, a fragment, an epitope, a region, or a portion of a mutant or modified variants of membrane- bound proteins.
- the binding site can bind to a binding moiety of a mutant or modified variant of membrane -bound protein.
- the binding moiety may also be on or comprise a domain, a fragment, an epitope, a region, or a portion of a mutant or modified variants of membrane -bound proteins.
- some single or multiple point mutations of GPCRs retain function and are involved in disease (See, e.g., Stadel et al., (1997) Trends in Pharmacological Review 18:430-37).
- a binding site binds to, for example, a domain, a fragment, an epitope, a region, or a portion of a ubiquitin ligase.
- a binding site binds to, for example, a domain, a fragment, an epitope, a region, or a portion of a ubiquitin adaptor, proteasome adaptor, or proteasome protein.
- a binding site binds to, for example, a domain, a fragment, an epitope, a region, or a portion of a protein involved in endocytosis, phagocytosis, a lysosomal pathway, an autophagic pathway, macroautophagy, microautophagy, chaperone-mediated autophagy, the multi vesicular body pathway, or a combination thereof.
- the circular polyribonucleotide comprises one or more RNA binding sites.
- the circular polyribonucleotide includes RNA binding sites that modify expression of an endogenous gene and/or an exogenous gene.
- the RNA binding site modulates expression of a host gene.
- the RNA binding site can include a sequence that hybridizes to an endogenous gene (e.g., a sequence for a miRNA, siRNA, mRNA, IncRNA, RNA, DNA, an antisense RNA, gRNA as described herein), a sequence that hybridizes to an exogenous nucleic acid such as a viral DNA or RNA, a sequence that hybridizes to an RNA, a sequence that interferes with gene transcription, a sequence that interferes with RNA translation, a sequence that stabilizes RNA or destabilizes RNA such as through targeting for degradation, or a sequence that modulates a DNA- or RNA-binding factor.
- an endogenous gene e.g., a sequence for a miRNA, siRNA, mRNA, IncRNA, RNA, DNA, an antisense RNA, gRNA as described herein
- an exogenous nucleic acid such as a viral DNA or RNA
- a sequence that hybridizes to an RNA a sequence that interferes
- the circular polyribonucleotide comprises an aptamer sequence that binds to an RNA.
- the aptamer sequence can bind to an endogenous gene (e.g., a sequence for a miRNA, siRNA, mRNA, IncRNA, RNA, DNA, an antisense RNA, gRNA as described herein), to an exogenous nucleic acid such as a viral DNA or RNA, to an RNA, to a sequence that interferes with gene transcription, to a sequence that interferes with RNA translation, to a sequence that stabilizes RNA or destabilizes RNA such as through targeting for degradation, or to a sequence that modulates a DNA- or RNA-binding factor.
- the secondary structure of the aptamer sequence can bind to the RNA.
- the circular RNA can form a complex with the RNA by binding of the aptamer sequence to the RNA.
- the RNA binding site can be one of a tRNA, IncRNA, lincRNA, miRNA, rRNA, snRNA, microRNA, siRNA, piRNA, snoRNA, snRNA, exRNA, scaRNA, Y RNA, and hnRNA binding site.
- RNA binding sites are well-known to persons of ordinary skill in the art.
- RNA binding sites can inhibit gene expression through the biological process of RNA interference (RNAi).
- the circular polyribonucleotides comprises an RNAi molecule with RNA or RNA-like structures typically having 15-50 base pairs (such as aboutl8-25 base pairs) and having a nucleobase sequence identical (complementary) or nearly identical (substantially complementary) to a coding sequence in an expressed target gene within the cell.
- RNAi molecules include, but are not limited to: short interfering RNA (siRNA), double-strand RNA (dsRNA), microRNA (miRNA), short hairpin RNA (shRNA), meroduplexes, and dicer substrates.
- the RNA binding site comprises an siRNA or an shRNA.
- siRNA and shRNA resemble intermediates in the processing pathway of the endogenous miRNA genes.
- siRNA can function as miRNA and vice versa.
- MicroRNA like siRNA, can use RISC to downregulate target genes, but unlike siRNA, most animal miRNA do not cleave the mRNA. Instead, miRNA reduce protein output through translational suppression or polyA removal and mRNA degradation.
- Known miRNA binding sites are within mRNA 3’-UTRs; miRNA seem to target sites with near-perfect complementarity to nucleotides 2-8 from the miRNA’ s 5’ end. This region is known as the seed region. Because siRNA and miRNA are interchangeable, exogenous siRNA can downregulate mRNA with seed complementarity to the siRNA. Multiple target sites within a 3’-UTR can give stronger downregulation.
- MicroRNA are short noncoding RNA that bind to the 3’-UTR of nucleic acid molecules and down-regulate gene expression either by reducing nucleic acid molecule stability or by inhibiting translation.
- the circular polyribonucleotide can comprise one or more miRNA target sequences, miRNA sequences, or miRNA seeds. Such sequences can correspond to any miRNA.
- a miRNA sequence comprises a“seed” region, i.e., a sequence in the region of positions 2-8 of the mature miRNA, which sequence has Watson-Crick complementarity to the miRNA target sequence.
- a miRNA seed can comprise positions 2-8 or 2-7 of the mature miRNA.
- a miRNA seed can comprise 7 nucleotides (e.g., nucleotides 2-8 of the mature miRNA), wherein the seed complementary site in the corresponding miRNA target is flanked by an adenine (A) opposed to miRNA position 1.
- a miRNA seed can comprise 6 nucleotides (e.g., nucleotides 2-7 of the mature miRNA), wherein the seed-complementary site in the corresponding miRNA target is flanked by an adenine (A) opposed to miRNA at position 1.
- the bases of the miRNA seed can be substantially complementary with the target sequence.
- the circular polyribonucleotide can evade or be detected by the host’s immune system, have modulated degradation, or modulated translation. This process can reduce the hazard of off target effects upon circular polyribonucleotide delivery.
- the circular polyribonucleotide can include an miRNA sequence identical to about 5 to about 25 contiguous nucleotides of a target gene.
- the miRNA sequence targets a mRNA and commences with the dinucleotide AA, comprises a GC -content of about 30%-70%, about 30%-60%, about 40%-60%, or about 45%-55%, and does not have a high percentage identity to any nucleotide sequence other than the target in the genome of the mammal in which it is to be introduced, for example, as determined by standard BLAST search.
- miRNA binding sites can be engineered out of (i.e., removed from) the circular polyribonucleotide to modulate protein expression in specific tissues. Regulation of expression in multiple tissues can be accomplished through introduction or removal or one or several miRNA binding sites (e.g., the miRNA binding site confers nucleic acid activity in a cell).
- tissues where miRNA are known to regulate mRNA, and thereby protein expression include, but are not limited to, liver (miR-122), muscle (miR-133, miR-206, miR-208), endothelial cells (miR-17-92, miR-126), myeloid cells (miR-142-3p, miR-142-5p, miR-16, miR-21, miR-223, miR-24, miR-27), adipose tissue (let-7, miR-30c), heart (miR-ld, miR-149), kidney (miR-192, miR-194, miR- 204), and lung epithelial cells (let-7, miR-133, miR-126).
- liver miR-122
- muscle miR-133, miR-206, miR-208
- endothelial cells miR-17-92, miR-126
- myeloid cells miR-142-3p, miR-142-5p, miR-16, miR-21, miR-223,
- MiRNA can also regulate complex biological processes, such as angiogenesis (miR-132).
- binding sites for miRNA that are involved in such processes can be removed or introduced, in order to tailor the expression from the circular polyribonucleotide to biologically relevant cell types or to the context of relevant biological processes.
- the miRNA binding site includes, e.g., miR-7.
- the circular polyribonucleotide described herein can be engineered for more targeted expression in specific cell types or only under specific biological conditions.
- the circular polyribonucleotide can be designed for optimal protein expression in a tissue or in the context of a biological condition.
- miRNA seed sites can be incorporated into the circular polyribonucleotide to modulate expression in certain cells which results in a biological improvement.
- An example of this is incorporation of miR-142 sites.
- Incorporation of miR-142 sites into the circular polyribonucleotide described herein can modulate expression in hematopoietic cells, but also reduce or abolish immune responses to a protein encoded in the circular polyribonucleotide.
- the circular polyribonucleotide comprises at least one miRNA, e.g., 2, 3,
- the circular polyribonucleotide comprises an miRNA having at least about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% nucleotide sequence identity to any one of the nucleotide sequences or a sequence that is complementary to a target sequence.
- RNAi molecules can be readily designed and produced by technologies known in the art.
- computational tools can be used to determine effective and specific sequence motifs.
- a circular polyribonucleotide comprises a long non-coding RNA.
- IncRNA Long non -coding RNA
- RNA Long non -coding RNA
- the longer length distinguishes IncRNA from small regulatory RNA, such as miRNA, siRNA, and other short RNA.
- miRNA small regulatory RNA
- siRNA small regulatory RNA
- the majority (-78%) of IncRNA are characterized as tissue-specific.
- Divergent IncRNA that are transcribed in the opposite direction to nearby protein-coding genes can regulate the transcription of the nearby gene.
- the length of the RNA binding site may be between about 5 to 30 nucleotides, between about 10 to 30 nucleotides, or about 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or more nucleotides.
- the degree of identity of the RNA binding site to a target of interest can be at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%.
- the circular polyribonucleotide includes one or more large intergenic non coding RNA (lincRNA) binding sites.
- LincRNA make up most of the long non-coding RNA.
- LincRNA are non-coding transcripts and, in some embodiments, are more than about 200 nucleotides long.
- lincRNA have an exon-intron-exon structure, similar to protein-coding genes, but do not encompass open-reading frames and do not code for proteins. LincRNA expression can be strikingly tissue-specific compared to coding genes. LincRNA are typically co-expressed with their neighboring genes to a similar extent to that of pairs of neighboring protein-coding genes.
- the circular polyribonucleotide comprises a circularized lincRNA.
- the circular polyribonucleotides disclosed herein include one or more lincRNA, for example, FIRRE, LINC00969, PVT1, LINC01608, JPX, LINC01572, LINC00355, Clorfl32, C3orf35, RP11-734, LINC01608, CC-499B15.5, CASC15, LINC00937, and RP11-191.
- lincRNA for example, FIRRE, LINC00969, PVT1, LINC01608, JPX, LINC01572, LINC00355, Clorfl32, C3orf35, RP11-734, LINC01608, CC-499B15.5, CASC15, LINC00937, and RP11-191.
- lincRNA and IncRNA sequences can be found in databases maintained by research organizations, for example, Institute of Genomics and Integrative Biology, Diamantina Institute at the University of Queensland, Ghent University, and Sun Yat-sen University. LincRNA and IncRNA molecules can be readily designed and produced by technologies known in the art. In addition, computational tools can be used to determine effective and specific sequence motifs.
- the RNA binding site can comprise a sequence that is substantially complementary, or fully complementary, to all or a fragment of an endogenous gene or gene product (e.g., mRNA).
- the complementary sequence can complement sequences at the boundary between introns and exons to prevent the maturation of newly-generated nuclear RNA transcripts of specific genes into mRNA for transcription.
- the complementary sequence may be specific to genes by hybridizing with the mRNA for that gene and prevent its translation.
- the RNA binding site can comprise a sequence that is antisense or substantially antisense to all or a fragment of an endogenous gene or gene product, such as DNA, RNA, or a derivative or hybrid thereof.
- the RNA binding site can comprise a sequence that is substantially complementary, or fully complementary, to all or a fragment of an endogenous gene or gene product (e.g., mRNA).
- the complementary sequence can complement sequences at the boundary between introns and exons to prevent the maturation of newly-generated nuclear RNA transcripts of specific genes into mRNA for transcription.
- the complementary sequence may be specific to genes by hybridizing with the mRNA for that gene and prevent its translation.
- the RNA binding site can comprise a sequence that is antisense or substantially antisense to all or a fragment of an endogenous gene or gene product, such as DNA, RNA, or a derivative or hybrid thereof.
- the RNA binding site can comprise a sequence that is substantially complementary, or fully complementary, to a region of a linear polyribonucleotide.
- the complementary sequence may be specific to the region of the linear polyribonucleotide for hybridization of the circular polyribonucleotide to the linear polyribonucleotide.
- the linear polyribonucleotide also comprises a region for binding to a protein, such as a receptor, on a cell.
- the region of the linear polyribonucleotide that binds to a cell receptor results in internalization of the linear polyribonucleotide hybridized to the circular polyribonucleotide into the cell after binding.
- the circular polyribonucleotide comprises a RNA binding site that has an RNA or RNA-like structure typically between about 5-5000 base pairs (depending on the specific RNA structure, e.g., miRNA 5-30 bps, IncRNA 200-500 bps) and has a nucleobase sequence identical (complementary) or nearly identical (substantially complementary) to a coding sequence in an expressed target gene within the cell.
- the circular polyribonucleotide comprises a DNA binding site, such as a sequence for a guide RNA (gRNA).
- gRNA guide RNA
- the circular polyribonucleotide comprises a guide RNA or a complement to a gRNA sequence.
- Guide RNA sequences can have a length of between 17 - 24 nucleotides (e.g., 19, 20, or 21 nucleotides) and complementary to the targeted nucleic acid sequence.
- Custom gRNA generators and algorithms can be used in the design of effective guide RNA.
- Gene editing can be achieved using a chimeric“single guide RNA” (“sgRNA”), an engineered (synthetic) single RNA molecule that mimics a naturally occurring crRNA-tracrRNA complex and contains both a tracrRNA (for binding the nuclease) and at least one crRNA (to guide the nuclease to the sequence targeted for editing).
- sgRNA chimeric“single guide RNA”
- tracrRNA for binding the nuclease
- crRNA to guide the nuclease to the sequence targeted for editing
- the gRNA can recognize specific DNA sequences (e.g., sequences adjacent to or within a promoter, enhancer, silencer, or repressor of a gene).
- the gRNA is part of a CRISPR system for gene editing.
- the circular polyribonucleotide can be designed to include one or multiple guide RNA sequences corresponding to a desired target DNA sequence.
- the gRNA sequences may include at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more nucleotides for interaction with Cas9 or other exonuclease to cleave DNA, e.g., Cpfl interacts with at least about 16 nucleotides of gRNA sequence for detectable DNA cleavage.
- the circular polyribonucleotide comprises an aptamer sequence that can bind to DNA.
- the secondary structure of the aptamer sequence can bind to DNA.
- the circular polyribonucleotide forms a complex with the DNA by binding of the aptamer sequence to the DNA.
- the circular polyribonucleotide includes sequences that bind a major groove of in duplex DNA.
- the specificity and stability of a triplex structure created by the circular polyribonucleotide and duplex DNA is afforded via Hoogsteen hydrogen bonds, which are different from those formed in classical Watson-Crick base pairing in duplex DNA.
- the circular polyribonucleotide binds to the purine-rich strand of a target duplex through the major groove.
- triplex formation occurs in two motifs, distinguished by the orientation of the circular polyribonucleotide with respect to the purine-rich strand of the target duplex.
- polypyrimidine sequence stretches in a circular polyribonucleotides bind to the polypurine sequence stretches of a duplex DNA via Hoogsteen hydrogen bonding in a parallel fashion (i.e., in the same 5’ to 3’, orientation as the purine-rich strand of the duplex), whereas the polypurine stretches (R) bind in an antiparallel fashion to the purine strand of the duplex via reverse-Hoogsteen hydrogen bonds.
- a purine motif comprises triplets of G:G-C, A:A-T, or T:A-T; whereas in the parallel, a pyrimidine motif comprises canonical triples of C+:G-C or T:A-T triplets (where C+ represents a protonated cytosine on the N3 position).
- a pyrimidine motif comprises canonical triples of C+:G-C or T:A-T triplets (where C+ represents a protonated cytosine on the N3 position).
- polyribonucleotide may form stable triplexes at neutral pH, while parallel CT sequences in a circular polyribonucleotide may bind at acidic pH.
- N3 on cytosine in the circular polyribonucleotide may be protonated.
- Substitution of C with 5-methyl-C may permit binding of CT sequences in the circular polyribonucleotide at physiological pH as 5-methyl-C has a higher pK than does cytosine.
- the DNA duplex target for triplex formation includes consecutive purine bases in one strand.
- a target for triplex formation comprises a homopurine sequence in one strand of the DNA duplex and a homopyrimidine sequence in the complementary strand.
- a triplex comprising a circular polyribonucleotide is a stable structure.
- a triplex comprising a circular polyribonucleotide exhibits an increased half-life, e.g., increased by about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, or greater, e.g., persistence for at least about 1 hr to about 30 days, or at least about 2 hrs, 6 hrs, 12 hrs, 18 hrs, 24 hrs, 2 days, 3, days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days,
- the circular polyribonucleotide includes one or more protein binding sites.
- a protein binding site comprises an aptamer sequence.
- the circular polyribonucleotide includes a protein binding site to reduce an immune response from the host as compared to the response triggered by a reference compound, e.g., a circular polyribonucleotide lacking the protein binding site, e.g., linear RNA.
- circular polyribonucleotides disclosed herein include one or more protein binding sites to bind a protein, e.g., a ribosome.
- a protein e.g., a ribosome.
- the circular polyribonucleotide can evade or have reduced detection by the host’s immune system, have modulated degradation, or modulated translation.
- the circular polyribonucleotide comprises at least one immunoprotein binding site, for example, to mask the circular polyribonucleotide from components of the host’s immune system, e.g., evade CTL responses.
- the immunoprotein binding site is a nucleotide sequence that binds to an immunoprotein and aids in masking the circular polyribonucleotide as non- endogenous.
- RNA binding to the capped 5’ end of an RNA From the 5’ end, the ribosome migrates to an initiation codon, whereupon the first peptide bond is formed.
- internal initiation (i.e., cap-independent) or translation of the circular polyribonucleotide does not require a free end or a capped end. Rather, a ribosome binds to a non-capped internal site, whereby the ribosome begins polypeptide elongation at an initiation codon.
- the circular polyribonucleotide includes one or more RNA sequences comprising a ribosome binding site, e.g., an initiation codon.
- circular polyribonucleotides disclosed herein comprise a protein binding sequence that binds to a protein.
- the protein binding sequence targets or localizes a circular polyribonucleotide to a specific target.
- the protein binding sequence specifically binds an arginine-rich region of a protein.
- circular polyribonucleotides disclosed herein include one or more protein binding sites that each bind a target protein, e.g., acting as a scaffold to bring two or more proteins in close proximity.
- circular polynucleotides disclosed herein comprise two protein binding sites that each bind a target protein, thereby bringing the target proteins into close proximity.
- circular polynucleotides disclosed herein comprise three protein binding sites that each bind a target protein, thereby bringing the three target proteins into close proximity.
- circular polynucleotides disclosed herein comprise four protein binding sites that each bind a target protein, thereby bringing the four target proteins into close proximity.
- circular polynucleotides disclosed herein comprise five or more protein binding sites that each bind a target protein, thereby bringing five or more target proteins into close proximity.
- the target proteins are the same.
- the target proteins are different.
- bringing target proteins into close proximity promotes formation of a protein complex.
- a circular polyribonucleotide of the disclosure can act as a scaffold to promote the formation of a complex comprising one, two, three, four, five, six, seven, eight, nine, or ten target proteins, or more.
- bringing two or more target proteins into close proximity promotes interaction of the two or more target proteins.
- bringing two or more target proteins into close proximity modulates, promotes, or inhibits of an enzymatic rection. In some embodiments, bringing two or more target proteins into close proximity modulates, promotes, or inhibits a signal transduction pathway.
- the protein binding site includes, but is not limited to, a binding site to the protein, such as ACINI, AGO, APOBEC3F, APOBEC3G, ATXN2, AUH, BCCIP, CAPRIN1, CELF2, CPSF1, CPSF2, CPSF6, CPSF7, CSTF2, CSTF2T, CTCF, DDX21, DDX3, DDX3X, DDX42, DGCR8, EIF3A, EIF4A3, EIF4G2, ELAVL1, ELAVL3, FAM120A, FBL, FIP1L1, FKBP4, FMR1, FUS, FXR1, FXR2, GNF3, GTF2F1, HNRNPA1, HNRNPA2B1, HNRNPC.
- a binding site to the protein such as ACINI, AGO, APOBEC3F, APOBEC3G, ATXN2, AUH, BCCIP, CAPRIN1, CELF2, CPSF1, CP
- a protein binding site is a nucleic acid sequence that binds to a protein, e.g., a sequence that can bind a transcription factor, enhancer, repressor, polymerase, nuclease, histone, or any other protein that binds DNA.
- a protein binding site is an aptamer sequence that binds to a protein.
- the secondary structure of the aptamer sequence binds the protein.
- the circular RNA forms a complex with the protein by binding of the aptamer sequence to the protein.
- a circular RNA is conjugated to a small molecule or a part thereof, wherein the small molecule or part thereof binds to a target such as a protein.
- a small molecule can be conjugated to a circular RNA via a modified nucleotide, e.g., by click chemistry.
- small molecules that can bind to proteins include, but are not limited to 4-hydroxytamoxifen (4-OHT), AC220, Afatinib , an aminopyrazole analog, an AR antagonist, BI-7273, Bosutinib, Ceritinib, Chloroalkane, Dasatinib, Foretinib, Gefitinib, a HIF- la-derived (R)-hydroxyproline, HJB97, a hydroxyproline-based ligand, IACS-7e, Ibrutinib, an ibrutinib derivative, JQ1, Lapatinib, an LCL161 derivative, Lenalidomide, a nutlin small molecule, OTX015, a PDE4 inhibitor, Pomalidomide, a ripk2 inhibitor, RN486, Sirt2 inhibitor 3b, SNS-032, Steel factor, a TBKl inhibitor, Thalidomide, a thalidomide derivative, a
- Thiazolidinedione-based ligand a VH032 derivative, VHL ligand 2, VHL-1, VL-269, and derivatives thereof.
- a circular RNA is conjugated to more than one small molecule, for instance, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more small molecules.
- a circular RNA is conjugated to more than one different small molecules, for instance, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more different small molecules.
- the more than one small molecule conjugated to the circular RNA are configured to recruit their respective target proteins into proximity, which can lead to interaction between the target proteins, and/or other molecular and cellular changes.
- a circular RNA can be conjugated to both JQ1 and thalidomide, or derivative thereof, which can thus recruit a target protein of JQ1, e.g., BET family proteins, and a target protein of thalidomide, e.g., E3 ligase.
- the circular RNA conjugated with JQ1 and thalidomide recruits a BET family protein via JQ1, or derivative thereof, tags the BET family protein with ubiquitin by E3 ligase that is recruited through thalidomide or derivative thereof, and thus leads to degradation of the tagged BET family protein.
- the circular polyribonucleotide comprises one or more binding sites to a non-RNA or non-DNA target.
- the binding site can be one of a small molecule, an aptamer, a lipid, a carbohydrate, a virus particle, a membrane, a multi-component complex, a cell, a cellular moiety, or any fragment thereof binding site.
- the circular polyribonucleotide comprises one or more binding sites to a non-RNA or non-DNA target.
- the binding site can be one of a small molecule, an aptamer, a lipid, a carbohydrate, a virus particle, a membrane, a multi-component complex, a cell, a cellular moiety, or any fragment thereof binding site.
- the circular polyribonucleotide comprises one or more binding sites to a non-RNA or non-DNA target.
- the binding site can be one of a small molecule, an aptamer, a lipid, a carbohydrate,
- polyribonucleotide comprises one or more binding sites to a lipid. In some embodiments, the circular polyribonucleotide comprises one or more binding sites to a carbohydrate. In some embodiments, the circular polyribonucleotide comprises one or more binding sites to a carbohydrate. In some embodiments, the circular polyribonucleotide comprises one or more binding sites to a membrane. In some
- the circular polyribonucleotide comprises one or more binding sites to a multi -component complex, e.g., ribosome, nucleosome, transcription machinery, etc.
- the circular polyribonucleotide comprises an aptamer sequence.
- the aptamer sequence can bind to any target as described herein (e.g., a nucleic acid molecule, a small molecule, a protein, a carbohydrate, a lipid, etc.).
- the aptamer sequence has a secondary structure that can bind the target.
- the aptamer sequence has a tertiary structure that can bind the target.
- the aptamer sequence has a quaternary structure that can bind the target.
- the circular polyribonucleotide can bind to the target via the aptamer sequence to form a complex.
- the complex is detectable for at least 5 days. In some embodiments, the complex is detectable for at least 2 days, 3, days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days.
- the least one binding site can bind to a target.
- the at least one binding site can comprise at least one aptamer sequence that binds to a target.
- the circRNA comprises one or more binding sites for one or more targets.
- Targets include, but are not limited to, nucleic acids (e.g., RNAs, DNAs, RNA-DNA hybrids), small molecules (e.g., drugs, fluorophores, metabolites), aptamers, polypeptides, proteins, lipids, carbohydrates, antibodies, viruses, virus particles, membranes, multi- component complexes, organelles, cells, other cellular moieties, any fragments thereof, and any combination thereof.
- a target is a single -stranded RNA, a double -stranded RNA, a single- stranded DNA, a double -stranded DNA, a DNA or RNA comprising one or more double stranded regions and one or more single stranded regions, an RNA-DNA hybrid, a small molecule, an aptamer, a polypeptide, a protein, a lipid, a carbohydrate, an antibody, an antibody fragment, a mixture of antibodies, a virus particle, a membrane, a multi -component complex, a cell, a cellular moiety, any fragment thereof, or any combination thereof.
- a target is a polypeptide, a protein, or any fragment thereof.
- a target can be a purified polypeptide, an isolated polypeptide, a fusion tagged polypeptide, a polypeptide attached to or spanning the membrane of a cell or a virus or virion, a cytoplasmic protein, an intracellular protein, an extracellular protein, a kinase, a tyrosine kinase, a serine/threonine kinase, a phosphatase, an aromatase, a phosphodiesterase, a cyclase, a helicase, a protease, an oxidoreductase, a reductase, a transferase, a hydrolase, a lyase, an isomerase, a glycosylase, a extracellular matrix protein, a ligase, a ubiquitin ligas
- a target is a heterologous polypeptide.
- a target is a protein overexpressed in a cell using molecular techniques, such as transfection.
- a target is a recombinant polypeptide.
- a target is in a sample produced from bacterial (e.g., E. coli), yeast, mammalian, or insect cells (e.g., proteins overexpressed by the organisms).
- a target is a polypeptide with a mutation, insertion, deletion, or polymorphism.
- a target is a polypeptide naturally expressed by a cell (e.g., a healthy cell or a cell associated with a disease or condition).
- a target is an antigen, such as a polypeptide used to immunize an organism or to generate an immune response in an organism, such as for antibody production.
- a target is an antibody.
- An antibody can specifically bind to a particular spatial and polar organization of another molecule.
- An antibody can be monoclonal, polyclonal, or a recombinant antibody, and can be prepared by techniques that are well known in the art such as immunization of a host and collection of sera (polyclonal) or by preparing continuous hybrid cell lines and collecting the secreted protein (monoclonal), or by cloning and expressing nucleotide sequences, or mutagenized versions thereof, coding at least for the amino acid sequences required for specific binding of natural antibodies.
- a naturally occurring antibody can be a protein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
- Each heavy chain can be comprised of a heavy chain variable region (VH) and a heavy chain constant region.
- the heavy chain constant region can comprise three domains, CHI, Cm, and Cm.
- Each light chain can comprise a light chain variable region (VL) and a light chain constant region.
- the light chain constant region can comprise one domain, CL.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed
- Each VH and VL can be composed of three CDRs and four FRs arranged from amino-terminus to carboxy-terminus in the following order: FRi, CDRi, FR 2 , CDR 2 , FR 3 , CDR 3 , and FR4.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Cl q) of the classical complement system.
- the antibodies can be of any isotype (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., lgGi, lgG2, lgG 3 , lgG- t , IgAi and lgA2), subclass or modified version thereof.
- Antibodies may include a complete immunoglobulin or fragments thereof.
- An antibody fragment can refer to one or more fragments of an antibody that retain the ability to specifically bind to a binding moiety, such as an antigen.
- antibody fragments include a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; an Fd fragment consisting of the VH and CHI domains; an Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a single domain antibody (dAb) fragment (Ward et al., (1989) Nature 341 : 544-46), which consists of a VH domain; and an isolated CDR and a single chain Fragment (scFv) in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); See, e.g., Bird et al., (1988) Science 242:423- 26; and Huston
- antibody fragments include Fab, F(ab)2, scFv, Fv, dAb, and the like.
- the two domains VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by an artificial peptide linker that enables them to be made as a single protein chain.
- Such single chain antibodies include one or more antigen binding moieties.
- An antibody can be a polyvalent antibody, for example, bivalent, trivalent, tetravalent, pentavalent, hexavalanet, heptavalent, or octavalent antibodies.
- An antibody can be a multi-specific antibody.
- bispecific, trispecific, tetraspecific, pentaspecific, hexaspecific, heptaspecific, or octaspecific antibodies can be generated, e.g., by recombinantly joining a combination of any two or more antigen binding agents (e.g., Fab, F(ab)2, scFv, Fv, IgG).
- Multi-specific antibodies can be used to bring two or more targets into close proximitiy, e.g., degradation machinery and a target substrate to degrade, or a ubiquitin ligase and a substrate to ubiquitinate.
- Antibodies can be human, humanized, chimeric, isolated, dog, cat, donkey, sheep, any plant, animal, or mammal.
- a target is a polymeric form of ribonucleotides and/or
- deoxyribonucleotides adenine, guanine, thymine, or cytosine
- DNA or RNA e.g., mRNA
- DNA includes double-stranded DNA found in linear DNA molecules (e.g., restriction fragments), viruses, plasmids, and chromosomes.
- a polynucleotide target is single -stranded, double stranded, small interfering RNA (siRNA), messenger RNA (mRNA), transfer RNA (tRNA), a chromosome, a gene, a noncoding genomic sequence, genomic DNA (e.g., fragmented genomic DNA), a purified polynucleotide, an isolated polynucleotide, a hybridized polynucleotide, a transcription factor binding site, mitochondrial DNA, ribosomal RNA, a eukaryotic polynucleotide, a prokaryotic polynucleotide, a synthesized polynucleotide, a ligated polynucleotide, a recombinant polynucleotide, a polynucleotide,
- a target is a recombinant polynucleotide.
- a target is a heterologous polynucleotide.
- a target is a polynucleotide produced from bacterial (e.g., E. coli), yeast, mammalian, or insect cells (e.g., polynucleotides heterologous to the organisms).
- a target is a polynucleotide with a mutation, insertion, deletion, or polymorphism.
- a target is an aptamer.
- An aptamer is an isolated nucleic acid molecule that binds with high specificity and affinity to a binding moiety or target molecule, such as a protein.
- An aptamer is a three dimensional structure held in certain conformation(s) that provides chemical contacts to specifically bind its given target.
- aptamers are nucleic acid based molecules, there is a fundamental difference between aptamers and other nucleic acid molecules such as genes and mR A. In the latter, the nucleic acid structure encodes information through its linear base sequence and thus this sequence is of importance to the function of information storage.
- aptamer function which is based upon the specific binding of a target molecule, is not entirely dependent on a conserved linear base sequence (a non-coding sequence), but rather a particular secondary/tertiary/quatemary structure. Any coding potential that an aptamer may possess is fortuitous and is not thought to play a role in the binding of an aptamer to its cognate target.
- Aptamers are differentiated from naturally occurring nucleic acid sequences that bind to certain proteins. These latter sequences are naturally occurring sequences embedded within the genome of the organism that bind to a specialized sub-group of proteins that are involved in the transcription, translation, and transportation of naturally occurring nucleic acids (e.g., nucleic acid-binding proteins).
- Aptamers on the other hand non-naturally occurring nucleic acid molecules. While aptamers can be identified that bind nucleic acid-binding proteins, in most cases such aptamers have little or no sequence identity to the sequences recognized by the nucleic acid-binding proteins in nature. More importantly, aptamers can bind virtually any protein (not just nucleic acid binding proteins) as well as almost any partner of interest including small molecules, carbohydrates, peptides, etc. For most partners, even proteins, a naturally occurring nucleic acid sequence to which it binds does not exist.
- aptamers are capable of specifically binding to selected partners and modulating the partner’s activity or binding interactions, e.g., through binding, aptamers may block their partner’s ability to function.
- the functional property of specific binding to a partner is an inherent property an aptamer.
- An aptamer can be 6-35 kDa.
- An aptamer can be from 20 to 500 nucleotides.
- An aptamer can bind its partner with micromolar to sub-nanomolar affinity, and may discriminate against closely related targets (e.g., aptamers may selectively bind related proteins from the same gene family). In some cases, an aptamer only binds one molecule. In some cases, an aptamer binds family members of a molecule of interest. An aptamer, in some cases, binds to multiple different molecules. Aptamers are capable of using commonly seen intermolecular interactions such as hydrogen bonding, electrostatic complementarities, hydrophobic contacts, and steric exclusion to bind with a specific partner.
- An aptamer can comprise a molecular stem and loop structure formed from the hybridization of complementary polynucleotides that are covalently linked (e.g., a hairpin loop structure).
- the stem comprises the hybridized polynucleotides and the loop is the region that covalently links the two complementary polynucleotides.
- An aptamer can be a linear ribonucleic acid (e.g., linear aptamer) comprising an aptamer sequence or a circular polyribonucleic acid comprising an aptamer sequence (e.g., a circular aptamer).
- linear ribonucleic acid e.g., linear aptamer
- circular polyribonucleic acid comprising an aptamer sequence (e.g., a circular aptamer).
- a target is a small molecule.
- a small molecule can be a macrocyclic molecule, an inhibitor, a drug, or chemical compound.
- a small molecule contains no more than five hydrogen bond donors.
- a small molecule contains no more than ten hydrogen bond acceptors.
- a small molecule has a molecular weight of 500 Daltons or less.
- a small molecule has a molecular weight of from about 180 to 500 Daltons.
- a small molecule contains an octanol-water partition coefficient lop P of no more than five.
- a small molecule has a partition coefficient log P of from -0.4 to 5.6. In some embodiments, a small molecule has a molar refractivity of from 40 to 130. In some embodiments, a small molecule contains from about 20 to about 70 atoms. In some embodiments, a small molecule has a polar surface area of 140 Angstroms 2 or less.
- circRNA comprises a binding site to a single target or a plurality of (e.g., two or more) targets.
- the single circRNA comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, or more different binding sites for a single target.
- the single circRNA comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, or more of the same binding sites for a single target.
- the single circRNA comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, or more different binding sites for one or more different targets.
- two or more targets are in a sample, such as a mixture or library of targets, and the sample comprises circRNA comprising two or more binding sites that bind to the two or more targets.
- a single target or a plurality of (e.g., two or more) targets have a plurality of binding moieties.
- the single target may have 2, 3, 4, 5, 6, 7, 8, 9, 10, or more binding moieties.
- two or more targets are in a sample, such as a mixture or library of targets, and the sample comprises two or more binding moieties.
- a single target or a plurality of targets comprise a plurality of different binding moieties.
- a plurality may include at least about 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 500, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, 11,000, 12,000, 13,000, 14,000, 15,000, 16,000, 17,000, 18,000, 19,000, 20,000, 25,000, or 30,000 binding moieties.
- a target can comprise a plurality of binding moieties comprising at least 2 different binding moieties.
- a binding moiety can comprise a plurality of binding moieties comprising at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, 11,000, 12,000, 13,000, 14,000, 15,000, 16,000, 17,000, 18,000, 19,000, 20,000, 21,000, 22,000, 23,000,
- the circular polyribonucleotide comprises one or more of the elements as described herein in addition to comprising a sequence encoding a protein (e.g., a therapeutic protein) and/or at least one binding site.
- the circular polyribonucleotide lacks a poly-A tail.
- the circular polyribonucleotide lacks a replication element.
- the circular polyribonucleotide lacks an IRES.
- the circular polyribonucleotide lacks a cap.
- the circular polyribonucleotide comprises any feature or any combination of features as disclosed in WO2019/118919, which is hereby incorporated by reference in its entirety.
- the circular polyribonucleotide comprises sequences encoding one or more polypeptides or peptides in addition to those dislosed above. Some examples include, but are not limited to, fluorescent tag or marker, antigen, peptide therapeutic, synthetic or analog peptide from naturally- bioactive peptide, agonist or antagonist peptide, anti-microbial peptide, pore-forming peptide, a bicyclic peptide, a targeting or cytotoxic peptide, a degradation or self-destruction peptide, and degradation or self-destruction peptides.
- the circular polyribonucleotide further comprises an expression sequence encoding an additional therapeutic protein as described herein. Further examples of regulatory elements are described in paragraphs [0151] - [0153] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- the circular polyribonucleotide comprises a regulatory element, e.g., a sequence that modifies expression of an expression sequence within the circular polyribonucleotide.
- a regulatory element may include a sequence that is located adjacent to an expression sequence that encodes an expression product.
- a regulatory element may be operably linked to the adjacent sequence.
- a regulatory element may increase an amount of product expressed as compared to an amount of the expressed product when no regulatory element is present.
- one regulatory element can increase an amount of products expressed for multiple expression sequences attached in tandem.
- one regulatory element can enhance the expression of one or more expression sequences.
- Multiple regulatory elements can also be used, for example, to differentially regulate expression of different expression sequences.
- a regulatory element as provided herein can include a selective translation sequence.
- the term“selective translation sequence” refers to a nucleic acid sequence that selectively initiates or activates translation of an expression sequence in the circular polyribonucleotide, for instance, certain riboswitch aptazymes.
- a regulatory element can also include a selective degradation sequence.
- the term“selective degradation sequence” refers to a nucleic acid sequence that initiates degradation of the circular polyribonucleotide, or an expression product of the circular
- the regulatory element is a translation modulator.
- a translation modulator can modulate translation of the expression sequence in the circular polyribonucleotide.
- a translation modulator can be a translation enhancer or suppressor.
- a translation initiation sequence can function as a regulatory element. Further examples of regulatory elements are described in paragraphs [0154] - [0161] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- the circular polyribonucleotide comprises a sequence encoding a protein (e.g., a therapeutic protein) and/or at least one binding site, and comprises a translation initiation sequence, e.g., a start codon.
- the translation initiation sequence includes a Kozak or Shine-Dalgamo sequence.
- the circular polyribonucleotide includes the translation initiation sequence, e.g., Kozak sequence, adjacent to an expression sequence.
- the translation initiation sequence is a non-coding start codon.
- the translation initiation sequence e.g., Kozak sequence
- the circular polyribonucleotide includes at least one translation initiation sequence adjacent to an expression sequence.
- the translation initiation sequence provides conformational flexibility to the circular polyribonucleotide.
- the translation initiation sequence is within a substantially single stranded region of the circular polyribonucleotide. Further examples of translation initiation sequences are described in paragraphs [0163] - [0165] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- a circular polyribonucleotide described herein comprises an internal ribosome entry site (IRES) element.
- IRES internal ribosome entry site
- a suitable IRES element to include in a circular polyribonucleotide can be an RNA sequence capable of engaging an eukaryotic ribosome. Further examples of an IRES are described in paragraphs [0166] - [0168] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- a circular polyribonucleotide can include one or more expression sequences (e.g., a therapeutic protein), and each expression sequence may or may not have a termination element. Further examples of termination elements are described in paragraphs [0169] - [0170] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- a circular polyribonucleotide of the disclosure can comprise a stagger element.
- stagger element refers to a moiety, such as a nucleotide sequence, that induces ribosomal pausing during translation.
- the stagger element may include a chemical moiety, such as glycerol, a non nucleic acid linking moiety, a chemical modification, a modified nucleic acid, or any combination thereof.
- the circular polyribonucleotide includes at least one stagger element adjacent to an expression sequence. In some embodiments, the circular polyribonucleotide includes a stagger element adjacent to each expression sequence. In some embodiments, the stagger element is present on one or both sides of each expression sequence, leading to separation of the expression products, e.g., peptide(s) and/or polypeptide(s). In some embodiments, the stagger element is a portion of the one or more expression sequences. In some embodiments, the circular polyribonucleotide comprises one or more expression sequences, and each of the one or more expression sequences is separated from a succeeding expression sequence by a stagger element on the circular polyribonucleotide.
- the stagger element prevents generation of a single polypeptide (a) from two rounds of translation of a single expression sequence or (b) from one or more rounds of translation of two or more expression sequences.
- the stagger element is a sequence separate from the one or more expression sequences.
- the stagger element comprises a portion of an expression sequence of the one or more expression sequences.
- the circular polyribonucleotide comprises one or more regulatory nucleic acid sequences or comprises one or more expression sequences that encode regulatory nucleic acid, e.g., a nucleic acid that modifies expression of an endogenous gene and/or an exogenous gene.
- the expression sequence of a circular polyribonucleotide as provided herein can comprise a sequence that is antisense to a regulatory nucleic acid like a non-coding RNA, such as, but not limited to, tRNA, IncRNA, miRNA, rRNA, snRNA, microRNA, siRNA, piRNA, snoRNA, snRNA, exRNA, scaRNA, Y RNA, and hnRNA.
- a non-coding RNA such as, but not limited to, tRNA, IncRNA, miRNA, rRNA, snRNA, microRNA, siRNA, piRNA, snoRNA, snRNA, exRNA, scaRNA, Y RNA, and hnRNA.
- the translation efficiency of a circular polyribonucleotide as provided herein is greater than a reference, e.g., a linear counterpart, a linear expression sequence, or a linear circular polyribonucleotide.
- a circular polyribonucleotide as provided herein has the translation efficiency that is at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 350%, 400%, 450%, 500%, 600%, 70%, 800%, 900%, 1000%, 2000%, 5000%, 10000%, 100000%, or more greater than that of a reference.
- a circular polyribonucleotide has a translation efficiency 10% greater than that of a linear counterpart.
- a circular polyribonucleotide has a translation efficiency 300% greater than that of a linear counterpart.
- the circular polyribonucleotide produces stoichiometric ratios of expression products. Rolling circle translation continuously produces expression products at substantially equivalent ratios. In some embodiments, the circular polyribonucleotide has a stoichiometric translation efficiency, such that expression products are produced at substantially equivalent ratios. In some embodiments, the circular polyribonucleotide has a stoichiometric translation efficiency of multiple expression products, e.g., products from 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more expression sequences.
- the ribosome bound to the circular polyribonucleotide does not disengage from the circular
- the circular polyribonucleotide as described herein is competent for rolling circle translation.
- the ribosome bound to the circular polyribonucleotide does not disengage from the circular polyribonucleotide before finishing at least 2 rounds, at least 3 rounds, at least 4 rounds, at least 5 rounds, at least 6 rounds, at least 7 rounds, at least 8 rounds, at least 9 rounds, at least 10 rounds, at least 11 rounds, at least 12 rounds, at least 13 rounds, at least 14 rounds, at least 15 rounds, at least 20 rounds, at least 30 rounds, at least 40 rounds, at least 50 rounds, at least 60 rounds, at least 70 rounds, at least 80 rounds, at least 90 rounds, at least 100 rounds, at least 150 rounds, at least 200 rounds, at least 250 rounds, at least 500 rounds, at least 1000 rounds, at
- the rolling circle translation of the circular polyribonucleotide leads to generation of polypeptide product that is translated from more than one round of translation of the circular polyribonucleotide (“continuous” expression product).
- the circular polyribonucleotide comprises a stagger element, and rolling circle translation of the circular
- polyribonucleotide leads to generation of polypeptide product that is generated from a single round of translation or less than a single round of translation of the circular polyribonucleotide (“discrete” expression product).
- the circular polyribonucleotide is configured such that at least 10%, 20%, 30%, 40%, 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% of total polypeptides (molar/molar) generated during the rolling circle translation of the circular polyribonucleotide are discrete polypeptides.
- the amount ratio of the discrete products over the total polypeptides is tested in an in vitro translation system.
- the in vitro translation system used for the test of amount ratio comprises rabbit reticulocyte lysate.
- the amount ratio is tested in an in vivo translation system, such as a eukaryotic cell or a prokaryotic cell, a cultured cell or a cell in an organism.
- the circular polyribonucleotide comprises untranslated regions (UTRs).
- UTRs of a genomic region comprising a gene may be transcribed but not translated.
- a UTR may be included upstream of the translation initiation sequence of an expression sequence described herein. In some embodiments, a UTR may be included downstream of an expression sequence described herein. In some instances, one UTR for first expression sequence is the same as or continuous with or overlapping with another UTR for a second expression sequence. In some
- the intron is a human intron. In some embodiments, the intron is a full-length human intron, e.g., ZKSCAN1.
- the circular polyribonucleotide may include a poly-A sequence.
- Exemplary poly-A sequences are described in paragraphs [0202] - [0205] of WO2019/118919, which is hereby incorporated by reference in its entirety hi some embodiments, the circular polyribonucleotide lacks a poly-A sequence.
- the circular polyribonucleotide comprises one or more riboswitches.
- Exemplary riboswitches are described in paragraphs [0232] - [0252] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- the circular polyribonucleotide comprises an aptazyme.
- aptazymes are described in paragraphs [0253] - [0259] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- the circular polyribonucleotide comprises one or more RNA binding sites.
- microRNAs or miRNA
- the circular polyribonucleotide may comprise one or more microRNA target sequences, microRNA sequences, or microRNA seeds. Such sequences may correspond to any known microRNA, such as those taught in US Publication US2005/0261218 and US Publication US2005/0059005, the contents of which are incorporated herein by reference in their entirety. Further examples of RNA binding sites are described in paragraphs [0206] - [0215] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- the circular polyribonucleotide includes one or more protein binding sites that enable a protein, e.g., a ribosome, to bind to an internal site in the RNA sequence.
- protein binding sites are described in paragraphs [0218] - [0221] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- the circular polyribonucleotide comprises an encryptogen to reduce, evade or avoid the innate immune response of a cell.
- an encryptogen to reduce, evade or avoid the innate immune response of a cell.
- polyribonucleotide which when delivered to cells (e.g., contacting), results in a reduced immune response from the host as compared to the response triggered by a reference compound, e.g. a linear polynucleotide corresponding to the described circular polyribonucleotide or a circular polyribonucleotide lacking an encryptogen.
- a reference compound e.g. a linear polynucleotide corresponding to the described circular polyribonucleotide or a circular polyribonucleotide lacking an encryptogen.
- the circular polyribonucleotide has less immunogenicity than a counterpart lacking an encryptogen.
- an encryptogen enhances stability.
- the regulatory features of a UTR may be included in the encryptogen to enhance the stability of the circular polyribonucleotide.
- 5’ or 3’UTRs can constitute encryptogens in a circular polyribonucleotide.
- removal or modification of UTR AU rich elements (AREs) may be useful to modulate the stability or immunogenicity of the circular polyribonucleotide.
- an encryptogen comprises miRNA binding site or binding site to any other non-coding RNAs.
- incorporation of miR-142 sites into the circular polyribonucleotide described herein may not only modulate expression in hematopoietic cells, but also reduce or abolish immune responses to a protein encoded in the circular polyribonucleotide.
- an encyptogen comprises one or more protein binding sites that enable a protein, e.g., an immunoprotein, to bind to the RNA sequence.
- a protein e.g., an immunoprotein
- the circular polyribonucleotide may evade or have reduced detection by the host’s immune system, have modulated degradation, or modulated translation, by masking the circular polyribonucleotide from components of the host’s immune system.
- the circular polyribonucleotide comprises at least one immunoprotein binding site, for example to evade immune reponses, e.g., CTL responses.
- the immunoprotein binding site is a nucleotide sequence that binds to an immunoprotein and aids in masking the circular polyribonucleotide as exogenous.
- an encryptogen comprises one or more modified nucleotides.
- exemplary modifications can include any modification to the sugar, the nucleobase, the intemucleoside linkage (e.g. to a linking phosphate / to a phosphodiester linkage / to the phosphodiester backbone), and any combination thereof that can prevent or reduce immune response against the circular polyribonucleotide.
- the circular polyribonucleotide includes one or more modifications as described elsewhere herein to reduce an immune response from the host as compared to the response triggered by a reference compound, e.g. a circular polyribonucleotide lacking the modifications.
- a reference compound e.g. a circular polyribonucleotide lacking the modifications.
- the addition of one or more inosine has been shown to discriminate RNA as endogenous versus viral. See for example, Yu, Z. et al. (2015) RNA editing by ADAR1 marks dsRNA as“self’. Cell Res.
- the circular polyribonucleotide includes one or more expression sequences for shRNA or an RNA sequence that can be processed into siRNA, and the shRNA or siRNA targets RIG-I and reduces expression of RIG-I.
- RIG-I can sense foreign circular RNA and leads to degradation of foreign circular RNA. Therefore, a circular polynucleotide harboring sequences for RIG-I-targeting shRNA, siRNA or any other regulatory nucleic acids can reduce immunity, e.g., host cell immunity, against the circular polyribonucleotide.
- the circular polyribonucleotide lacks a sequence, element or structure, that aids the circular polyribonucleotide in reducing, evading or avoiding an innate immune response of a cell.
- the circular polyribonucleotide may lack a polyA sequence, a 5’ end, a 3’ end, phosphate group, hydroxyl group, or any combination thereof.
- the circular polyribonucleotide comprises a spacer sequence.
- elements of a polyribonucleotide may be separated from one another by a spacer sequence or linker. Exemplary of spacer sequences are described in paragraphs [0293] - [0302] of
- the circular polyribonucleotide described herein may also comprise a non-nucleic acid linker.
- Exemplary non-nucleic acid linkers are described in paragraphs [0303] - [0307] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- the circular polyribonucleotide further includes another nucleic acid sequence.
- the circular polyribonucleotide may comprise other sequences that include DNA, RNA, or artificial nucleic acids.
- the other sequences may include, but are not limited to, genomic DNA, cDNA, or sequences that encode tRNA, mRNA, rRNA, miRNA, gRNA, siRNA, or other RNAi molecules.
- the circular polyribonucleotide includes an siRNA to target a different locus of the same gene expression product as the circular polyribonucleotide.
- the circular polyribonucleotide includes an siRNA to target a different gene expression product than a gene expression product that is present in the circular polyribonucleotide.
- the circular polyribonucleotide lacks a 5’-UTR. In some embodiments, the circular polyribonucleotide lacks a 3’-UTR. In some embodiments, the circular polyribonucleotide lacks a poly-A sequence. In some embodiments, the circular polyribonucleotide lacks a termination element. In some embodiments, the circular polyribonucleotide lacks an internal ribosomal entry site. In some embodiments, the circular polyribonucleotide lacks degradation susceptibility by exonucleases.
- the fact that the circular polyribonucleotide lacks degradation susceptibility can mean that the circular polyribonucleotide is not degraded by an exonuclease, or only degraded in the presence of an exonuclease to a limited extent, e.g., that is comparable to or similar to in the absence of exonuclease.
- the circular polyribonucleotide is not degraded by exonucleases.
- the circular polyribonucleotide has reduced degradation when exposed to exonuclease.
- the circular polyribonucleotide lacks binding to a cap-binding protein In some embodiments, the circular polyribonucleotide lacks a 5’ cap.
- the circular polyribonucleotide lacks a 5’-UTR and is competent for protein expression from its one or more expression sequences. In some embodiments, the circular polyribonucleotide lacks a 3’-UTR and is competent for protein expression from its one or more expression sequences. In some embodiments, the circular polyribonucleotide lacks a poly-A sequence and is competent for protein expression from its one or more expression sequences. In some embodiments, the circular polyribonucleotide lacks a termination element and is competent for protein expression from its one or more expression sequences.
- the circular polyribonucleotide lacks an internal ribosomal entry site and is competent for protein expression from its one or more expression sequences. In some embodiments, the circular polyribonucleotide lacks a cap and is competent for protein expression from its one or more expression sequences. In some embodiments, the circular polyribonucleotide
- the circular polyribonucleotide lacks a 5’-UTR, a 3’-UTR, and an IRES, and is competent for protein expression from its one or more expression sequences.
- the circular polyribonucleotide comprises one or more of the following sequences: a sequence that encodes one or more miRNAs, a sequence that encodes one or more replication proteins, a sequence that encodes an exogenous gene, a sequence that encodes a therapeutic, a regulatory element (e.g., translation modulator, e.g., translation enhancer or suppressor), a translation initiation sequence, one or more regulatory nucleic acids that targets endogenous genes (e.g., siRNA, IncRNAs, shRNA), and a sequence that encodes a therapeutic mRNA or protein.
- a regulatory element e.g., translation modulator, e.g., translation enhancer or suppressor
- a translation initiation sequence e.g., one or more regulatory nucleic acids that targets endogenous genes (
- the circular polyribonucleotide may include certain
- the circular polyribonucleotide is less susceptible to degradation by exonuclease as compared to linear RNA. As such, the circular
- polyribonucleotide can be more stable than a linear RNA, especially when incubated in the presence of an exonuclease.
- the increased stability of the circular polyribonucleotide compared with linear RNA can make the circular polyribonucleotide more useful as a cell transforming reagent to produce polypeptides (e.g., antigens and/or epitopes to elicit antibody responses).
- the increased stability of the circular polyribonucleotide compared with linear RNA can make the circular polyribonucleotide easier to store for long than linear RNA.
- the stability of the circular polyribonucleotide treated with exonuclease can be tested using methods standard in art which determine whether RNA degradation has occurred (e.g., by gel electrophoresis).
- the circular polyribonucleotide can be less susceptible to dephosphorylation when the circular polyribonucleotide is incubated with phosphatase, such as calf intestine phosphatase.
- the circular polyribonucleotide comprises particular sequence
- the circular polyribonucleotide may comprise a particular nucleotide composition.
- the circular polyribonucleotide may include one or more purine (adenine and/or guanosine) rich regions.
- the circular polyribonucleotide may include one or more purine poor regions.
- the circular polyribonucleotide may include one or more AU rich regions or elements (AREs).
- the circular polyribonucleotide may include one or more AU rich regions or elements (AREs).
- the circular AREs AU rich regions or elements
- polyribonucleotide may include one or more adenine rich regions.
- the circular polyribonucleotide may include one or more repetitive elements described elsewhere herein. In some embodiments, the circular polyribonucleotide comprises one or more modifications described elsewhere herein.
- a circular polyribonucleotide may include one or more substitutions, insertions and/or additions, deletions, and covalent modifications with respect to reference sequences.
- circular polyribonucleotides with one or more insertions, additions, deletions, and/or covalent modifications relative to a parent polyribonucleotide are included within the scope of this disclosure. Exemplary modifications are described in paragraphs [0310] - [0325] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- the circular polyribonucleotide comprises a higher order structure, e.g., a secondary or tertiary structure.
- complementary segments of the circular polyribonucleotide fold itself into a double stranded segment, held together with hydrogen bonds between pairs, e.g., A-U and C-G.
- helices also known as stems, are formed intra- molecularly, having a double-stranded segment connected to an end loop.
- the circular polyribonucleotide has at least one segment with a quasi -double-stranded secondary structure.
- one or more sequences of the circular polyribonucleotide include substantially single stranded vs double stranded regions.
- the ratio of single stranded to double stranded may influence the functionality of the circular polyribonucleotide.
- one or more sequences of the circular polyribonucleotide that are substantially single stranded. In some embodiments, one or more sequences of the circular polyribonucleotide that are substantially single stranded. In some embodiments, one or more sequences of the circular polyribonucleotide that are substantially single stranded.
- polyribonucleotide that are substantially single stranded may include a protein- or R A-binding site.
- the circular polyribonucleotide sequences that are substantially single stranded may be conformationally flexible to allow for increased interactions.
- the sequence of the circular polyribonucleotide is purposefully engineered to include such secondary structures to bind or increase protein or nucleic acid binding.
- the circular polyribonucleotide sequences that are substantially double stranded may include a conformational recognition site, e.g., a riboswitch or aptazyme.
- the circular polyribonucleotide sequences that are substantially double stranded may be conformationally rigid. In some such instances, the conformationally rigid sequence may sterically hinder the circular polyribonucleotide from binding a protein or a nucleic acid.
- the sequence of the circular polyribonucleotide is purposefully engineered to include such secondary structures to avoid or reduce protein or nucleic acid binding.
- the circular polyribonucleotide has a quasi-helical structure. In some embodiments, the circular polyribonucleotide has at least one segment with a quasi -helical structure. In some embodiments, the circular polyribonucleotide includes at least one of a U-rich or A-rich sequence or a combination thereof. In some embodiments, the U-rich and/or A-rich sequences are arranged in a manner that would produce a triple quasi-helix structure. In some embodiments, the circular polyribonucleotide has a double quasi-helical structure.
- the circular polyribonucleotide has one or more segments (e.g., 2, 3, 4, 5, 6, or more) having a double quasi-helical structure.
- the circular polyribonucleotide includes at least one of a C-rich and/or G-rich sequence.
- the C- rich and/or G-rich sequences are arranged in a manner that would produce triple quasi-helix structure.
- the circular polyribonucleotide has an intramolecular triple quasi-helix structure that aids in stabilization.
- the circular polyribonucleotide has two quasi-helical structure (e.g., separated by a phosphodiester linkage), such that their terminal base pairs stack, and the quasi -helical structures become colinear, resulting in a“coaxially stacked” substructure.
- the circular polyribonucleotide comprises a tertiary structure with one or more motifs, e.g., a pseudoknot, a g-quadruplex, a helix, and coaxial stacking.
- motifs e.g., a pseudoknot, a g-quadruplex, a helix, and coaxial stacking.
- a circular polyribonucleotide as disclosed herein comprises a conjugation moiety for conjugation of the circular polyribonucleotide to, for example, to a chemical compound (e.g., a small molecule), an antibody or fragment thereof, a peptide, a protein, an aptamer, a drug, or a combination thereof.
- a small molecule can be conjugated to a circRNA, thereby generating a circRNA comprising a small molecule.
- the circRNA comprises at least two conjugation moieties, e.g., a first conjugation moiety that binds to a first small molecule (e.g., JQ1) and a second conjugation molecule that binds to a second small molecule (e.g., thalidomide).
- the circRNA comprises a conjugation moiety that binds to a small molecule (e.g., thalidomide) and a binding site that binds to a protein (e.g., BRIM).
- the circular polyribonucleotide is at least about 20 nucleotides, at least about 30 nucleotides, at least about 40 nucleotides, at least about 50 nucleotides, at least about 75 nucleotides, at least about 100 nucleotides, at least about 200 nucleotides, at least about 300 nucleotides, at least about 400 nucleotides, at least about 500 nucleotides, at least about 1,000 nucleotides, at least about 2,000 nucleotides, at least about 5,000 nucleotides, at least about 6,000 nucleotides, at least about 7,000 nucleotides, at least about 8,000 nucleotides, at least about 9,000 nucleotides, at least about 10,000 nucleotides, at least about 12,000 nucleotides, at least about 14,000 nucleotides, at least about 15,000 nucleotides, at least about 16,000 nucleotides, at least about 17,000
- the circular polyribonucleotide may be of a sufficient size to accommodate a binding site for a ribosome.
- the maximum size of a circular polyribonucleotide can be as large as is within the technical constraints of producing a circular polyribonucleotide, and/or using the circular polyribonucleotide. While not being bound by theory, it is possible that multiple segments of RNA may be produced from DNA and their 5' and 3' free ends annealed to produce a "string" of RNA, which ultimately may be circularized when only one 5' and one 3' free end remains. In some
- the maximum size of a circular polyribonucleotide may be limited by the ability of packaging and delivering the RNA to a target. In some embodiments, the size of a circular polyribonucleotide
- polyribonucleotide is a length sufficient to encode useful polypeptides, and thus, lengths of at least 20,000 nucleotides, at least 15,000 nucleotides, at least 10,000 nucleotides, at least 7,500 nucleotides, or at least 5,000 nucleotides, at least 4,000 nucleotides, at least 3,000 nucleotides, at least 2,000 nucleotides, at least 1,000 nucleotides, at least 500 nucleotides, at least 1 400 nucleotides, at least 300 nucleotides, at least 200 nucleotides, at least 100 nucleotides may be useful.
- the circular polyribonucleotide is capable of replicating or replicates in a cell from an aquaculture animal (fish, crabs, shrimp, oysters etc.), a mammalian cell, e.g., a cell from a pet or zoo animal (cats, dogs, lizards, birds, lions, tigers and bears etc.), a cell from a farm or working animal (horses, cows, pigs, chickens etc.), a human cell, cultured cells, primary cells or cell lines, stem cells, progenitor cells, differentiated cells, germ cells, cancer cells (e.g., tumorigenic, metastic), non- tumorigenic cells (normal cells), fetal cells, embryonic cells, adult cells, mitotic cells, non-mitotic cells, or any combination thereof.
- an aquaculture animal fish, crabs, shrimp, oysters etc.
- a mammalian cell e.g., a cell from a pet or zoo animal (cats, dogs,
- the invention includes a cell comprising the circular polyribonucleotide described herein, wherein the cell is a cell from an aquaculture animal (fish, crabs, shrimp, oysters etc.), a mammalian cell, e.g., a cell from a pet or zoo animal (cats, dogs, lizards, birds, lions, tigers and bears etc.), a cell from a farm or working animal (horses, cows, pigs, chickens etc.), a human cell, a cultured cell, a primary cell or a cell line, a stem cell, a progenitor cell, a differentiated cell, a germ cell, a cancer cell (e.g., tumorigenic, metastic), a non-tumorigenic cell (normal cells), a fetal cell, an embryonic cell, an adult cell, a mitotic cell, a non-mitotic cell, or any combination thereof.
- an aquaculture animal fish, crabs, shrimp, oysters etc
- a circular polyribonucleotide provided herein has increased half-life over a reference, e.g., a linear polyribonucleotide having the same nucleotide sequence that is not circularized (linear counterpart).
- the circular polyribonucleotide is substantially resistant to degradation, e.g., exonuclease degradation.
- the circular polyribonucleotide is resistant to self-degradation.
- the circular polyribonucleotide lacks an enzymatic cleavage site, e.g., a dicer cleavage site. Further examples of stability and half life of circular
- the circular polyribonucleotide has a half-life of at least that of a linear counterpart, e.g., linear expression sequence, or linear circular polyribonucleotide. In some embodiments, the circular polyribonucleotide has a half-life that is increased over that of a linear counterpart. In some embodiments, the half-life is increased by about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, or greater.
- the circular polyribonucleotide has a half-life or persistence in a cell for at least about 1 hr to about 30 days, or at least about 2 hrs, 6 hrs, 12 hrs, 18 hrs, 24 hrs, 2 days, 3, days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days,
- the circular polyribonucleotide has a half-life or persistence in a cell for no more than about 10 mins to about 7 days, or no more than about 1 hr, 2 hrs, 3 hrs, 4 hrs, 5 hrs, 6 hrs, 7 hrs, 8 hrs, 9 hrs, 10 hrs, 11 hrs, 12 hrs, 13 hrs, 14 hrs, 15 hrs, 16 hrs, 17 hrs, 18 hrs, 19 hrs, 20 hrs, 21 hrs, 22 hrs, 24 hrs, 36 hrs, 48 hrs, 60 hrs, 72 hrs, 4 days, 5 days, 6 days, 7 days, or any time therebetween.
- the circular polyribonucleotide has a half-life or persistence in a cell while the cell is dividing. In some embodiments, the circular polyribonucleotide has a half-life or persistence in a cell post division. In certain embodiments,
- the circular polyribonucleotide has a half-life or persistence in a dividing cell for greater than about 10 minutes to about 30 days, or at least about 1 hr, 2 hrs, 3 hrs, 4 hrs, 5 hrs, 6 hrs, 7 hrs,
- At least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% of an amount of the circular polyribonucleotide persists for a time period of at least about 3, 4, 5, 6, 7, 8,
- the circular polyribonucleotide is non-immunogenic in a mammal, e.g., a human.
- the circular polyribonucleotide includes a deoxyribonucleic acid sequence that is non-naturally occurring and can be produced using recombinant technology (e.g., derived in vitro using a DNA plasmid), chemical synthesis, or a combination thereof.
- a DNA molecule used to produce an RNA circle can comprise a DNA sequence of a naturally-occurring original nucleic acid sequence, a modified version thereof, or a DNA sequence encoding a synthetic polypeptide not normally found in nature (e.g., chimeric molecules or fusion proteins, such as fusion proteins comprising multiple antigens and/or epitopes).
- DNA and RNA molecules can be modified using a variety of techniques including, but not limited to, classic mutagenesis techniques and recombinant techniques, such as site-directed mutagenesis, chemical treatment of a nucleic acid molecule to induce mutations, restriction enzyme cleavage of a nucleic acid fragment, ligation of nucleic acid fragments, polymerase chain reaction (PCR) amplification and/or mutagenesis of selected regions of a nucleic acid sequence, synthesis of oligonucleotide mixtures and ligation of mixture groups to "build" a mixture of nucleic acid molecules and combinations thereof.
- classic mutagenesis techniques and recombinant techniques such as site-directed mutagenesis
- chemical treatment of a nucleic acid molecule to induce mutations
- restriction enzyme cleavage of a nucleic acid fragment ligation of nucleic acid fragments
- PCR polymerase chain reaction
- the circular polyribonucleotide may be prepared according to any available technique including, but not limited to chemical synthesis and enzymatic synthesis.
- a linear primary construct or linear mRNA may be cyclized, or concatemerized to create a circular polyribonucleotide described herein.
- the mechanism of cyclization or concatemerization may occur through methods such as, but not limited to, chemical, enzymatic, splint ligation), or ribozyme catalyzed methods.
- the newly formed 5 '-/3 '-linkage may be an intramolecular linkage or an intermolecular linkage.
- the circular polyribonucleotides is purified, e.g., free ribonucleic acids, linear or nicked RNA, DNA, proteins, etc are removed.
- the circular polyribonucleotides is purified, e.g., free ribonucleic acids, linear or nicked RNA, DNA, proteins, etc are removed.
- the circular polyribonucleotides is purified, e.g., free ribonucleic acids, linear or nicked RNA, DNA, proteins, etc are removed.
- the circular polyribonucleotides is purified, e.g., free ribonucleic acids, linear or nicked RNA, DNA, proteins, etc are removed.
- the circular polyribonucleotides is purified, e.g., free ribonucleic acids, linear or nicked RNA, DNA, proteins, etc are removed.
- the circular polyribonucleotides is purified, e.g.
- polyribonucleotides may be purified by any known method commonly used in the art. Examples of nonlimiting purification methods include, column chromatography, gel excision, size exclusion, etc.
- a linear circular polyribonucleotide may be cyclized, or concatemerized.
- the linear circular polyribonucleotide may be cyclized in vitro prior to formulation and/or delivery. In some embodiments, the linear circular polyribonucleotide may be cyclized within a cell.
- the linear circular polyribonucleotide is cyclized, or concatemerized using a chemical method to form a circular polyribonucleotide.
- the 5 '-end and the 3'-end of the nucleic acid includes chemically reactive groups that, when close together, may form a new covalent linkage between the 5'-end and the 3'-end of the molecule.
- the 5'-end may contain an NHS-ester reactive group and the 3'-end may contain a 3'-amino- terminated nucleotide such that in an organic solvent the 3'-amino-terminated nucleotide on the 3'-end of a linear RNA molecule will undergo a nucleophilic attack on the 5'-NHS-ester moiety forming a new 5'- /3' -amide bond.
- a DNA or RNA ligase may be used to enzymatically link a 5'- phosphorylated nucleic acid molecule (e.g., a linear circular polyribonucleotide) to the 3'-hydroxyl group of a nucleic acid (e.g., a linear nucleic acid) forming a new phosphorodiester linkage.
- a linear circular polyribonucleotide is incubated at 37°C for 1 hour with 1-10 units of T4 RNA ligase (New England Biolabs, Ipswich, MA) according to the manufacturer's protocol.
- the ligation reaction may occur in the presence of a linear nucleic acid capable of base -pairing with both the 5'- and 3'- region in juxtaposition to assist the enzymatic ligation reaction.
- the ligation is splint ligation.
- a splint ligase like SplintR® ligase, can be used for splint ligation.
- a single stranded polynucleotide like a single stranded RNA, can be designed to hybridize with both termini of a linear polyribonucleotide, so that the two termini can be juxtaposed upon hybridization with the single-stranded splint.
- Splint ligase can thus catalyze the ligation of the juxtaposed two termini of the linear polyribonucleotide, generating a circular polyribonucleotide.
- a DNA or RNA ligase may be used in the synthesis of the circular polynucleotides.
- the ligase may be a circ ligase or circular ligase.
- either the 5 '-or 3 '-end of the linear circular polyribonucleotide can encode a ligase ribozyme sequence such that during in vitro transcription, the resultant linear circular polyribonucleotide includes an active ribozyme sequence capable of ligating the 5 '-end of the linear circular polyribonucleotide to the 3 '-end of the linear circular polyribonucleotide.
- the ligase ribozyme may be derived from the Group I Intron, Hepatitis Delta Virus, Hairpin ribozyme or may be selected by SELEX (systematic evolution of ligands by exponential enrichment). The ribozyme ligase reaction may take 1 to 24 hours at temperatures between 0 and 37°C.
- a linear circular polyribonucleotide may be cyclized or concatermerized by using at least one non-nucleic acid moiety.
- the at least one non-nucleic acid moiety may react with regions or features near the 5' terminus and/or near the 3' terminus of the linear circular polyribonucleotide in order to cyclize or concatermerize the linear circular polyribonucleotide.
- the at least one non-nucleic acid moiety may be located in or linked to or near the 5' terminus and/or the 3' terminus of the linear circular polyribonucleotide.
- the non-nucleic acid moieties contemplated may be homologous or heterologous.
- the non-nucleic acid moiety may be a linkage such as a hydrophobic linkage, ionic linkage, a biodegradable linkage and/or a cleavable linkage.
- the non-nucleic acid moiety is a ligation moiety.
- the non-nucleic acid moiety may be an oligonucleotide or a peptide moiety, such as an apatamer or a non-nucleic acid linker as described herein.
- a linear circular polyribonucleotide may be cyclized or concatermerized due to a non-nucleic acid moiety that causes an attraction between atoms, molecular surfaces at, near or linked to the 5' and 3' ends of the linear circular polyribonucleotide.
- one or more linear circular polyribonucleotides may be cyclized or concatermized by intermolecular forces or intramolecular forces.
- intermolecular forces include dipole-dipole forces, dipole-induced dipole forces, induced dipole -induced dipole forces, Van der Waals forces, and London dispersion forces.
- Non-limiting examples of intramolecular forces include covalent bonds, metallic bonds, ionic bonds, resonant bonds, agnostic bonds, dipolar bonds, conjugation, hyperconjugation and antibonding.
- the linear circular polyribonucleotide may comprise a ribozyme RNA sequence near the 5' terminus and near the 3' terminus.
- the ribozyme RNA sequence may covalently link to a peptide when the sequence is exposed to the remainder of the ribozyme.
- the peptides covalently linked to the ribozyme RNA sequence near the 5' terminus and the 3 'terminus may associate with each other causing a linear circular polyribonucleotide to cyclize or concatemerize.
- the peptides covalently linked to the ribozyme RNA near the 5' terminus and the 3' terminus may cause the linear primary construct or linear mRNA to cyclize or concatemerize after being subjected to ligated using various methods known in the art such as, but not limited to, protein ligation.
- ribozymes for use in the linear primary constructs or linear RNA of the present invention or a non-exhaustive listing of methods to incorporate and/or covalently link peptides are described in US patent application No. US20030082768, the contents of which is here in incorporated by reference in its entirety.
- the linear circular polyribonucleotide may include a 5' triphosphate of the nucleic acid converted into a 5' monophosphate, e.g., by contacting the 5' triphosphate with RNA 5' pyrophosphohydrolase (RppH) or an ATP diphosphohydrolase (apyrase).
- RppH RNA 5' pyrophosphohydrolase
- apyrase ATP diphosphohydrolase
- converting the 5' triphosphate of the linear circular polyribonucleotide into a 5' monophosphate may occur by a two-step reaction comprising: (a) contacting the 5' nucleotide of the linear circular polyribonucleotide with a phosphatase (e.g., Antarctic Phosphatase, Shrimp Alkaline Phosphatase, or Calf Intestinal Phosphatase) to remove all three phosphates; and (b) contacting the 5' nucleotide after step (a) with a kinase (e.g., Polynucleotide Kinase) that adds a single phosphate.
- a phosphatase e.g., Antarctic Phosphatase, Shrimp Alkaline Phosphatase, or Calf Intestinal Phosphatase
- the circularization efficiency of the circularization methods provided herein is at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or 100%. In some embodiments, the circularization efficiency of the circularization methods provided herein is at least about 40%.
- the circular polyribonucleotide includes at least one splicing element.
- Exemplary splicing elements are described in paragraphs [0270] - [0275] of WO2019/118919, which is hereby incorporated by reference in its entirety.
- linear circular polyribonucleotides may include complementary sequences, including either repetitive or nonrepetitive nucleic acid sequences within individual introns or across flanking introns. Repetitive nucleic acid sequence are sequences that occur within a segment of the circular polyribonucleotide.
- the circular polyribonucleotide includes a repetitive nucleic acid sequence.
- the repetitive nucleotide sequence includes poly CA or poly UG sequences.
- the circular polyribonucleotide includes at least one repetitive nucleic acid sequence that hybridizes to a complementary repetitive nucleic acid sequence in another segment of the circular polyribonucleotide, with the hybridized segment forming an internal double strand.
- repetitive nucleic acid sequences and complementary repetitive nucleic acid sequences from two separate circular polyribonucleotides hybridize to generate a single circularized polyribonucleotide, with the hybridized segments forming internal double strands.
- the complementary sequences are found at the 5’ and 3’ ends of the linear circular polyribonucleotides.
- the complementary sequences include about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
- chemical methods of circularization may be used to generate the circular polyribonucleotide.
- Such methods may include, but are not limited to click chemistry (e.g., alkyne and azide based methods, or clickable bases), olefin metathesis, phosphoramidate ligation, hemiaminal-imine crosslinking, base modification, and any combination thereof.
- enzymatic methods of circularization may be used to generate the circular polyribonucleotide.
- a ligation enzyme e.g., DNA or RNA ligase
- DNA or RNA ligase may be used to generate a template of the circular polyribonuclease or complement, a complementary strand of the circular polyribonuclease, or the circular polyribonuclease.
- Circularization of the circular polyribonucleotide may be accomplished by methods known in the art, for example, those described in“RNA circularization strategies in vivo and in vitro” by Petkovic and Muller from Nucleic Acids Res, 2015, 43(4): 2454-2465, and“In vitro circularization of RNA” by Muller and Appel, from RNA Biol, 2017, 14(8): 1018-1027.
- the circular polyribonucleotide may encode a sequence and/or motifs useful for replication. Exemplary replication elements are described in paragraphs [0280] - [0286] of WO2019/118919, which is hereby incorporated by reference in its entirety. In some embodiments, the circular polyribonucleotide as disclosed herein lacks a replication element.
- the circular polyribonucleotide lacks a poly-A sequence and a replication element.
- any of the circular polyribonucleotides described herein in a method administration, wherein the method comprises providing a first does of a circular polyribonucleotide to a plurality of cells, followed by providing a second dose of the circular polyribonucleotide to the plurality of cells. It is also within the scope of this disclosure to use any of the circular polyribonucleotides described herein in a composition administration.
- polyribonucleotide may comprise one or more of an expression sequence, a regulatory element, or an untranslated region.
- the circular polyribonucleotide may be competent for rolling circle translation.
- the circular polyribonucleotide lacks a termination element.
- the circular polyribonucleotide may comprise a stagger element at the 3’ end of at least one of the expression sequences.
- the stagger element stalls a ribosome during rolling circle translation.
- the stagger element may encode a sequence with a C-terminal consensus sequence that is
- polyribonucleotide lacks an internal ribosomal entry site.
- one or more of the expression sequences comprise a Kozak initiation sequence.
- the circular polyribonucleotide may comprise a termination element, e.g., a stop codon.
- the circular polyribonucleotide comprises one or more of an encryptogen, a regulatory element, at replication element, or a quasi-double- stranded secondary structure.
- the circular polyribonucleotide may comprise one or more functional characteristics, e.g., greater translation efficiency than a linear counterpart, a stoichiometric translation efficiency of multiple translation products, less immunogenicity than a counterpart lacking an encryptogen, increased half-life over a linear counterpart, or persistence during cell division.
- the circular polyribonucleotide may comprise a replication domain, enabling self-replication of the circular polyribonucleotide.
- the method of the present invention comprises providing or administering compositions in combination with one or more pharmaceutically acceptable excipients.
- a composition of a circular polyribonucleotide may be used or administered as a pharmaceutical composition, using any of the dosing, redosing, or staggered dosing methods described herein.
- the circular polyribonucleotide compositions described herein may be provided or administered in a variety of different dosages and at a variety of different concentrations.
- the circular polyribonucleotide composition may be provided or administered as a pharmaceutical composition.
- the pharmaceutical composition may comprise one or more pharmaceutically relevant carriers or excipients.
- the pharmaceutical composition may comprise a circular polyribonucleotide and one or more pharmaceutically acceptable carriers or excipients.
- a pharmaceutically acceptable excipient can be a non-carrier excipient.
- a non-carrier excipient serves as a vehicle or medium for a composition, such as a circular polyribonucleotide as described herein.
- a non-carrier excipient serves as a vehicle or medium for a composition, such as a linear polyribonucleotide as described herein.
- Non-limiting examples of a non-carrier excipient include solvents, aqueous solvents, non-aqueous solvents, dispersion media, diluents, dispersions, suspension aids, surface active agents, isotonic agents, thickening agents, emulsifying agents, preservatives, polymers, peptides, proteins, cells, hyaluronidases, dispersing agents, granulating agents, disintegrating agents, binding agents, buffering agents (e.g., phosphate buffered saline (PBS)), lubricating agents, oils, and mixtures thereof.
- PBS phosphate buffered saline
- a non-carrier excipient can be any one of the inactive ingredients approved by the United States Food and Drug Administration (FDA) and listed in the Inactive Ingredient Database that does not exhibit a cell-penetrating effect.
- Pharmaceutical compositions may optionally comprise one or more additional active substances, e.g. therapeutically and/or prophylactically active substances.
- compositions of the present invention may be sterile and/or pyrogen-free.
- General considerations in the formulation and/or manufacture of pharmaceutical agents may be found, for example, in Remington: The Science and Practice of Pharmacy 21st ed., Lippincott Williams & Wilkins, 2005 (incorporated herein by reference).
- compositions described herein can be used in therapeutic and veterinary.
- pharmaceutical compositions e.g., comprising a circular polyribonucleotide as described herein
- a subject is a non-human animal, for example, suitable for veterinary use.
- Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with merely ordinary, if any, experimentation. Subjects to which
- compositions include, but are not limited to, any animals, such as humans and/or other primates; mammals, including commercially relevant mammals, e.g., pet and live-stock animals, such as cattle, pigs, horses, sheep, goats, cats, dogs, mice, and/or rats; and/or birds, including commercially relevant birds such as parrots, poultry, chickens, ducks, geese, hens or roosters and/or turkeys; zoo animals, e.g., a feline; non-mammal animals, e.g., reptiles, fish, amphibians, etc..
- mammals including commercially relevant mammals, e.g., pet and live-stock animals, such as cattle, pigs, horses, sheep, goats, cats, dogs, mice, and/or rats
- birds including commercially relevant birds such as parrots, poultry, chickens, ducks, geese, hens or roosters and/or turkeys
- zoo animals e
- Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with an excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, dividing, shaping and/or packaging the product.
- the pharmaceutically acceptable carrier or excipient is a sugar (e.g., sucrose, lactose, mannitol, maltose, sorbitol or fructose), a neutral salt (e.g., sodium chloride, magnesium sulfate, magnesium chloride, potassium sulfate, sodium carbonate, sodium sulfite, potassium acid phosphate, or sodium acetate), an acidic component (e.g., fumaric acid, maleic acid, adipic acid, citric acid or ascorbic acid), an alkaline component (e.g., tris(hydroxymethyl) aminomethane (TRIS), meglumine, tribasic or dibasic phosphates of sodium or potassium), or an amino acid (e.g., glycine or arginine).
- a neutral salt e.g., sodium chloride, magnesium sulfate, magnesium chloride, potassium sulfate, sodium carbonate, sodium sulfite, potassium acid phosphate,
- circular polyribonucleotide described herein may also be included in pharmaceutical compositions with a delivery carrier.
- compositions described herein may be formulated for example to include a pharmaceutical excipient or carrier.
- a pharmaceutical carrier can be a membrane, lipid biylar, and/or a polymeric carrier, e.g., a liposome, such as a nanoparticle, e.g., a lipid nanoparticle, and delivered by known methods, such as via partial or full encapsulation of the modified circular polyribonucleotide, to a subject in need thereof (e.g., a human or non-human agricultural or domestic animal, e.g., cattle, dog, cat, horse, poultry).
- a subject in need thereof e.g., a human or non-human agricultural or domestic animal, e.g., cattle, dog, cat, horse, poultry.
- transfection e.g., lipid-mediated, cationic polymers, calcium phosphate, dendrimers
- electroporation or other methods of membrane disruption e.g., nucleofection
- viral delivery e.g., lentivirus, retrovirus, adenovirus, AAV
- microinjection microprojectile bombardment (“gene gun”)
- fugene direct sonic loading, cell squeezing, optical transfection, protoplast fusion, impalefection, magnetofection, exosome-mediated transfer, lipid nanoparticle-mediated transfer, and any combination thereof.
- the circular polyribonucleotide or pharmaceutical composition is delivered as a naked delivery formulation.
- a naked delivery formulation delivers a circular polyribonucleotide as disclosed herein to a cell without the aid of a carrier and without covalent modification or partial or complete encapsulation of the circular polyribonucleotide.
- a naked delivery formulation is a formulation that is free from a carrier and wherein the circular polyribonucleotide as described herein is without a covalent modification that binds a moiety that aids in delivery to a cell or without partial or complete encapsulation of the circular polyribonucleotide.
- a circular polyribonucleotide without covalent modification bound to a moiety that aids in delivery to a cell is not covalently bound to a protein, small molecule, a particle, a polymer, or a biopolymer that aids in delivery to a cell.
- a naked delivery formulation may be free of any or all of: transfection reagents, cationic carriers, carbohydrate carriers, nanoparticle carriers, or protein carriers.
- a naked delivery formulation may be free from phtoglycogen octenyl succinate, phytoglycogen beta- dextrin, anhydride-modified phytoglycogen beta-dextrin, lipofectamine, polyethylenimine, poly(trimethylenimine), poly(tetramethylenimine), polypropylenimine, aminoglycoside-polyamine, dideoxy-diamino-b-cyclodextrin, spermine, spermidine, poly(2-dimethylamino)ethyl methacrylate, poly(lysine), poly(histidine), poly(arginine), cationized gelatin, dendrimers, chitosan, l,2-Dioleoyl-3- Trimethylammonium
- a naked delivery formulation may comprise a non-carrier excipient.
- a non-carrier excipient may comprise an inactive ingredient.
- a non-carrier excipient may comprise a buffer, for example PBS.
- a non-carrier excipient may be a solvent, a non-aqueous solvent, a diluent (e.g., a parenterally acceptable diluent), a suspension aid, a surface active agent, an isotonic agent, a thickening agent, an emulsifying agent, a preservative, a polymer, a peptide, a protein, a cell, a hyaluronidase, a dispersing agent, a granulating agent, a disintegrating agent, a binding agent, a buffering agent, a lubricating agent, or an oil.
- a diluent e.g., a parenterally acceptable diluent
- a suspension aid e.g., a surface active agent, an isotonic agent, a thickening agent, an emulsifying agent, a preservative, a polymer, a peptide, a protein, a cell,
- a naked delivery formulation may comprise a diluent (e.g., a parenterally acceptable diluent).
- a diluent may be a liquid diluent or a solid diluent.
- a diluent may be an RNA solubilizing agent, a buffer, or an isotonic agent. Examples of an RNA solubilizing agent include water, ethanol, methanol, acetone, formamide, and 2-propanol.
- Examples of a buffer include 2- (N-morpholino)ethanesulfonic acid (MES), Bis-Tris, 2-[(2-amino-2-oxoethyl)- (carboxymethyl)amino] acetic acid (ADA), N-(2-Acetamido)-2-aminoethanesulfonic acid (ACES), piperazine-N,N'-bis(2-ethanesulfonic acid) (PIPES), 2-[[l,3-dihydroxy-2-(hydroxymethyl)propan-2- yl]amino]ethanesulfonic acid (TES), 3-(N-morpholino)propanesulfonic acid (MOPS), 4-(2- hydroxyethyl)-l-piperazineethanesulfonic acid (HEPES), Tris, Tricine, Gly-Gly, Bicine, or phosphate.
- Examples of an isotonic agent include glycerin, mannitol, polyethylene glycol, prop
- the invention is further directed to a host or host cell comprising the circular polyribonucleotide described herein.
- the host or host cell is a plant, insect, bacteria, fungus, vertebrate, mammal (e.g., human), or other organism or cell.
- the circular polyribonucleotide is non-immunogenic in the host.
- the circular polyribonucleotide has a decreased or fails to produce a response by the host’s immune system as compared to the response triggered by a reference compound, e.g., a linear polynucleotide corresponding to the described circular polyribonucleotide or a circular polyribonucleotide lacking an encryptogen.
- Some immune responses include, but are not limited to, humoral immune responses (e.g., production of antigen-specific antibodies) and cell-mediated immune responses (e.g., lymphocyte proliferation).
- a host or a host cell is contacted with (e.g., delivered to or administered to) the circular polyribonucleotide.
- the host is a mammal, such as a human.
- the amount of the circular polyribonucleotide, expression product, or both in the host can be measured at any time after administration.
- the cell in the method of present invention can be a eukaryotic cell.
- the cell is an animal cell.
- the cell is a mammalian cell.
- the cell is a human cell.
- the cell is a cell from an aquaculture animal (fish, crabs, shrimp, oysters etc.), a mammal, e.g., from a pet or zoo animal (cats, dogs, lizards, birds, lions, tigers and bears etc.), from a farm or working animal (horses, cows, pigs, chickens etc.), a human, cultured cells, primary cells or cell lines, stem cells, progenitor cells, differentiated cells, germ cells, cancer cells (e.g., tumorigenic, metastic), non-tumorigenic cells (normal cells), fetal cells, embryonic cells, adult cells, mitotic cells, non-mitotic cells, or any combination thereof.
- an aquaculture animal fish, crabs, shrimp, oysters etc.
- a mammal e.g., from a pet or zoo animal (cats, dogs, lizards, birds, lions, tigers and bears etc.), from a farm or working animal (h
- a cell is from an organ, a tissue, or an organism.
- the cell can be removed from a subject prior to use in the methods disclosed herein, e.g., excised surgically, by venipuncture, etc.
- the cell can be from a cell culture.
- the methods disclosed herein can be used on cell in a subject, e.g., a composition as disclosed herein is administered to a subject comprising a cell.
- a subject comprising a cell can be an aquaculture animal (fish, crabs, shrimp, oysters etc.), a mammal, e.g., from a pet or zoo animal (cats, dogs, lizards, birds, lions, tigers and bears etc.), a farm or working animal (horses, cows, pigs, chickens etc.), or a human.
- the subject is a subject in need thereof and the protein produced by the circular polyribonucleotide of the method disclosed herein treats the subject.
- the cell is a plurality of cells.
- the plurality of cells in the method of present invention can be a plurality of eukaryotic cells.
- the plurality of cells a plurality of animal cells.
- the plurality of cells is a plurality of mammalian cells.
- the plurality of cells is a plurality of human cells.
- the plurality of cells is a plurality of cell from an aquaculture animal (fish, crabs, shrimp, oysters etc.), a mammal, e.g., from a pet or zoo animal (cats, dogs, lizards, birds, lions, tigers and bears etc.), from a farm or working animal (horses, cows, pigs, chickens etc.), a human, cultured cells, primary cells or cell lines, stem cells, progenitor cells, differentiated cells, germ cells, cancer cells (e.g., tumorigenic, metastic), non- tumorigenic cells (normal cells), fetal cells, embryonic cells, adult cells, mitotic cells, non-mitotic cells, or any combination thereof.
- the cell can be a plurality of cells in a subject.
- a subject can be an animal.
- a subject can be a mammal.
- a subject can be a human.
- a plurality of cells are cells from an organ, a tissue, or an organism.
- the plurality of cells can be removed from a subject prior to use in the methods disclosed herein, e.g., excised surgically, by venipuncture, etc.
- the plurality of cells can be from a cell culture.
- the methods disclosed herein can be used on a plurality of cells in a subject, e.g., a dose as disclosed herein is administered to a subject comprising a plurality of cells.
- a subject comprising a plurality of cells can be an aquaculture animal (fish, crabs, shrimp, oysters etc.), a mammal, e.g., from a pet or zoo animal (cats, dogs, lizards, birds, lions, tigers and bears etc.), a farm or working animal (horses, cows, pigs, chickens etc.), or a human.
- the subject is a subject in need thereof and the protein produced by the circular polyribonucleotide of the method disclosed herein treats the subject.
- the subject in the method of present invention can be an animal.
- the subject is an animal cell.
- the subject is a mammal.
- the subject is a human.
- the subject is an aquaculture animal (fish, crabs, shrimp, oysters etc.), a mammal, e.g., from a pet or zoo animal (cats, dogs, lizards, birds (e.g., parrots), lions, tigers and bears etc.), from a farm or working animal (horses, cows (e.g., dairy and beef cattle) pigs, chickens, turkeys, hens or roosters, goats, sheep, etc.), or a human.
- a pet or zoo animal cats, dogs, lizards, birds (e.g., parrots), lions, tigers and bears etc.
- cows e.g., dairy and beef cattle
- pigs chickens, turkeys, hens or r
- the a cell as disclosed herein is in a subject as disclosed herein.
- the subject is a subject in need thereof and the protein produced by the circular polyribonucleotide of the method disclosed herein treats the subject.
- a method of expressing a protein in a cell comprising:
- a first composition comprising a circular polyribonucleotide that encodes the protein to the cell, wherein the cell expresses a first level of the protein
- a method of expressing a protein in a cell comprising:
- a first composition comprising a circular polyribonucleotide that encodes the protein to the cell, wherein the cell expresses a first level of the protein
- a method of producing a circular polyribonucleotide in a cell comprising:
- a first composition comprising the circular polyribonucleotide to the cell, wherein the cell comprises a first level of the circular polyribonucleotide after providing the first composition; and providing a second composition of the circular polyribonucleotide to the cell, wherein the cell comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide is at least as much as the first level;
- a method of producing a circular polyribonucleotide in a cell comprising:
- the cell comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide varies by no more than 20% of the first level after providing the second composition;
- a method of expressing a level of a protein in a cell after providing a first composition and a second composition of a circular polyribonucleotide to the cell compared to a level of the protein in the cell after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprising:
- the cell comprises at least the level of the protein after providing the second composition of the circular polyribonucleotide
- a method of expressing a level of a protein in a cell after providing a first composition and a second composition of a circular polyribonucleotide to the cell compared to a level of the protein in the cell after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprising:
- the cell comprises a level of the protein that varies by no more than 20% of the level after providing the second composition of the circular polyribonucleotide; thereby maintaining expression of the level of the protein in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of the protein in the cell after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- providing the second composition of the circular polyribonucleotide to the cell wherein the cell comprises a level of the protein after providing the second composition that varies by no more than 20% of the level of the circular polyribonucleotide; thereby maintaining the level of the circular polyribonucleotide in the cell after providing the first composition and the second composition of the circular polyribonucleotide compared to the level of the linear counterpart in the cell after providing the first composition and the second composition of the linear counterpart of the circular polyribonucleotide.
- composition occurs after providing the second composition and before the second level of the protein expressed by the first and second composition is substantially undetectable in the cell.
- composition occurs after providing the second composition and before the second level of the protein expressed by the first and second composition in the cell decreases by more than 50%.
- composition occurs after providing the second composition and before the level of the circular polyribonucleotide produced by the first and second composition in the cell is substantially undetectable in the cell.
- composition occurs after providing the second composition and before the level of the circular polyribonucleotide produced by the first and second composition in the cell decreases by more than 50%.
- an amount of circular polyribonucleotide of the second composition is no more than 1%, 5%, 10%, 15%, 20%, or 25% less than an amount of circular polyribonucleotide of the first composition.
- the method of any one of the preceding embodiments, wherein the first level of the protein is the highest level of the protein one day after providing the first composition.
- the first level of the protein is 40%, 50%, 60%, 70%, 80%, or 90% of the highest level of the protein one day after providing the first composition.
- a subsequent level of the protein expressed after each subsequent composition is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of the highest level of the protein one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing each subsequent composition.
- an average level of the protein after providing the second composition is at least 40%, 50%, 60%, 70%, 80%, or 90% of the first level, wherein the average level of the protein is measured from one day after providing the second composition to the day when the protein is substantially undetectable.
- an average level of the protein after providing each subsequent composition after the first composition is at least 40%, 50%, 60%, 70%, 80%, or 90% of the first level, wherein the average level of the protein is measured from one day after providing each subsequent composition to the day when the protein is substantially undetectable.
- protein in the cell after providing the second composition is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of protein in the cell after providing the first composition.
- the third level of protein in the cell after providing the third composition is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of protein in the plurality after providing the first composition.
- protein 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the second composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the protein after providing the first composition.
- 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the third composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the protein after providing the first composition.
- circular polyribonucleotide is the highest level of the circular polyribonucleotide one day after providing the first composition.
- circular polyribonucleotide is 40%, 50%, 60%, 70%, 80%, or 90% of the highest level of the circular polyribonucleotide one day after providing the first composition.
- polyribonucleotide expressed after each subsequent composition is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of the highest level of the circular
- polyribonucleotide one day after providing the first composition for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, or 40 days after providing each subsequent composition.
- an average level of the circular polyribonucleotide after providing the second composition is at least 40%, 50%, 60%, 70%, 80%, or 90% of the first level, wherein the average level of the circular polyribonucleotide is measured from one day after providing the second composition to the day when the circular polyribonucleotide is substantially undetectable.
- an average level of the circular polyribonucleotide after providing each subsequent composition after the first composition is at least 40%, 50%, 60%, 70%, 80%, or 90% of the first level, wherein the average level of the circular polyribonucleotide is measured from one day after providing each subsequent composition to the day when the circular polyribonucleotide is substantially undetectable.
- circular polyribonucleotide in the cell after providing the second composition is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of circular polyribonucleotide in the cell after providing the first composition.
- circular polyribonucleotide 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the second composition of the circular polyribonucleotide is at least 1%, 5%,
- the level of the protein in the cell after providing the first composition and the second composition of the circular polyribonucleotide is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the level of the protein in the cell after providing the first composition and the second composition of the linear counterpart of the circular for at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the second composition of the circular polyribonucleotide.
- the therapeutic protein has antioxidant activity, binding, cargo receptor activity, catalytic activity, molecular carrier activity, molecular function regulator, molecular transducer activity, nutrient reservoir activity, protein tag, structural molecule activity, toxin activity, transcription regulator activity, translation regulator activity, or transporter activity.
- the therapeutic protein is Human Factor VIII, Human Factor IX, REP1, adenosine deaminase, human NGF, nuclear- encoded ND4, SECRA2a, SUMOl, VEGF, PDE6A, p53, PBFD, ARSA, ABCD1, APOE4, RPGR, DCLREIC, VEGF 165, PDGF-B, gamma-sarcoglycan, dystrophin, LAMP2B, CNGB3, Retinitis Pigmentosa GTPase Regulator, or CLN6.
- the therapeutic protein is Human Factor VIII, Human Factor IX, REP1, adenosine deaminase, human NGF, nuclear- encoded ND4, SECRA2a, SUMOl, VEGF, PDE6A, p53, PBFD, ARSA, ABCD1, APOE4, RPGR, DCLREIC, VEGF 165, PDGF-B, gamm
- polyribonucleotide further comprises a stagger element at a 3’ end of an expression sequence, and lacks a termination element.
- polyribonucleotide lacks an internal ribosomal entry site.
- expression sequences comprise a Kozak initiation sequence.
- polyribonucleotide further comprises at least one structural element selected from:
- polyribonucleotide further comprises a replication domain configured to mediate self-replication of the circular polyribonucleotide.
- polyribonucleotide persists during cell division.
- a method of expressing a protein in a cell comprising:
- a first composition comprising a circular polyribonucleotide that encodes the protein to the cell, wherein the cell expresses a first level of the protein
- a method of expressing a protein in a cell comprising:
- a first composition comprising a circular polyribonucleotide that encodes the protein to the cell, wherein the cell expresses a first level of the protein
- a method of expressing a level of a protein in a cell after providing a first composition and a second composition of a circular polyribonucleotide to the cell compared to a level of the protein in the cell after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprising: providing a first composition of the circular polyribonucleotide encoding the protein to the cell, wherein the cell comprises the level of the protein after providing the first composition of the circular polyribonucleotide; and providing the second composition of the circular polyribonucleotide after the first composition to the cell, wherein the cell comprises at least the level of the protein after providing the second composition of the circular polyribonucleotide;
- a method of expressing a level of a protein in a cell after providing a first composition and a second composition of a circular polyribonucleotide to the cell compared to a level of the protein in the cell after providing a first composition and second composition of a linear counterpart of the circular polyribonucleotide comprising:
- the cell comprises the level of the protein after providing the first composition of the circular polyribonucleotide; and providing the second composition of the circular polyribonucleotide after the first composition to the cell, wherein the cell comprises a level of the protein that varies by no more than 20% of the level after providing the second composition of the circular polyribonucleotide;
- a subsequent level of the protein expressed after each subsequent composition is at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, or 130% of a highest level of the protein one day after providing the first composition for at least 1, 2, 3, 4, 5,
- a third level of protein produced in the cell after providing the third composition is at least 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of protein in the plurality after providing the first composition.
- protein 1 hour, 12 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 15 days, 20 days, 25 days, 30 days, 40 days, or 45 days after providing the third composition of the circular polyribonucleotide is at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, or 60% higher than the first level of the protein after providing the first composition.
- intracellular protein a membrane protein, or a secreted protein.
- the therapeutic protein has a) antioxidant activity, binding, cargo receptor activity, catalytic activity, molecular carrier activity, molecular transducer activity, nutrient reservoir activity, structural molecule activity, toxin activity, transcription regulator activity, translation regulator activity, or transporter activity; b) is a molecular function regulator; or c) functions as a protein tag.
- the therapeutic protein is Human Factor VIII, Human Factor IX, REP1, adenosine deaminase, human NGF, nuclear-encoded ND4, SECRA2a, SUMOl, VEGF, PDE6A, p53, PBFD, ARSA, ABCD1, APOE4, RPGR,
- a method of producing a circular polyribonucleotide in a cell comprising:
- the cell comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide is at least as much as the first level;
- a method of producing a circular polyribonucleotide in a cell comprising:
- the cell comprises a second level of the circular polyribonucleotide and the second level of circular polyribonucleotide varies by no more than 20% of the first level after providing the second composition;
- the cell comprises a level of the protein after providing the second composition that varies by no more than 20% of the level of the circular polyribonucleotide;
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biochemistry (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Physical Education & Sports Medicine (AREA)
- Cardiology (AREA)
- Rheumatology (AREA)
- Neurology (AREA)
- Immunology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Heart & Thoracic Surgery (AREA)
- Gastroenterology & Hepatology (AREA)
- Pulmonology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Vascular Medicine (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202080044871.7A CN114096674A (zh) | 2019-06-19 | 2020-06-19 | 环状多核糖核苷酸的给药方法 |
| US17/619,638 US20220296729A1 (en) | 2019-06-19 | 2020-06-19 | Methods of dosing circular polyribonucleotides |
| EP20747268.9A EP3987038A1 (en) | 2019-06-19 | 2020-06-19 | Methods of dosing circular polyribonucleotides |
| AU2020296190A AU2020296190A1 (en) | 2019-06-19 | 2020-06-19 | Methods of dosing circular polyribonucleotides |
| JP2021575283A JP2022536951A (ja) | 2019-06-19 | 2020-06-19 | 環状ポリリボヌクレオチドを投与する方法 |
| CA3140594A CA3140594A1 (en) | 2019-06-19 | 2020-06-19 | Methods of dosing circular polyribonucleotides |
| KR1020227001638A KR20220024647A (ko) | 2019-06-19 | 2020-06-19 | 원형 폴리리보뉴클레오티드의 투여 방법 |
| IL288983A IL288983A (en) | 2019-06-19 | 2021-12-14 | Methods of dosing circular polyribonucleotides |
| US17/978,030 US20230061936A1 (en) | 2019-06-19 | 2022-10-31 | Methods of dosing circular polyribonucleotides |
| JP2025272525A JP2026040556A (ja) | 2019-06-19 | 2025-12-22 | 環状ポリリボヌクレオチドを投与する方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962863725P | 2019-06-19 | 2019-06-19 | |
| US62/863,725 | 2019-06-19 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/619,638 A-371-Of-International US20220296729A1 (en) | 2019-06-19 | 2020-06-19 | Methods of dosing circular polyribonucleotides |
| US17/978,030 Continuation US20230061936A1 (en) | 2019-06-19 | 2022-10-31 | Methods of dosing circular polyribonucleotides |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020257727A1 true WO2020257727A1 (en) | 2020-12-24 |
Family
ID=71842849
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/038835 Ceased WO2020257727A1 (en) | 2019-06-19 | 2020-06-19 | Methods of dosing circular polyribonucleotides |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US20220296729A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3987038A1 (cg-RX-API-DMAC7.html) |
| JP (2) | JP2022536951A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20220024647A (cg-RX-API-DMAC7.html) |
| CN (1) | CN114096674A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2020296190A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3140594A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL288983A (cg-RX-API-DMAC7.html) |
| MA (1) | MA56538A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2020257727A1 (cg-RX-API-DMAC7.html) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11458156B2 (en) | 2017-12-15 | 2022-10-04 | Flagship Pioneering Innovations Vi, Llc | Compositions comprising circular polyribonucleotides and uses thereof |
| US11672874B2 (en) | 2019-09-03 | 2023-06-13 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| WO2023115013A1 (en) | 2021-12-17 | 2023-06-22 | Flagship Pioneering Innovations Vi, Llc | Methods for enrichment of circular rna under denaturing conditions |
| CN117070564A (zh) * | 2023-03-30 | 2023-11-17 | 安可来(重庆)生物医药科技有限公司 | 一种用于合成环形rna的质粒及其构建方法与一种环形rna及其体外合成方法 |
| WO2024159172A1 (en) | 2023-01-27 | 2024-08-02 | Senda Biosciences, Inc. | A modified lipid composition and uses thereof |
| US12319925B2 (en) | 2021-05-11 | 2025-06-03 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| US12338474B2 (en) | 2021-09-17 | 2025-06-24 | Flagship Pioneering Innovations Vi, Llc | Compositions and methods for producing circular polyribonucleotides |
| US12480117B2 (en) | 2019-03-25 | 2025-11-25 | Flagship Pioneering Innovations Vi, Llc | Compositions comprising modified circular polyribonucleotides and uses thereof |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20230203192A1 (en) * | 2020-05-20 | 2023-06-29 | Flagship Pioneering, Inc. | Compositions and methods for producing human polyclonal antibodies |
| CN116870004B (zh) * | 2023-02-24 | 2025-10-21 | 中南大学 | 以brd7为靶点在防治自身免疫性疾病药物中的应用 |
| CN120241980A (zh) * | 2023-12-29 | 2025-07-04 | 复旦大学 | 一种基于环状rna的现货型体内原位car与肿瘤疫苗联用的免疫治疗技术及其应用 |
Citations (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1992001813A1 (en) | 1990-07-25 | 1992-02-06 | Syngene, Inc. | Circular extension for generating multiple nucleic acid complements |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5426180A (en) | 1991-03-27 | 1995-06-20 | Research Corporation Technologies, Inc. | Methods of making single-stranded circular oligonucleotides |
| US5438119A (en) | 1988-05-02 | 1995-08-01 | The Regents Of The University Of California | Method of obtaining a peptide with desired target property |
| US5440016A (en) | 1993-06-18 | 1995-08-08 | Torrey Pines Institute For Molecular Studies | Peptides of the formula (KFmoc) ZZZ and their uses |
| US5463564A (en) | 1994-09-16 | 1995-10-31 | 3-Dimensional Pharmaceuticals, Inc. | System and method of automatically generating chemical compounds with desired properties |
| US5525735A (en) | 1994-06-22 | 1996-06-11 | Affymax Technologies Nv | Methods for synthesizing diverse collections of pyrrolidine compounds |
| US5541061A (en) | 1992-04-29 | 1996-07-30 | Affymax Technologies N.V. | Methods for screening factorial chemical libraries |
| US5545568A (en) | 1992-09-14 | 1996-08-13 | The Regents Of The University Of California | Solid phase and combinatorial synthesis of compounds on a solid support |
| US5549974A (en) | 1994-06-23 | 1996-08-27 | Affymax Technologies Nv | Methods for the solid phase synthesis of thiazolidinones, metathiazanones, and derivatives thereof |
| US5565324A (en) | 1992-10-01 | 1996-10-15 | The Trustees Of Columbia University In The City Of New York | Complex combinatorial chemical libraries encoded with tags |
| US5593853A (en) | 1994-02-09 | 1997-01-14 | Martek Corporation | Generation and screening of synthetic drug libraries |
| US5639603A (en) | 1991-09-18 | 1997-06-17 | Affymax Technologies N.V. | Synthesizing and screening molecular diversity |
| US5688696A (en) | 1994-12-12 | 1997-11-18 | Selectide Corporation | Combinatorial libraries having a predetermined frequency of each species of test compound |
| US5688997A (en) | 1994-05-06 | 1997-11-18 | Pharmacopeia, Inc. | Process for preparing intermediates for a combinatorial dihydrobenzopyran library |
| US5708153A (en) | 1991-09-18 | 1998-01-13 | Affymax Technologies N.V. | Method of synthesizing diverse collections of tagged compounds |
| US5712128A (en) | 1992-01-13 | 1998-01-27 | Duke University | Enzymatic RNA molecules |
| US5721099A (en) | 1992-10-01 | 1998-02-24 | Trustees Of Columbia University In The City Of New York | Complex combinatorial chemical libraries encoded with tags |
| US5731423A (en) | 1996-03-21 | 1998-03-24 | Transcell Technologies, Inc. | Process for preparing sulfoxides |
| US5741713A (en) | 1995-06-21 | 1998-04-21 | Martek Biosciences Corporation | Combinatorial libraries of labeled biochemical compounds and methods for producing same |
| US5766903A (en) | 1995-08-23 | 1998-06-16 | University Technology Corporation | Circular RNA and uses thereof |
| US5773244A (en) | 1993-05-19 | 1998-06-30 | Regents Of The University Of California | Methods of making circular RNA |
| US6210931B1 (en) | 1998-11-30 | 2001-04-03 | The United States Of America As Represented By The Secretary Of Agriculture | Ribozyme-mediated synthesis of circular RNA |
| US20030082768A1 (en) | 1998-04-17 | 2003-05-01 | Whitehead Institute For Biomedical Research | Use of a ribozyme to join nucleic acids and peptides |
| US20050059005A1 (en) | 2001-09-28 | 2005-03-17 | Thomas Tuschl | Microrna molecules |
| US20050261218A1 (en) | 2003-07-31 | 2005-11-24 | Christine Esau | Oligomeric compounds and compositions for use in modulation small non-coding RNAs |
| US20100137407A1 (en) | 2007-05-09 | 2010-06-03 | Riken | Single-chain circular rna and method of producing the same |
| WO2010084371A1 (en) | 2009-01-26 | 2010-07-29 | Mitoprod | Novel circular interfering rna molecules |
| WO2016197121A1 (en) * | 2015-06-05 | 2016-12-08 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for transient gene therapy with enhanced stability |
| WO2019118919A1 (en) | 2017-12-15 | 2019-06-20 | Flagship Pioneering, Inc. | Compositions comprising circular polyribonucleotides and uses thereof |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015034925A1 (en) * | 2013-09-03 | 2015-03-12 | Moderna Therapeutics, Inc. | Circular polynucleotides |
| US10407683B2 (en) * | 2014-07-16 | 2019-09-10 | Modernatx, Inc. | Circular polynucleotides |
| AU2018251187B2 (en) * | 2017-04-14 | 2024-03-28 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for transient gene therapy with enhanced stability |
| US20200131498A1 (en) * | 2017-06-14 | 2020-04-30 | Modernatx, Inc. | Polynucleotides encoding methylmalonyl-coa mutase |
| CN112399860B (zh) * | 2018-06-06 | 2024-08-16 | 麻省理工学院 | 用于在真核细胞中翻译的环状rna |
| BR112021023411A2 (pt) * | 2019-05-22 | 2022-02-01 | Massachusetts Inst Technology | Composições e métodos de rna circular |
-
2020
- 2020-06-19 KR KR1020227001638A patent/KR20220024647A/ko active Pending
- 2020-06-19 US US17/619,638 patent/US20220296729A1/en active Pending
- 2020-06-19 MA MA056538A patent/MA56538A/fr unknown
- 2020-06-19 CN CN202080044871.7A patent/CN114096674A/zh active Pending
- 2020-06-19 WO PCT/US2020/038835 patent/WO2020257727A1/en not_active Ceased
- 2020-06-19 CA CA3140594A patent/CA3140594A1/en active Pending
- 2020-06-19 JP JP2021575283A patent/JP2022536951A/ja not_active Withdrawn
- 2020-06-19 EP EP20747268.9A patent/EP3987038A1/en active Pending
- 2020-06-19 AU AU2020296190A patent/AU2020296190A1/en active Pending
-
2021
- 2021-12-14 IL IL288983A patent/IL288983A/en unknown
-
2022
- 2022-10-31 US US17/978,030 patent/US20230061936A1/en not_active Abandoned
-
2025
- 2025-12-22 JP JP2025272525A patent/JP2026040556A/ja active Pending
Patent Citations (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5438119A (en) | 1988-05-02 | 1995-08-01 | The Regents Of The University Of California | Method of obtaining a peptide with desired target property |
| US5641862A (en) | 1988-05-02 | 1997-06-24 | The Regents Of The University Of California | General method for producing and selecting peptides with specific properties |
| US5734018A (en) | 1988-05-02 | 1998-03-31 | The Regents Of The University Of California | Peptide mixtures |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO1992001813A1 (en) | 1990-07-25 | 1992-02-06 | Syngene, Inc. | Circular extension for generating multiple nucleic acid complements |
| US5426180A (en) | 1991-03-27 | 1995-06-20 | Research Corporation Technologies, Inc. | Methods of making single-stranded circular oligonucleotides |
| US5708153A (en) | 1991-09-18 | 1998-01-13 | Affymax Technologies N.V. | Method of synthesizing diverse collections of tagged compounds |
| US5639603A (en) | 1991-09-18 | 1997-06-17 | Affymax Technologies N.V. | Synthesizing and screening molecular diversity |
| US5712128A (en) | 1992-01-13 | 1998-01-27 | Duke University | Enzymatic RNA molecules |
| US5541061A (en) | 1992-04-29 | 1996-07-30 | Affymax Technologies N.V. | Methods for screening factorial chemical libraries |
| US5545568A (en) | 1992-09-14 | 1996-08-13 | The Regents Of The University Of California | Solid phase and combinatorial synthesis of compounds on a solid support |
| US5565324A (en) | 1992-10-01 | 1996-10-15 | The Trustees Of Columbia University In The City Of New York | Complex combinatorial chemical libraries encoded with tags |
| US5721099A (en) | 1992-10-01 | 1998-02-24 | Trustees Of Columbia University In The City Of New York | Complex combinatorial chemical libraries encoded with tags |
| US5773244A (en) | 1993-05-19 | 1998-06-30 | Regents Of The University Of California | Methods of making circular RNA |
| US5440016A (en) | 1993-06-18 | 1995-08-08 | Torrey Pines Institute For Molecular Studies | Peptides of the formula (KFmoc) ZZZ and their uses |
| US5698673A (en) | 1993-06-18 | 1997-12-16 | Torrey Pines Institute | Peptides having anti-melittin activity |
| US5593853A (en) | 1994-02-09 | 1997-01-14 | Martek Corporation | Generation and screening of synthetic drug libraries |
| US5688997A (en) | 1994-05-06 | 1997-11-18 | Pharmacopeia, Inc. | Process for preparing intermediates for a combinatorial dihydrobenzopyran library |
| US5525735A (en) | 1994-06-22 | 1996-06-11 | Affymax Technologies Nv | Methods for synthesizing diverse collections of pyrrolidine compounds |
| US5549974A (en) | 1994-06-23 | 1996-08-27 | Affymax Technologies Nv | Methods for the solid phase synthesis of thiazolidinones, metathiazanones, and derivatives thereof |
| US5463564A (en) | 1994-09-16 | 1995-10-31 | 3-Dimensional Pharmaceuticals, Inc. | System and method of automatically generating chemical compounds with desired properties |
| US5684711A (en) | 1994-09-16 | 1997-11-04 | 3-Dimensional Pharmaceuticals, Inc. | System, method, and computer program for at least partially automatically generating chemical compounds having desired properties |
| US5574656A (en) | 1994-09-16 | 1996-11-12 | 3-Dimensional Pharmaceuticals, Inc. | System and method of automatically generating chemical compounds with desired properties |
| US5688696A (en) | 1994-12-12 | 1997-11-18 | Selectide Corporation | Combinatorial libraries having a predetermined frequency of each species of test compound |
| US5741713A (en) | 1995-06-21 | 1998-04-21 | Martek Biosciences Corporation | Combinatorial libraries of labeled biochemical compounds and methods for producing same |
| US5766903A (en) | 1995-08-23 | 1998-06-16 | University Technology Corporation | Circular RNA and uses thereof |
| US5731423A (en) | 1996-03-21 | 1998-03-24 | Transcell Technologies, Inc. | Process for preparing sulfoxides |
| US20030082768A1 (en) | 1998-04-17 | 2003-05-01 | Whitehead Institute For Biomedical Research | Use of a ribozyme to join nucleic acids and peptides |
| US6210931B1 (en) | 1998-11-30 | 2001-04-03 | The United States Of America As Represented By The Secretary Of Agriculture | Ribozyme-mediated synthesis of circular RNA |
| US20050059005A1 (en) | 2001-09-28 | 2005-03-17 | Thomas Tuschl | Microrna molecules |
| US20050261218A1 (en) | 2003-07-31 | 2005-11-24 | Christine Esau | Oligomeric compounds and compositions for use in modulation small non-coding RNAs |
| US20100137407A1 (en) | 2007-05-09 | 2010-06-03 | Riken | Single-chain circular rna and method of producing the same |
| WO2010084371A1 (en) | 2009-01-26 | 2010-07-29 | Mitoprod | Novel circular interfering rna molecules |
| WO2016197121A1 (en) * | 2015-06-05 | 2016-12-08 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for transient gene therapy with enhanced stability |
| WO2019118919A1 (en) | 2017-12-15 | 2019-06-20 | Flagship Pioneering, Inc. | Compositions comprising circular polyribonucleotides and uses thereof |
Non-Patent Citations (40)
| Title |
|---|
| "Remington: The Science and Practice of Pharmacy", 2005, LIPPINCOTT WILLIAMS & WILKINS |
| ANGENENDT ET AL., ANAL. CHEM., vol. 76, no. 7, 2004, pages 1844 - 9 |
| ANGENENDT ET AL., MOL. CELL PROTEOMICS, vol. 5, no. 9, 2006, pages 1658 - 66 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 26 |
| CHATTEIJEEJ. LABAER, CURR OPIN BIOTECH, vol. 17, no. 4, 2006, pages 334 - 336 |
| DEANGELIS ALLISON: "The inside story of how data integrityissues roiled a biotech seen as'Moderna 2.0'", THE BOSTON GLOBE, 12 June 2023 (2023-06-12), pages 1 - 19, XP093116335, Retrieved from the Internet <URL:https://www.statnews.com/2023/06/12/laronde-data-integrity-issu...FgCkF2eh_-V9-3TUHWEBk&utm_content=261977264&utm_source=hs_email> [retrieved on 20240105] |
| EGLIHERDEWIJN: "Chemistry and Biology of Artificial Nucleic Acids", 2012, WILEY-VCH |
| ELLESE CARMONA: "Circular RNA: Design Criteria for Optimal Therapeutical Utility", 15 January 2019 (2019-01-15), pages 1 - 130, XP055710958, Retrieved from the Internet <URL:https://dash.harvard.edu/bitstream/handle/1/41121328/CARMONA-DISSERTATION-2019.pdf?sequence=1> [retrieved on 20200702] * |
| FREDRIKSSON ET AL., NAT BIOTECH, vol. 20, 2002, pages 473 - 77 |
| GORI ET AL.: "Delivery and Specificity of CRISPR/Cas9 Genome Editing Technologies for Human Gene Therapy", HUMAN GENE THERAPY, vol. 26, no. 7, July 2015 (2015-07-01), pages 443 - 451, XP055501239, DOI: 10.1089/hum.2015.074 |
| GULLBERG ET AL., PNAS, vol. 101, 2004, pages 8420 - 24 |
| HE ET AL., CURR. OPIN. BIOTECHNOL., vol. 19, no. 1, 2008, pages 4 - 9 |
| HE ET AL., NAT. METHODS, vol. 5, no. 2, 2008, pages 175 - 7 |
| HE ET AL., NUCLEIC ACIDS RES., vol. 29, no. 15, 2001, pages E73 - 3 |
| HETAUSSIG, J. IMMUNOL. METHODS, vol. 274, no. 1-2, 2003, pages 265 - 70 |
| HEWANG, BIOMOL ENG, vol. 24, no. 4, 2007, pages 375 - 80 |
| HUSTON ET AL., PNAS, vol. 85, 1988, pages 5879 - 83 |
| KATZEN ET AL., TRENDS BIOTECHNOL., vol. 23, no. 3, 2005, pages 150 - 6 |
| KHUDYAKOVFIELDS: "Artificial DNA: Methods and Applications", 2002, CRC PRESS |
| KILB ET AL., ENG. LIFE SCI., vol. 14, 2014, pages 352 - 364 |
| KINPARA ET AL., J BIOCHEM., vol. 136, no. 2, 2004, pages 149 - 54 |
| MARIANNE C. KRAMER ET AL: "Combinatorial control of Drosophila circular RNA expression by intronic repeats, hnRNPs, and SR proteins", GENES & DEVELOPMENT, vol. 29, no. 20, 8 October 2015 (2015-10-08), US, pages 2168 - 2182, XP055732434, ISSN: 0890-9369, DOI: 10.1101/gad.270421.115 * |
| MULLERAPPEL: "In vitro circularization of RNA", RNA BIOL, vol. 14, no. 8, 2017, pages 1018 - 1027 |
| PETKOVICMULLER, NUCLEIC ACIDS RES, vol. 43, no. 4, 2015, pages 2454 - 2465 |
| R. ALEXANDER WESSELHOEFT ET AL: "Engineering circular RNA for potent and stable translation in eukaryotic cells", NATURE COMMUNICATIONS, vol. 9, no. 1, 1 December 2018 (2018-12-01), GB, XP055622155, ISSN: 2041-1723, DOI: 10.1038/s41467-018-05096-6 * |
| RAMACHANDRAN ET AL., SCIENCE, vol. 305, no. 5680, 2004, pages 86 - 90 |
| See also references of EP3987038A1 |
| STADEL ET AL., TRENDS IN PHARMACOLOGICAL REVIEW, vol. 18, 1997, pages 430 - 37 |
| STEELAND ET AL.: "Nanobodies as therapeutics: big opportunities for small antibodies", DRUG DISCOV TODAY, vol. 21, no. 7, 2016, pages 1076 - 113, XP029598209, DOI: 10.1016/j.drudis.2016.04.003 |
| STEVENS, STRUCTURE, vol. 8, no. 9, 2000, pages R177 - R185 |
| TAKULAPALLI ET AL., J. PROTEOME RES., vol. 11, no. 8, 2012, pages 4382 - 91 |
| TANNOUS, NAT PROTOC., vol. 4, no. 4, 2009, pages 582 - 591 |
| TAO ET AL., NAT BIOTECHNOL, vol. 24, no. 10, 2006, pages 1253 - 4 |
| THOMAS SCHLAKE ET AL: "Developing mRNA-vaccine technologies", RNA BIOLOGY, vol. 9, no. 11, 1 November 2012 (2012-11-01), pages 1319 - 1330, XP055561756, ISSN: 1547-6286, DOI: 10.4161/rna.22269 * |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 46 |
| WESSELHOEFT R ALEXANDER ET AL: "RNA Circularization Diminishes Immunogenicity and Can Extend Translation DurationIn Vivo", MOLECULAR CELL, vol. 74, no. 3, 2 May 2019 (2019-05-02), pages 508, XP085676575, ISSN: 1097-2765, DOI: 10.1016/J.MOLCEL.2019.02.015 * |
| YANG WANG ET AL: "Efficient backsplicing produces translatable circular mRNAs", RNA, vol. 21, no. 2, 1 December 2014 (2014-12-01), US, pages 172 - 179, XP055325538, ISSN: 1355-8382, DOI: 10.1261/rna.048272.114 * |
| YU, Z. ET AL.: "RNA editing by ADAR1 marks dsRNA as ''self", CELL RES., vol. 25, 2015, pages 1283 - 1284 |
| ZHAO: "Synthetic Biology: Tools and Applications", 2013, ACADEMIC PRESS |
| ZURIS ET AL.: "Cationic lipid-mediated delivery of proteins enables efficient protein-based genome editing in vitro and in vivo", NAT BIOTECHNOL., vol. 33, no. 1, 30 October 2014 (2014-10-30), pages 73 - 80, XP055246826, DOI: 10.1038/nbt.3081 |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11458156B2 (en) | 2017-12-15 | 2022-10-04 | Flagship Pioneering Innovations Vi, Llc | Compositions comprising circular polyribonucleotides and uses thereof |
| US11844759B2 (en) | 2017-12-15 | 2023-12-19 | Flagship Pioneering Innovations Vi, Llc | Compositions comprising circular polyribonucleotides and uses thereof |
| US12357653B2 (en) | 2017-12-15 | 2025-07-15 | Flagship Pioneering Innovations Vi, Llc | Compositions comprising circular polyribonucleotides and uses thereof |
| US12539309B2 (en) | 2017-12-15 | 2026-02-03 | Flagship Pioneering Innovations Vi, Llc | Compositions comprising circular polyribonucleotides and uses thereof |
| US12480117B2 (en) | 2019-03-25 | 2025-11-25 | Flagship Pioneering Innovations Vi, Llc | Compositions comprising modified circular polyribonucleotides and uses thereof |
| US11672874B2 (en) | 2019-09-03 | 2023-06-13 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| US12319925B2 (en) | 2021-05-11 | 2025-06-03 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| US12338474B2 (en) | 2021-09-17 | 2025-06-24 | Flagship Pioneering Innovations Vi, Llc | Compositions and methods for producing circular polyribonucleotides |
| WO2023115013A1 (en) | 2021-12-17 | 2023-06-22 | Flagship Pioneering Innovations Vi, Llc | Methods for enrichment of circular rna under denaturing conditions |
| WO2024159172A1 (en) | 2023-01-27 | 2024-08-02 | Senda Biosciences, Inc. | A modified lipid composition and uses thereof |
| CN117070564A (zh) * | 2023-03-30 | 2023-11-17 | 安可来(重庆)生物医药科技有限公司 | 一种用于合成环形rna的质粒及其构建方法与一种环形rna及其体外合成方法 |
| CN117070564B (zh) * | 2023-03-30 | 2024-05-10 | 安可来(重庆)生物医药科技有限公司 | 一种用于合成环形rna的质粒及其构建方法与一种环形rna及其体外合成方法 |
Also Published As
| Publication number | Publication date |
|---|---|
| MA56538A (fr) | 2022-04-27 |
| JP2022536951A (ja) | 2022-08-22 |
| US20220296729A1 (en) | 2022-09-22 |
| AU2020296190A1 (en) | 2022-01-06 |
| IL288983A (en) | 2022-02-01 |
| CA3140594A1 (en) | 2020-12-24 |
| US20230061936A1 (en) | 2023-03-02 |
| JP2026040556A (ja) | 2026-03-09 |
| KR20220024647A (ko) | 2022-03-03 |
| CN114096674A (zh) | 2022-02-25 |
| EP3987038A1 (en) | 2022-04-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230061936A1 (en) | Methods of dosing circular polyribonucleotides | |
| US12480117B2 (en) | Compositions comprising modified circular polyribonucleotides and uses thereof | |
| US20220257794A1 (en) | Circular rnas for cellular therapy | |
| US12539309B2 (en) | Compositions comprising circular polyribonucleotides and uses thereof | |
| US20220143062A1 (en) | Circular polyribonucleotides and pharmaceutical compositions thereof | |
| US20230104113A1 (en) | Delivery of compositions comprising circular polyribonucleotides | |
| TW202446956A (zh) | 包含經修飾的胞嘧啶的dna組成物 | |
| WO2025230868A1 (en) | Self-amplifying rna and methods | |
| CN118660960A (zh) | 用于基因组编辑的多核苷酸、组合物和方法 | |
| EA048813B1 (ru) | Композиции и способы редактирования гена ttr и лечения транстиретинового амилоидоза (attr) |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20747268 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3140594 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2021575283 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020296190 Country of ref document: AU Date of ref document: 20200619 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20227001638 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020747268 Country of ref document: EP Effective date: 20220119 |