WO2020257483A1 - Structurally defined sirna-dual variable domain immunoglobulin conjugates - Google Patents
Structurally defined sirna-dual variable domain immunoglobulin conjugates Download PDFInfo
- Publication number
- WO2020257483A1 WO2020257483A1 PCT/US2020/038475 US2020038475W WO2020257483A1 WO 2020257483 A1 WO2020257483 A1 WO 2020257483A1 US 2020038475 W US2020038475 W US 2020038475W WO 2020257483 A1 WO2020257483 A1 WO 2020257483A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- conjugate
- antisense strand
- seq
- dsrna
- linker
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CC(C(N1)=O)=CN(C(*)[C@](COC)OC)C1=O Chemical compound CC(C(N1)=O)=CN(C(*)[C@](COC)OC)C1=O 0.000 description 4
- DZNTUOAEEPRPDK-JXBXZBNISA-N B[C@@H](C1)O[C@H](COC)C1OC Chemical compound B[C@@H](C1)O[C@H](COC)C1OC DZNTUOAEEPRPDK-JXBXZBNISA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/111—General methods applicable to biologically active non-coding nucleic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/549—Sugars, nucleosides, nucleotides or nucleic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6807—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6867—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of a blood cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6875—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody being a hybrid immunoglobulin
- A61K47/6879—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody being a hybrid immunoglobulin the immunoglobulin having two or more different antigen-binding sites, e.g. bispecific or multispecific immunoglobulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/522—CH1 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/31—Chemical structure of the backbone
- C12N2310/315—Phosphorothioates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/32—Chemical structure of the sugar
- C12N2310/321—2'-O-R Modification
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/32—Chemical structure of the sugar
- C12N2310/322—2'-R Modification
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/32—Chemical structure of the sugar
- C12N2310/323—Chemical structure of the sugar modified ring structure
- C12N2310/3231—Chemical structure of the sugar modified ring structure having an additional ring, e.g. LNA, ENA
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/35—Nature of the modification
- C12N2310/351—Conjugate
- C12N2310/3513—Protein; Peptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
- C12N2320/32—Special delivery means, e.g. tissue-specific
Definitions
- the invention relates to dual variable domain immunoglobulin siRNA conjugates that are advantageous for inhibition of target gene expression, as well as compositions suitable for therapeutic use. Additionally, the invention provides methods of inhibiting the expression of a target gene by administering these conjugates, e.g., for the treatment of various diseases.
- RNA interference or“RNAi” is a term initially coined by Fire and co-workers to describe the observation that double-stranded RNAi (dsRNA) can block gene expression (Fire el al. (1998) Nature 391, 806-811; Elbashir et al. (2001) Genes Dev. 15, 188-200).
- Short dsRNA directs gene-specific, post-transcriptional silencing in many organisms, including vertebrates, and has provided a new tool for studying gene function.
- RNAi is mediated by RNA-induced silencing complex (RISC), a sequence-specific, multi-component nuclease that destroys messenger RNAs homologous to the silencing trigger.
- RISC RNA-induced silencing complex
- RISC RNA-induced silencing complex
- RISC is known to contain short RNAs (approximately 22 nucleotides) derived from the double-stranded RNA trigger, but the protein components of this activity
- RNA interference RNA interference
- siRNAs Short interfering RNAs
- the siRNA After entering cells, the siRNA is loaded into an RNA-induced silencing complex (RISC). During the loading process, the passenger (sense) strand is removed and the guide (antisense) strand remains within the RISC where it binds to its complementary site on the target mRNA. The bound mRNA can then be cleaved by the nuclease activity of RISC and then further degraded by cellular nucleases.
- RISC RNA-induced silencing complex
- siRNAs are highly efficient at gene silencing, there are several challenges that have to be overcome to enable their use as therapeutics: 1.) siRNA size and high negative charge prevents passive uptake into cells; 2.) unmodified siRNAs exhibit both a short half-life in biological matrices due to rapid degradation by nucleases, and 3.) siRNA is potentially immunogenic. For certain tissues, like the eye and lung, some of these problems can be overcome by local administration of siRNA via intravitreal injection and inhalation, respectively. For siRNA delivery to the liver, tremendous progress over the past years has yielded several clinically validated delivery technologies, which have been shown to be safe and effective in humans.
- LNPs multi-component lipid nanoparticles
- the LNPs are designed to release their siRNA payload into the cytoplasm of hepatocytes, where they can engage with the RISC machinery.
- GalNAc multivalent N-acetylgalactosamine
- the ligand is designed to bind with high affinity and specificity to the asialoglycoprotein receptor (ASGPR), a cell surface receptor expressed on hepatocytes.
- ASGPR asialoglycoprotein receptor
- RNAi based therapies directed towards the liver, the ability to target other tissues is highly desirable.
- Monoclonal antibodies are particularity well suited as delivery vehicles because of their high specificity towards antigens expressed on target tissues and long-circulatory half-life. 5 These properties have contributed towards mAbs being a highly successful therapeutic class with currently over 60 FDA approved antibody-based therapeutics. 6
- mAbs are an already validated delivery vehicle for the generation of antibody-drug conjugates (ADCs), which involve the conjugation of highly potent small molecules for their selective delivery to target cancer cells.
- ADCs antibody-drug conjugates
- ARCs antibody -RNA conjugates
- ARCs antibody -RNA conjugates
- the disclosure provides dual variable domain (DVD) immunoglobulin conjugates and uses thereof are provided.
- the conjugate comprises a DVD immunoglobulin molecule having a first and a second variable domain, and a dsRNA molecule that is covalently conjugated to the second variable domain via a linker.
- Methods of making and using the conjugates for inhibiting target gene expression and thereapeutic uses are also provided.
- a conjugate of the invention comprises a dual variable domain immunoglobulin molecule (Ig) or an antigen-binding fragment thereof, and a double-stranded RNA (dsRNA) molecule, linked together via a linker.
- the dual variable domain immunoglobulin molecule comprises: (i) a first variable domain that binds to a binding target; and (ii) a second variable domain that comprises a reactive residue, where the linker is covalently conjugated to the reactive residue.
- the conjugates disclosed herein can be represented by the formula: Ig-(L-R) n , where Ig is a dual variable domain immunoglobulin molecule, or an immunoglobulin-fragment (antigen binding fragment) thereof, where the dual variable domain immunoglobulin molecule comprises a first variable domain that binds to a binding target, and a second variable domain that comprises a reactive residue; I, is a linker that is covalently conjugated to the reactive residue of the second variable domain of Ig; R is a double-stranded RNA molecule, and n is an integer selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, and 12.
- the double-stranded RNA molecule is conjugated to the linker and comprises a sense strand and an antisense strand, each strand having 14 to 40 nucleotides, wherein the antisense strand has sufficient complementarity to a target sequence to mediate RNA interference, and the dsRNA is capable of inhibiting the expression of the target gene.
- the disclosure provides a method for inhibiting the expression of a target gene sequence.
- the method comprises administering a conjugate described herein to a cell in an amount sufficient to inhibit expression of the target gene.
- the cell can be in vitro or in vivo.
- the disclosure provides a pharmaceutical composition comprising a conjugate described herein.
- the disclosure provides a method for treating a subject using a conjugate described herein.
- the method for treatment comprises administering a therapeutically effective amount of a conjugate described herein to a subject in need thereof.
- Fig. 1A is a schematic representation showing a comparison of h38C2 IgGl to an anti-multiple myeloma (MM) DVD-IgGl.
- the DVD-IgGl is composed of variable domains of anti-CD138, BCMA, or SLAMF7 (blue), h38C2 (green) with reactive lysine (Lys; K, yellow circle), and constant domains (gray).
- a fully human spacer sequence (ASTKGP, red lines) was used to join the two variable domains together.
- Fig. IB is a Coomassie stained SDS-PAGE confirming the purity of all MM-targeting DVD-IgGl s under non-reducing (expected -200 kDa) and reducing conditions (expected heavy chain -63 kDa, light chain -36 KDa). Molecular weights from a pre-stained protein ladder are shown on the left.
- Fig. 1C is a flow cytometry analysis showing specific binding of DVD-IgGl s against three MM cell lines (U-266, NCI-H929, and RPMI-8226). h38C2 IgGl (black) was used as a negative control.
- FIG. 2 shows structures of siRNA compounds b-lactam hapten (blue) functionalized siRNA at the 3’ (4, SEQ ID NO: 40 and 43) and 5’ (5, SEQ ID NO: 39 and 43) end targeting CTNNB1 for DVD-IgGl attachment.
- Control b-lactam hapten functionalized siRNA at the 3’ end (6, SEQ ID NO: 41 and 44) targeting human transthyretin (TTR trr r! Bookmark not def i ned.
- w h i c h is an irrelevant target in this study.
- Control siRNA targeting CTNNBl lacking the b-lactam hapten moiety (7, SEQ ID NO: 37 and 43) for DVD-IgGl conjugation Black circles in the siRNA indicate 2’-OMe-modified nucleosides, green circles stand for 2’-F-modified nucleosides, and blue circles for 2’-NMA 5-Me-U nucleosides containing a 5’-vinylphosphonate (VP) moiety. Yellow bars denote phosphorothioate (PS) linkages for exonuclease protection.
- PS phosphorothioate
- Fig. 3A is a schematic representation of ARC assembly.
- ARCs (8-13) were assembled by incubating DVD-IgGls (1-3) with ten equivalents (eq) of b-lactam siRNA (4 and 5) at room temperature (rt) for 2 h.
- siRNA attachment red and black helix
- Fig. 3B is a line graph shoing the catalytic retro-aldol activity of the reactive Lys of h38C2.
- the activity was measured using methodol as a substrate, which is converted to a fluorescent aldehyde and detected. The signal is reported in relative fluorescent units (RFU; mean ⁇ SD of triplicates).
- the assembled ARCs (8-13) were catalytically inactive due to amide formation at the reactive Lys, indicating complete conjugation.
- Unconjugated DVD-IgGls (1-3) were used as positive controls and trastuzumab IgGl (black) as a negative control.
- Fig. 4A is a bar graph showing CTNNB1 mRNA knockdown in NCI-H929 cells after treatment with SLAMF7 (8 and 11), BCMA (9 and 12), or CD138 (10 and 13) targeting ARCs for 72 h at 37 °C at 90 nM (antibody concentration).
- Unconjugated DVD-IgGls (1-3) (black) and transfected free siRNA ( Figure 2, 7) (white) were used as negative and positive controls, respectively.
- Fig. 4B is a bar graph showing dose response of BCMA-targeting ARCs (9 and 12) with NCI-H929 cells.
- BCMA ARC (14) is conjugated to an siRNA targeting human TTR ( Figure 2, 6) and was used as a negative control. Error bars in (A) and (B) correspond to biological duplicates. A student’s t-test was used to determine significance when each group was compared to the untreated group.
- Fig. 5 is a bar graph showing CTNNBl mRNA knockdown in NCI-H929 cells after treatment with unpurified or purified BCMA targeting ARCs (9 and 12) for 72 h at 37 °C at 90 nM (antibody concentration).
- Unconjugated anti-BCMA DVD-IgGl (2), anti-BCMA ARCs conjugated to an siRNA targeting human TTR (14), and anti-HER2 ARCs (15 and 16) conjugated to an siRNA targeting CTNNBl were used as negative controls.
- Transfected free siRNA ( Figure 2, 7) was used as a positive control. Error bars correspond to biological triplicates.
- Fig. 6 is gel picture showing CTNNBl protein knockdown in NCI-H929 cells after treatment with BCMA targeting ARCs (9 and 12, lanes 3 and 4) for 72 h at 37 °C at 90 nM (antibody concentration).
- Untreated cells (lane 1), unconjugated anti-BCMA DVD-IgGl (2, lane 2), anti-BCMA ARC targeting TTR (14, lane 5), and anti-HER2 ARCs targeting CTNNBl (15 and 16, lanes 6 and 7) were used as negative controls.
- Transfected free siRNA (7, lane 8) was used as a positive control.
- the western blot depicted is a representative example from 3 biological replicates.
- Fig. 7 is a schematic representation showing the synthesis of an exemplary sense strand 19 (SEQ ID NO: 39) containing a b-lactam moiety by reaction of bis ⁇ -lactam derivative 15 with the corresponding single-stranded siRNA 16 (SEQ ID NO: 36) containing an amino function appended at the 5’-end.
- Compounds 20 and 21 containing a b-lactam moiety at the 3’- end of the strand were prepared analogously from the corresponding precursor strands 17 and 18.
- Figs. 8A and 8B are HPLC chromatograms of 19 (SEQ ID NO: 18) without (Fig. 8A) and with butylamine (Fig. 8B) pretreatment. Complete cleavage of the product by HPLC eluents was observed. After pretreatment of an aliquot with excess of butylamine, the product was converted to the butylamine adduct prior to the chromatography.
- Fig. 9 shows the catalytic retro-aldol activity of the reactive Lys of h38C2.
- the activity was measured using methodol as a substrate, which is converted to a fluorescent aldehyde and detected. The signal is reported in relative fluorescent units (RFU; mean ⁇ SD of triplicates).
- the anti-BCMA DVD-IgGl (2) was conjugated to an siRNA-targeting human TTR ( Figure 2, 6) using the conditions shown in Figure 3A to generate the antibody-RNA conjugate (14).
- the ARC is catalytically inactive due to amide formation at the reactive Lys, indicating complete conjugation.
- Unconjugated anti-BCMA DVD-IgGl (2) was used as a positive control and trastuzumab IgGl (black) as a negative control.
- Fig. 10A is a schematic showing optimized assembly of anti-BCMA ARC 9 and 12.
- ARCs were assembled by incubating the anti-BCMA DVD-IgGl (2) with two equivalents (eq) of b-lactam siRNA (4 and 5; Fig. 2) at room temperature (rt) for 4 h.
- siRNA attachment red and black helix
- Fig 10B show the catalytic retro-aldol activity of the reactive Lys of h38C2 of the anti-BCMA ARCs 9 and 12 (Fig. 10A).
- the activity was measured using methodol as a substrate, which is converted to a fluorescent aldehyde and detected. The signal is reported in relative fluorescent units (RFU; mean ⁇ SD of triplicates).
- the assembled ARCs (9 and 12) were catalytically inactive due to amide formation at the reactive Lys, indicating complete conjugation.
- Unconjugated anti-BCMA DVD-IgGl (2) was used as a positive control and trastuzumab IgGl (black) as a negative control.
- Figs. 11A-11D are size exclusion chromatographs showing purified anti-BCMA DVD-IgGl 2 (Fig. 11A) and ARCs anti-BCMA ARC 9 (Fig. 11B), anti-BCMA ARC 12 (Fig. 11C), and anti-BCMA ARC 14 (Fig. 11D). The major peaks are indicated in mL.
- Figs. 12A-12D show the assembly of the anti-HER2 control ARCs and their size- exclusion chromatographs.
- Fig. 12A shows the catalytic retro-aldol activity of the reactive Lys of h38C2.
- the activity was measured using methodol as a substrate after conjugation of the anti- HER2 DVD-IgGl with b-lactam siRNA (4 and 5) as described in Figure 3.
- the signal is reported in relative fluorescent units (RFU; mean ⁇ SD of triplicates).
- the assembled ARCs (15 and 16) were catalytically inactive due to amide formation at the reactive Lys, indicating complete conjugation.
- Unconjugated anti-HER2 DVD blue was used as a positive control and trastuzumab IgGl (black) as a negative control.
- B anti-HER2 DVD.
- C anti-HER2 ARC (15).
- D anti-HER2 ARC (16). Figs.
- 12-B-12D are size exclusion chromatographs showing purified anti-HER2 DVD (Fig. 12B), anti-HER2 ARC 15 (Fig. 12C), and anti-HER2 ARC 16 (Fig. 12D). The major peaks are indicated in mL.
- Figs. 13A and 13B are bar graphs showing b-catenin knockdown in U266 (Fig. 13A) and RPMI-8226 (Fig. 13B) cells after treatment with SLAMF7, BCMA, or CD138 targeting ARCs (8-13) for 72 h at 37 °C at 90 nM.
- Unconjugated DVDs (1-3) (black) and transfected free siRNA (6) (gray) were used as controls.
- a student’s t-test was used to determine significance when each group was compared to the untreated group.
- the error bars correspond to biological triplicates
- Figs. 14A-14C show cytotoxicity of ARCs (top-to-down: 1, 8, 11, 2, 9, 12, 3, 10, 13, and 25, CD138 ADC is 28) following incubation with MM cell lines U266 (Fig. 14A), NCI-H929 (Fig. 14B) and RPMI-8226 (Fig. 14C) for 72 h at 37 °C (mean ⁇ SD of triplicates). Unconjugated DVDs were used as negative controls and an anti-CD138 DVD conjugated to cytotoxic MMAF (22, black) was used as a positive control.
- Figs. 15A-15C show surface plasmon resonance (SPR) binding analysis of exemplary anti-BSMA Fab-DVD conjugated with siRNA_4 (Fig. 15A) and with siRNA_5 (Fig. 15B) and without conjugation with an siRNA (Fig. 15C).
- the calculated equilibrium dissociation constants (V ci ) were identical before and after conjugation, indicating that the conjugation with siRNA does not affect outer variable domain binding to BCMA.
- Fig. 16 is a schematic representation of a DVD-IgGl ARC construct (1 :2 conjugation).
- Fig. 17 is a schematic representation of an exemplary DVD-IgGl ARC/EEP construct (1 :2 conjugation) with a fusogenic peptide.
- Figs. 18 and 19 show size exclusion chromatography and flow cytometry analysis (Fig. 18) and Fab format, binding and surface plasmon resonance analysis (Fig. 19) of an exemplary DVD-IgGl ARC (B CMA/CTNNB 1-A).
- Figs. 20 and 21 show knockdown of CTNNBl mRNA (Fig. 20) and CTNNBl protein (Fig. 21) with an exemplary DVD- IgGl ARC (BCMA/CTNNB 1-A). Sequences in Fig. 20 are SEQ ID NO: 39 (top) and SEQ ID NO: 43 (bottom).
- Fig. 22 shows pharmacokinetics of an exemplary DVD- IgGl ARC (BCMA/CTNNB 1-A). Sequences are SEQ ID NO: 51 (top) and SEQ ID NO: 43 (bottom).
- FIG. 23 is a schematic showing effect of interferon regulatory factor 4 (IRF4) in multiple myeloma. Adapted from Shaffer et al. Nature (2008), 454(7201):226-31 and Shaffer et al. Clin Cancer Res (2009), 15(9): 2954-2961.
- IRF4 interferon regulatory factor 4
- Fig. 24 shows knockdown of IRF4 mRNA with an exemplary DVD-IgGl ARC (BCMA/CTNNB 1-A). Sequences are SEQ ID NO: 52 (top) and SEQ ID NO: 53 (bottom).
- siRNA cargo molecules can compromise binding affinity and cell internalization once conjugated to the DVD; the siRNA molecules can lose their gene- silencing activity once conjugated to the DVD; siRNA can have enhanced nucleolytic degradation once conjugated to the DVD; chemistry for conjugating drugs to DVD (e.g., labile b- lactams) is not compatible with the currently established solid support synthesis of siRNAs; the reactivity of b-lactam moiety attached to the siRNA may not be high enough to support efficient conjugation to the uniquely reactive Lys residue within the hydrophobic pocket of the DVD using mild and neutral conditions so to not compromise integrity of the DVD and the siRNA; and purification of DVD-siRNA conjugates is not obvious.
- the attachment point on the siRNA can also comprise the activity of the siRNA.
- siRNAs containing a 3- aryl- -lactam moiety can be efficiently and quantitatively conjugated to the corresponding DVDs using mild and neutral conditions in aqueous buffer (phosphate buffered saline, pH 7.4) without compromising the integrity of either siRNA or DVD. It was also surprising and unexpected that DVD-siRNA conjugates can be efficiently purified using size-exclusion chromatography.
- the invention provides a conjugate comprising: (i) a dual variable domain immunoglobulin molecule (Ig), or an antigen-binding fragment thereof, wherein the dual variable domain immunoglobulin molecule comprises a first variable domain that binds to a binding target and a second variable domain that comprises a reactive residue; (ii) a linker covalently conjugated to the reactive residue of the second variable domain of Ig; and (iii) a double-stranded RNA (dsRNA) molecule conjugated to the linker, where the dsRNA is capable of inhibiting the expression of a target gene, where the dsRNA comprises a sense strand and an antisense strand, each strand having 14 to 40 nucleotides, wlierein the antisense strand has sufficient complementarity to the target sequence to mediate RNA interference.
- dsRNA molecules a dual variable domain immunoglobulin molecule (Ig), or an antigen-binding fragment thereof, wherein the dual variable domain immunoglobulin
- the dsRNA molecule comprises a sense strand (also referred to as passenger strand) and an antisense strand (also referred to as guide strand).
- a sense strand also referred to as passenger strand
- an antisense strand also referred to as guide strand.
- Each strand of the dsRNA molecule independently can range from 12-40 nucleotides in length.
- each strand independently can be between 14-40 nucleotides in length, 17-37 nucleotides in length, 25-37 nucleotides in length, 27-30 nucleotides in length, 17-23 nucleotides in length, 17-21 nucleotides in length, 17-19 nucleotides in length, 19-25 nucleotides in length, 19-23 nucleotides in length, 19-21 nucleotides in length, 21-25 nucleotides in length, or 21-23 nucleotides in length.
- the sense and antisense strands can be equal length or unequal length. In some embodiments, the antisense strand is longer, e.g., by 1, 2, 3, 4, or 5 nucleotides than the sense strand.
- the antisense strand is of length 18 to 35 nucleotides. In some embodiments, the antisense strand is 21-25, 19-25, 19-21 or 21-23 nucleotides in length. In some particular embodiments, the antisense strand is 23 nucleotides in length.
- the sense strand can be, in some embodiments, 18-35 nucleotides in length. In some embodiments, the sense strand is 21-25, 19-25, 19-21 or 21-23 nucleotides in length. In some particular embodiments, the antisense strand is 21 nucleotides in length. [0048] In some particular embodiments, sense strand is 21 nucleotides in length and the antisense strand is 23 nucleotides in length.
- the double-stranded RNA molecule has a double-stranded or duplex region.
- the duplex region is 12-40 nucleotide base pairs in length.
- the dsRNA has a duplex region of 12-25 nucleotide pairs in length.
- the dsRNA has a duplex region of 18, 19, 20, 21, 22, 22, 23, 24, or 25 nucleotide base pairs in length.
- the dsRNA has a duplex region of 19, 20, 21 or 22 nucleotide base pairs in length.
- the dsRNA molecule can comprise thermally stabilizing modifications.
- the dsRNA molecule can comprise at least four, e.g., five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen or more thermally stabilizing modifications.
- both the sense and the antisense strands comprise at least one, e.g., two, three, four or more thermally stabilizing modifications.
- the thermally stabilizing modification can occur on any nucleotide of the sense strand or antisense strand.
- the thermally stabilizing modification can occur on every nucleotide on the sense strand and/or antisense strand; each thermally stabilizing modification can occur in an alternating pattern on the sense strand or antisense strand; or the sense strand and antisense strand both comprise thermally stabilizing modifications in an alternating pattern.
- the alternating pattern of the thermally stabilizing modifications on the sense strand can be the same or different from the antisense strand, and the alternating pattern of the thermally stabilizing modifications on the sense strand can have a shift relative to the alternating pattern of the thermally stabilizing modifications on the antisense strand.
- the antisense strand of the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more thermally stabilizing modifications.
- the antisense strand comprises two, three, four, five or six thermally stabilizing modifications.
- a thermally stabilizing modification in the antisense strand can be present at any position.
- the antisense strand comprises at least three thermally stabilizing modifications.
- the antisense strand comprises thermally stabilizing modifications at least at positions 2, 14 and 16 from the 5’-end.
- the antisense comprises at least four thermally stabilizing modifications.
- the antisense comprises thermally stabilizing modifications at least at positions 2, 6, 14 and 16 from the 5’-end.
- the antisense strand comprises at least five thermally stabilizing modifications.
- the antisense strand comprises thermally stabilizing modifications at least at positions 2, 6, 9, 14 and 16 from the 5’-end.
- the antisense strand comprises at least six thermally stabilizing modifications.
- the antisense strand comprises thermally stabilizing modifications at least at positions 2, 6, 8, 9, 14 and 16 from the 5’-end.
- the sense strand of the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more thermally stabilizing modifications.
- the sense strand comprises two, three, four, or five thermally stabilizing modifications.
- the sense strand comprises three or four thermally stabilizing modifications.
- a thermally stabilizing modification in the sense strand can be present at any positions.
- the sense strand comprises at least three thermally stabilizing modifications.
- the sense comprises thermally stabilizing modification at least at positions 7, 10 and 11 from the 5’-end.
- the sense strand comprises at least four thermally stabilizing modifications.
- the sense comprises thermally stabilizing modification at least at positions 7, 9, 10 and 11 from the 5’-end.
- the sense strand comprises thermally stabilizing modifications at positions opposite or complimentary to positions 11, 12 and 15 of the antisense strand, counting from the 5’-end of the antisense strand. In some other embodiments, the sense strand comprises thermally stabilizing modifications at positions opposite or complimentary to positions 11, 12, 13 and 15 of the antisense strand, counting from the 5’-end of the antisense strand. In some embodiments, the sense strand comprises a block of two, three or four thermally stabilizing modification.
- the sense strand comprises thermally stabilizing modifications at least at positions 7, 9, and 11 from the 5’-end
- the antisense strand comprises thermally stabilizing modifications at least at positions 2, 14 and 16 from the 5’-end.
- the sense strand comprises thermally stabilizing modifications at least at positions 7, 9, and 11 from the 5’-end
- the antisense strand comprises thermally stabilizing modifications at least at positions 2, 6, 9, 14 and 16 from the 5’-end.
- the sense strand comprises thermally stabilizing modifications at least at positions 7, 9, and 11 from the 5’-end
- the antisense strand comprises thermally stabilizing modifications at least at positions 2, 6, 8, 9, 14 and 16 from the 5’-end.
- the sense strand comprises thermally stabilizing modifications at least at positions 7, 9, 10, and 11 from the 5’-end
- the antisense strand comprises thermally stabilizing modifications at least at positions 2, 14 and 16 from the 5’-end.
- the sense strand comprises thermally stabilizing modifications at least at positions 7, 9, 10, and 11 from the 5’-end
- the antisense strand comprises thermally stabilizing modifications at least at positions 2, 6, 9, 14 and 16 from the 5’-end.
- the sense strand comprises thermally stabilizing modifications at least at positions 7, 9, 10, and 11 from the 5’-end
- the antisense strand comprises thermally stabilizing modifications at least at positions 2, 6, 8, 9, 14 and 16 from the 5’-end.
- the sense strand does not comprise a thermally stabilizing modification in position opposite or complimentary to the thermally destabilizing modification of the duplex in the antisense strand.
- thermally stabilizing modifications include, but are not limited to 2’- fluoro modifications and locked nucleic acid (LNA).
- LNA locked nucleic acid
- the dsRNA molecule can comprise 2’-fluoro nucleotides, i.e., 2’-fluoro modifications.
- the dsRNA molecule can comprise at least four, e.g., five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen or more 2’-fluoro nucleotides.
- the 2’-fluoro nucleotides all can be present in one strand.
- both the sense and the antisense strands comprise at least two 2’-fluoro nucleotides.
- the 2’-fluoro modification can occur on any nucleotide of the sense strand or antisense strand.
- the 2’-fluoro modification can occur on every nucleotide on the sense strand and/or antisense strand; each 2’-fluoro modification can occur in an alternating pattern on the sense strand or antisense strand; or the sense strand and antisense strand both comprise 2’-fluoro modifications in an alternating pattern.
- the alternating pattern of the 2’- fluoro modifications on the sense strand can be the same or different from the antisense strand, and the alternating pattern of the 2’-fluoro modifications on the sense strand can have a shift relative to the alternating pattern of the 2’-fluoro modifications on the antisense strand.
- the antisense strand of the dsRNA molecule can comprise at least two (e.g., two, three, four, five, six, seven, eight, nine, ten or more) 2’-fluoro nucleotides.
- the antisense strand comprises two, three, four, five or six 2’-fluoro nucleotides.
- a 2’-fluoro modification in the antisense strand can be present at any position.
- the antisense strand comprises at least three 2’-fluoro nucleotides.
- the antisense strand comprises 2’-fluoro nucleotides at least at positions 2, 14 and 16 from the 5’-end.
- the antisense comprises at least four 2’-fluoro nucleotides.
- the antisense comprises 2’-fluoro nucleotides at least at positions 2, 6, 14 and 16 from the 5’-end.
- the antisense strand comprises at least five 2’-fluoro nucleotides.
- the antisense strand comprises 2’-fluoro nucleotides at least at positions 2, 6, 9, 14 and 16 from the 5’-end.
- the antisense strand comprises at least six 2’-fluoro nucleotides.
- the antisense strand comprises 2’-fluoro nucleotides at least at positions 2, 6, 8, 9, 14 and 16 from the 5’-end.
- the sense strand of the dsRNA molecule can comprise at least two (e.g., two, three, four, five, six, seven, eight, nine, ten or more) 2’-fluoro nucleotides.
- the sense strand comprises two, three, four, or five 2’-fluoro nucleotides.
- the sense strand comprises three or four 2’-fluoro nucleotides.
- a 2’-fluoro modification in the sense strand can be present at any positions.
- the sense strand comprises at least three 2’-fluoro nucleotides.
- the sense comprises 2’-fluoro nucleotides at least at positions 7, 10 and 11 from the 5’-end.
- the sense strand comprises at least four 2’-fluoro nucleotides.
- the sense comprises 2’- fluoro nucleotides at least at positions 7, 9, 10 and 11 from the 5’-end.
- the sense strand comprises 2’-fluoro nucleotides at positions opposite or complimentary to positions 11, 12 and 15 of the antisense strand, counting from the 5’-end of the antisense strand. In some other embodiments, the sense strand comprises 2’-fluoro nucleotides at positions opposite or complimentary to positions 11, 12, 13 and 15 of the antisense strand, counting from the 5’-end of the antisense strand. In some embodiments, the sense strand comprises a block of two, three or four 2’-fluoro nucleotides.
- the sense strand comprises 2’-fluoro nucleotides at least at positions 7, 9, and 11 from the 5’-end
- the antisense strand comprises 2’-fluoro nucleotides at least at positions 2, 14 and 16 from the 5’-end.
- the sense strand comprises 2’-fluoro nucleotides at least at positions 7, 9, and 11 from the 5’-end
- the antisense strand comprises 2’-fluoro nucleotides at least at positions 2, 6, 9, 14 and 16 from the 5’-end.
- the sense strand comprises 2’-fluoro nucleotides at least at positions 7, 9, and 11 from the 5’-end
- the antisense strand comprises 2’-fluoro nucleotides at least at positions 2, 6, 8, 9, 14 and 16 from the 5’-end.
- the sense strand comprises 2’-fluoro nucleotides at least at positions 7, 9, 10, and 11 from the 5’-end
- the antisense strand comprises 2’-fluoro nucleotides at least at positions 2, 14 and 16 from the 5’-end.
- the sense strand comprises 2’-fluoro nucleotides at least at positions 7, 9, 10, and 11 from the 5’-end
- the antisense strand comprises 2’-fluoro nucleotides at least at positions 2, 6, 9, 14 and 16 from the 5’-end.
- the sense strand comprises 2’-fluoro nucleotides at least at positions 7, 9, 10, and 11 from the 5’-end
- the antisense strand comprises 2’-fluoro nucleotides at least at positions 2, 6, 8, 9, 14 and 16 from the 5’-end.
- the antisense strand does not comprise a 2’-fluoro nucleotide at positions 3-9, counting from 5’-end.
- the dsRNA molecule can comprise at least one, e.g., one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty or more 2’-OMe nucleotides.
- the 2’-OMe nucleotides all can be present in one strand.
- both the sense and the antisense strands comprise at least one 2’-OMe nucleotide.
- the 2’-OMe modification can occur on any nucleotide of the sense strand or antisense strand.
- the 2’-OMe modification can occur on every nucleotide on the sense strand and/or antisense strand; each thermally stabilizing modification can occur in an alternating pattern on the sense strand or antisense strand; or the sense strand and antisense strand both comprise 2’-OMe modifications in an alternating pattern.
- the alternating pattern of the thermally stabilizing modifications on the sense strand can be the same or different from the antisense strand, and the alternating pattern of the thermally stabilizing modifications on the sense strand can have a shift relative to the alternating pattern of the 2’-OMe modifications on the antisense strand.
- the antisense strand of the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen or more 2’-OMe modifications.
- a thermally stabilizing modification in the antisense strand can be present at any position.
- the antisense strand comprises at least three thermally stabilizing modifications.
- the antisense strand does not comprise 2’-OMe modifications at least at positions 2, 14 and 16 from the 5’-end. In some other embodiments, the antisense does not comprise 2’-OMe modifications at least at positions 2, 6, 14 and 16 from the 5’-end. In some further embodiments, the antisense strand does not comprise 2’-OMe modifications at least at positions 2, 6, 9, 14 and 16 from the 5’-end. In still some further embodiments, the antisense strand does not comprise 2’-OMe modifications at least at positions 2, 6, 8, 9, 14 and 16 from the 5’-end.
- the sense strand of the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen or more 2’-OMe modifications.
- a 2’-OMe modification in the sense strand can be present at any positions.
- the sense does not comprise 2’-OMe modifications at least at positions 7, 10 and 11 from the 5’-end.
- the sense does not comprise 2’-OMe modifications at least at positions 7, 9, 10 and 11 from the 5’- end.
- the dsRNA molecule can comprise locked nucleic acid (LNA).
- the dsRNA molecule can comprise can comprise at least one, e.g., one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty or more LNA modifications.
- the LNA nucleotides all can be present in one strand.
- both the sense and the antisense strands comprise at least LNA modifications.
- the LNA modification can occur on any nucleotide of the sense strand or antisense strand.
- the LNA modification can occur on every nucleotide on the sense strand and/or antisense strand; each LNA modification can occur in an alternating pattern on the sense strand or antisense strand; or the sense strand and antisense strand both comprise LNA modifications in an alternating pattern.
- the alternating pattern of the LNA modifications on the sense strand can be the same or different from the antisense strand, and the alternating pattern of the LNA modifications on the sense strand can have a shift relative to the alternating pattern of the 2’-fluoro modifications on the antisense strand.
- the antisense strand of the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more LNA modifications.
- a LNA modification in the antisense strand can be present at any position.
- the sense strand of the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more LNA modifications.
- a LNA modification in the sense strand can be present at any position.
- the sense strand comprises at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more LNA modifications and the antisense strand does not comprise a 2’-fluoro nucleotide at positions 3-9, counting from 5’-end.
- the dsRNA molecule can comprise bridged nucleic acid (BNA).
- BNA bridged nucleic acid
- the dsRNA molecule can comprise can comprise at least one, e.g., one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty or more BNA modifications.
- the BNA nucleotides all can be present in one strand.
- both the sense and the antisense strands comprise at least BNA modifications.
- the BNA modification can occur on any nucleotide of the sense strand or antisense strand.
- the BNA modification can occur on every nucleotide on the sense strand and/or antisense strand; each BNA modification can occur in an alternating pattern on the sense strand or antisense strand; or the sense strand and antisense strand both comprise BNA modifications in an alternating pattern.
- the alternating pattern of the BNA modifications on the sense strand can be the same or different from the antisense strand, and the alternating pattern of the BNA modifications on the sense strand can have a shift relative to the alternating pattern of the 2’-fluoro modifications on the antisense strand.
- the antisense strand of the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more BNA modifications.
- a BNA modification in the antisense strand can be present at any position.
- the sense strand of the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more BNA modifications.
- a BNA modification in the sense strand can be present at any position.
- the sense strand comprises at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more BNA modifications and the antisense strand does not comprise a 2’-fluoro nucleotide at positions 3-9, counting from 5’-end.
- the dsRNA molecule can comprise cyclohexene nucleic acid (CeNA).
- the dsRNA molecule can comprise can comprise at least one, e.g., one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty or more CeNA modifications.
- the CeNA nucleotides all can be present in one strand.
- both the sense and the antisense strands comprise at least CeNA modifications.
- the CeNA modification can occur on any nucleotide of the sense strand or antisense strand.
- the CeNA modification can occur on every nucleotide on the sense strand and/or antisense strand; each CeNA modification can occur in an alternating pattern on the sense strand or antisense strand; or the sense strand and antisense strand both comprise CeNA modifications in an alternating pattern.
- the alternating pattern of the CeNA modifications on the sense strand can be the same or different from the antisense strand, and the alternating pattern of the CeNA modifications on the sense strand can have a shift relative to the alternating pattern of the 2’-fluoro modifications on the antisense strand.
- the antisense strand of the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more CeNA modifications. Without limitations, a CeNA modification in the antisense strand can be present at any position.
- the sense strand of the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more CeNA modifications.
- a CeNA modification in the sense strand can be present at any position.
- the sense strand comprises at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more CeNA modifications and the antisense strand does not comprise a 2’-fluoro nucleotide at positions 3-9, counting from 5’-end.
- the dsRNA molecule comprises one or more overhang regions (i.e., single-stranded region) and/or capping groups of dsRNA molecule at the 3’-end, or 5’-end or both ends of a strand.
- the overhang can be 1-10 nucleotides in length, 1-6 nucleotides in length, 1-5 nucleotides in length, 1-4 nucleotides in length, 1-3 nucleotides in length, 2-6 nucleotides in length, 2-5 nucleotides in length 2-4 nucleotides in length, 2-3 nucleotides in length, or 1-2 nucleotides in length.
- the overhangs can be the result of one strand being longer than the other, or the result of two strands of the same length being staggered.
- the overhang can form a mismatch with the sequence being targeted or it can be complementary to the sequence being targeted or can be other sequence.
- the first and second strands can also be joined, e.g., by additional bases to form a hairpin, or by other non-base linkers. Without limitations the overhang can be present at the 3’-end of the sense strand, antisense strand or both strands.
- the dsRNA molecule comprises a single overhang.
- the dsRNA molecule has a single overhang and the overhang is at least two, three, four, five, six, seven, eight, nine, or ten nucleotides in length.
- the overhang is present at the 3’-end of the antisense strand.
- the dsRNA comprises a two nucleotide overhang at the 3’-end of the antisense strand.
- the dsRNA can also have a blunt end.
- one end of the dsRNA is a blunt end and the other end has an overhang.
- the blunt end can be located at the 5’-end of the antisense strand (or the 3’-end of the sense strand) or vice versa.
- the antisense strand of the dsRNA has a nucleotide overhang at the 3’-end, and the 5’-end is blunt.
- the asymmetric blunt end at the 5’-end of the antisense strand and 3’- end overhang of the antisense strand favor the guide strand loading into RISC process.
- the dsRNA has a 2 nucleotide overhang on the 3’-end of the antisense strand and a blunt end at the 5’-end of the antisense strand.
- the dsRNA molecule has two blunt ends, i.e., at both ends of the dsRNA.
- the nucleotides in the overhang region of the dsRNA molecule can each independently be a modified or unmodified nucleotide including, but not limited to 2’-sugar modified, such as, 2’-Fluoro, 2’-(9-methyl, thymidine (T), 2’ -G-methoxy ethyl -5-methyl uridine, 2’-(9-methoxyethyladenosine, 2’-0-methoxyethyl-5-methylcytidine, GNA, SNA, hGNA, hhGNA, mGNA, TNA, h’GNA, and any combinations thereof.
- 2’-sugar modified such as, 2’-Fluoro, 2’-(9-methyl, thymidine (T), 2’ -G-methoxy ethyl -5-methyl uridine, 2’-(9-methoxyethyladenosine, 2’-0-methoxy
- TT can be an overhang sequence for either end on either strand.
- the 5’- or 3’- overhangs at the sense strand, antisense strand or both strands of the dsRNA molecule can be phosphorylated.
- the overhang region contains two nucleotides having a phosphorothioate intemucleotide linkage between the two nucleotides, where the two nucleotides in the overhang region can be the same or different.
- the dsRNA molecule can comprise at least one, e.g., two, three, four, five, six, seven, eight, nine, ten or more phosphorothioate or methylphosphonate intemucleotide linkage.
- the phosphorothioate or methylphosphonate intemucleotide linkage modification can occur on any nucleotide of the sense strand or antisense strand or both in any position of the strand.
- the intemucleotide linkage modification can occur on every nucleotide on the sense strand and/or antisense strand; each intemucleotide linkage modification can occur in an alternating pattern on the sense strand or antisense strand; or the sense strand or antisense strand comprises both intemucleotide linkage modifications in an alternating pattern.
- the alternating pattern of the intemucleotide linkage modification on the sense strand can be the same or different from the antisense strand, and the alternating pattern of the intemucleotide linkage modification on the sense strand can have a shift relative to the alternating pattern of the intemucleotide linkage modification on the antisense strand.
- the dsRNA molecule comprises the phosphorothioate or methylphosphonate intemucleotide linkage modification in the overhang region.
- the overhang region comprises two nucleotides having a phosphorothioate or methylphosphonate intemucleotide linkage between the two nucleotides.
- Intemucleotide linkage modifications also may be made to link the overhang nucleotides with the terminal paired nucleotides within duplex region.
- the overhang nucleotides can be linked through phosphorothioate or methylphosphonate intemucleotide linkage, and optionally, there may be additional phosphorothioate or methylphosphonate intemucleotide linkages linking the overhang nucleotide with a paired nucleotide that is next to the overhang nucleotide.
- these terminal three nucleotides can be at the 3’-end of the antisense strand.
- the sense strand of the dsRNA molecule comprises 1-10 blocks of two to ten phosphorothioate or methylphosphonate intemucleotide linkages separated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 phosphate intemucleotide linkages, wherein one of the phosphorothioate or methylphosphonate intemucleotide linkages is placed at any position in the oligonucleotide sequence and the said sense strand is paired with an antisense strand comprising any combination of phosphorothioate, methylphosphonate and phosphate intemucleotide linkages or an antisense strand comprising either phosphorothioate or methylphosphonate or phosphate linkage.
- the antisense strand of the dsRNA molecule comprises two blocks of two phosphorothioate or methylphosphonate intemucleotide linkages separated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 phosphate intemucleotide linkages, wherein one of the phosphorothioate or methylphosphonate intemucleotide linkages is placed at any position in the oligonucleotide sequence and the said antisense strand is paired with a sense strand comprising any combination of phosphorothioate, methylphosphonate and phosphate intemucleotide linkages or an antisense strand comprising either phosphorothioate or methylphosphonate or phosphate linkage.
- the antisense strand of the dsRNA molecule comprises two blocks of three phosphorothioate or methylphosphonate intemucleotide linkages
- the antisense strand of the dsRNA molecule comprises two blocks of four phosphorothioate or methylphosphonate intemucleotide linkages separated by 1, 2,
- the antisense strand of the dsRNA molecule comprises two blocks of five phosphorothioate or methylphosphonate intemucleotide linkages separated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 phosphate intemucleotide linkages, wherein one of the phosphorothioate or methylphosphonate intemucleotide linkages is placed at any position in the oligonucleotide sequence and the said antisense strand is paired with a sense strand comprising any combination of phosphorothioate, methylphosphonate and phosphate intemucleotide linkages or an antisense strand comprising either phosphorothioate or methylphosphonate or phosphate linkage.
- the antisense strand of the dsRNA molecule comprises two blocks of six phosphorothioate or methylphosphonate intemucleotide linkages separated by 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 phosphate intemucleotide linkages, wherein one of the phosphorothioate or methylphosphonate intemucleotide linkages is placed at any position in the oligonucleotide sequence and the said antisense strand is paired with a sense strand comprising any combination of phosphorothioate, methylphosphonate and phosphate intemucleotide linkages or an antisense strand comprising either phosphorothioate or methylphosphonate or phosphate linkage.
- the antisense strand of the dsRNA molecule comprises two blocks of seven phosphorothioate or methylphosphonate intemucleotide linkages separated by 1, 2, 3, 4, 5, 6, 7 or 8 phosphate intemucleotide linkages, wherein one of the phosphorothioate or methylphosphonate intemucleotide linkages is placed at any position in the oligonucleotide sequence and the said antisense strand is paired with a sense strand comprising any combination of phosphorothioate, methylphosphonate and phosphate intemucleotide linkages or an antisense strand comprising either phosphorothioate or methylphosphonate or phosphate linkage.
- the antisense strand of the dsRNA molecule comprises two blocks of eight phosphorothioate or methylphosphonate intemucleotide linkages separated by 1, 2, 3, 4, 5 or 6 phosphate intemucleotide linkages, wherein one of the phosphorothioate or methylphosphonate intemucleotide linkages is placed at any position in the oligonucleotide sequence and the said antisense strand is paired with a sense strand comprising any combination of phosphorothioate, methylphosphonate and phosphate intemucleotide linkages or an antisense strand comprising either phosphorothioate or methylphosphonate or phosphate linkage.
- the antisense strand of the dsRNA molecule comprises two blocks of nine phosphorothioate or methylphosphonate intemucleotide linkages separated by 1, 2, 3 or 4 phosphate intemucleotide linkages, wherein one of the phosphorothioate or methylphosphonate intemucleotide linkages is placed at any position in the oligonucleotide sequence and the said antisense strand is paired with a sense strand comprising any combination of phosphorothioate, methylphosphonate and phosphate intemucleotide linkages or an antisense strand comprising either phosphorothioate or methylphosphonate or phosphate linkage.
- the dsRNA molecule comprises one or more phosphorothioate or methylphosphonate intemucleotide linkage modification within 1-10 of the termini position(s) of the sense and/or antisense strand.
- at least 2, 3, 4, 5, 6, 7, 8, 9 or 10 nucleotides may be linked through phosphorothioate or methylphosphonate intemucleotide linkage at one end or both ends of the sense and/or antisense strand.
- the dsRNA molecule comprises one or more phosphorothioate or methylphosphonate intemucleotide linkage modification within 1-10 of the internal region of the duplex of each of the sense and/or antisense strand.
- at least 2, 3, 4, 5, 6, 7, 8, 9 or 10 nucleotides may be linked through phosphorothioate methylphosphonate intemucleotide linkage at position 8-16 of the duplex region counting from the 5’-end of the sense strand; the dsRNA molecule can optionally further comprise one or more phosphorothioate or methylphosphonate intemucleotide linkage modification within 1-10 of the termini position(s).
- the dsRNA molecule comprises one to five phosphorothioate or methylphosphonate intemucleotide linkage modification(s) within position 1-5 and one to five phosphorothioate or methylphosphonate intemucleotide linkage modification(s) within position 18-23 of the sense strand (counting from the 5’-end), and one to five phosphorothioate or methylphosphonate intemucleotide linkage modification at positions 1 and 2 and one to five within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises one phosphorothioate intemucleotide linkage modification within position 1-5 and one phosphorothioate or methylphosphonate intemucleotide linkage modification within position 18-23 of the sense strand (counting from the 5’-end), and one phosphorothioate intemucleotide linkage modification at positions 1 and 2 and two phosphorothioate or methylphosphonate intemucleotide linkage modifications within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises two phosphorothioate intemucleotide linkage modifications within position 1-5 and one phosphorothioate intemucleotide linkage modification within position 18-23 of the sense strand (counting from the 5’-end), and one phosphorothioate intemucleotide linkage modification at positions 1 and 2 and two phosphorothioate intemucleotide linkage modifications within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises two phosphorothioate intemucleotide linkage modifications within position 1-5 and two phosphorothioate intemucleotide linkage modifications within position 18-23 of the sense strand (counting from the 5’-end), and one phosphorothioate intemucleotide linkage modification at positions 1 and 2 and two phosphorothioate intemucleotide linkage modifications within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises two phosphorothioate intemucleotide linkage modifications within position 1-5 and two phosphorothioate intemucleotide linkage modifications within position 18-23 of the sense strand (counting from the 5’-end), and one phosphorothioate intemucleotide linkage modification at positions 1 and 2 and one phosphorothioate intemucleotide linkage modification within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises one phosphorothioate intemucleotide linkage modification within position 1-5 and one phosphorothioate intemucleotide linkage modification within position 18-23 of the sense strand (counting from the 5’-end), and two phosphorothioate intemucleotide linkage modifications at positions 1 and 2 and two phosphorothioate intemucleotide linkage modifications within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises one phosphorothioate intemucleotide linkage modification within position 1-5 and one within position 18-23 of the sense strand (counting from the 5’-end), and two phosphorothioate intemucleotide linkage modification at positions 1 and 2 and one phosphorothioate intemucleotide linkage modification within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises one phosphorothioate intemucleotide linkage modification within position 1-5 (counting from the 5’-end) of the sense strand, and two phosphorothioate intemucleotide linkage modifications at positions 1 and 2 and one phosphorothioate intemucleotide linkage modification within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises two phosphorothioate intemucleotide linkage modifications within position 1-5 (counting from the 5’-end) of the sense strand, and one phosphorothioate intemucleotide linkage modification at positions 1 and 2 and two phosphorothioate intemucleotide linkage modifications within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises two phosphorothioate intemucleotide linkage modifications within position 1-5 and one within position 18-23 of the sense strand (counting from the 5’-end), and two phosphorothioate intemucleotide linkage modifications at positions 1 and 2 and one phosphorothioate intemucleotide linkage modification within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises two phosphorothioate intemucleotide linkage modifications within position 1-5 and one phosphorothioate intemucleotide linkage modification within position 18-23 of the sense strand (counting from the 5’-end), and two phosphorothioate intemucleotide linkage modifications at positions 1 and 2 and two phosphorothioate intemucleotide linkage modifications within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises two phosphorothioate intemucleotide linkage modifications within position 1-5 and one phosphorothioate intemucleotide linkage modification within position 18-23 of the sense strand (counting from the 5’-end), and one phosphorothioate intemucleotide linkage modification at positions 1 and 2 and two phosphorothioate intemucleotide linkage modifications within positions 18-23 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises two phosphorothioate intemucleotide linkage modifications at position 1 and 2, and two phosphorothioate intemucleotide linkage modifications at position 20 and 21 of the sense strand (counting from the 5’-end), and one phosphorothioate intemucleotide linkage modification at positions 1 and one at position 21 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises one phosphorothioate intemucleotide linkage modification at position 1, and one phosphorothioate intemucleotide linkage modification at position 21 of the sense strand (counting from the 5’-end), and two phosphorothioate intemucleotide linkage modifications at positions 1 and 2 and two phosphorothioate intemucleotide linkage modifications at positions 20 and 21 the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises two phosphorothioate intemucleotide linkage modifications at position 1 and 2, and two phosphorothioate intemucleotide linkage modifications at position 21 and 22 of the sense strand (counting from the 5’-end), and one phosphorothioate intemucleotide linkage modification at positions 1 and one phosphorothioate intemucleotide linkage modification at position 21 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises one phosphorothioate intemucleotide linkage modification at position 1, and one phosphorothioate intemucleotide linkage modification at position 21 of the sense strand (counting from the 5’-end), and two phosphorothioate intemucleotide linkage modifications at positions 1 and 2 and two phosphorothioate intemucleotide linkage modifications at positions 21 and 22 the antisense strand (counting from the 5’-end).
- the dsRNA molecule comprises two phosphorothioate intemucleotide linkage modifications at position 1 and 2, and two phosphorothioate intemucleotide linkage modifications at position 22 and 23 of the sense strand (counting from the 5’-end), and one phosphorothioate intemucleotide linkage modification at positions 1 and one phosphorothioate intemucleotide linkage modification at position 21 of the antisense strand (counting from the 5’-end).
- the dsRNA molecule one phosphorothioate intemucleotide linkage modification at position 1, and one phosphorothioate intemucleotide linkage modification at position 21 of the sense strand (counting from the 5’-end), and two phosphorothioate intemucleotide linkage modifications at positions 1 and 2 and two phosphorothioate intemucleotide linkage modifications at positions 23 and 23 the antisense strand (counting from the 5’-end).
- the sense strand can comprise 0, 1, 2, 3 or 4 phsophorothioate intemucleotide linkages.
- the sense strand comprises phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3.
- the antisense strand can comprise 1, 2, 3 or 4 phsophorothioate intemucleotide linkages.
- the sense strand comprises phosphorothioate intemucleotide linkages between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23.
- the antisense strand comprises phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23.
- the sense strand comprises phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3, and the antisense strand comprises phosphorothioate intemucleotide linkages between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23.
- the sense strand comprises phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3
- the antisense strand comprises phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23.
- the dsRNA molecule can be 5’ phosphorylated or include a phosphoryl analog at the 5’ terminus.
- Exemplary 5’-phosphate modifications include those which are compatible with RISC mediated gene silencing. Suitable modifications include: 5’- monophosphate ((H0)2(0)P-0-5’); 5’-diphosphate ((H0)2(0)P-0-P(H0)(0)-0-5’); 5’- triphosphate ((H0)2(0)P-0-(H0)(0)P-0-P(H0)(0)-0-5’); 5’-guanosine cap (7-methylated or non-methylated) (7m-G-0-5’-(H0)(0)P-0-(H0)(0)P-0-P(H0)(0)-0-5’); 5’-adenosine cap (Appp), and any modified or unmodified nucleotide cap structure (N-0-5’-(H0)(0)P-0- (H0)(0)P-0-P
- the modification can in placed in the antisense strand of a dsRNA molecule.
- the antisense strand can comprise a 5’-vinylphosphonate nucleotide at 5’-end.
- the antisense comprises 5’-/'-vinylphosphanate.
- the antisense strand comprises 5’-/'-vinylphosphanate and a nucleoside at position N-l that reduces or inhibits activity of siRNA relative to a siRNA having the same antisense strand sequence but unmodified N-l position and a nucleoside at position N-l that reduces or inhibits activity of siRNA relative to a siRNA having the same antisense strand sequence but unmodified N-l position
- the sense strand comprises a 5’-morpholino, a 5’- dimethylamino, a 5’-deoxy, an inverted abasic, or an inverted abasic locked nucleic acid modification at the 5’-end.
- the linker between the Ig and the dsRNA molecule can be attached to the sense strand, antisense strand or both strands. Further, the linker can be conjugated at the 3’-end, 5’- end or both ends of a strand. For instance, the linker can be conjugated to the sense strand. In some embodiments, the linker is conjugated to the 3’-end of the sense strand. In some other embodiments, the linker is conjugated to the 3’-end of the sense strand.
- the dsRNA has a melting temperature in the range from about 40°C to about 80°C.
- the dsRNA has a melting temperature with a lower end of the range from about 40°C, 45°C, 50°C, 55°C, 60°C or 65°C, and upper end of the range from about 70°C, 75°C or 80°C.
- the dsRNA has a melting temperature in the range from about 55°C to about 70°C or in the range from about 60°C to about 75°C.
- the dsRNA has a melting temperature in the range from about 57°C to about 67°C.
- the dsRNA has a melting temperature in the range from about 60°C to about 67°C.
- the dsRNA has a melting temperature in the range from about 62°C to about 66°C.
- dsRNA molecules having a melting temperature of at least 60°C are more effective in vivo and in vitro. Accordingly, in some embodiments, the dsRNA has a melting temperature of at least 60°C.
- the antisense strand must have some metabolic stability.
- some amount of the antisense stand may need to be present in vivo after a period time after administration. Accordingly, in some embodiments, at least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 5 after in vivo administration.
- At least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 6 after in vivo administration.
- at least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 7 after in vivo administration.
- At least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 8 after in vivo administration.
- at least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 9 after in vivo administration.
- At least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 10 after in vivo administration. In some embodiments, at least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 11 after in vivo administration.
- At least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 12 after in vivo administration. In some embodiments, at least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 13 after in vivo administration.
- At least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 14 after in vivo administration. In some embodiments, at least 40%, for example at least 45%, at least 50%, at least 55%, at least 60%., at least 65%, at least 70%, at least 75%, or at least 80% of the antisense strand of the dsRNA is present in vivo, for example in mouse liver, at day 15 after in vivo administration.
- thermally destabilizing modifications in the seed region of the antisense strand can reduce or inhibit off-target gene silencing.
- the antisense strand comprises at least one (e.g., one, two, three, four, five or more) thermally destabilizing modification of the duplex within the first 9 nucleotide positions of the 5’ region of the antisense strand.
- thermally destabilizing modification(s) includes modification(s) that would result with a dsRNA with a lower overall melting temperature (Tm) (preferably a Tm with one, two, three or four degrees lower than the Tm of the dsRNA without having such modification(s).
- Tm overall melting temperature
- thermally destabilizing modification is located at position 2, 3, 4, 5, 6, 7, 8 or 9, or preferably at position 4, 5, 6, 7, or 8, from the 5’-end of the antisense strand. In some embodiments, the thermally destabilizing modification is located at position 2, 3, 4, 5 or 9 from the 5’-end of the antisense strand. In some other embodiments, the thermally destabilizing modification is located at position 6, 7 or 8 from the 5’-end of the antisense strand. In some particular embodiments, the thermally destabilizing modification is located at position 7 from the 5’-end of the antisense strand.
- the thermally destabilizing modifications can include, but are not limited to, abasic modifications; mismatch with the opposing nucleotide in the opposing strand; and sugar modification such as 2’-deoxy modification or acyclic nucleotide, e.g., unlocked nucleic acids (UNA) or glycol nucleic acid (GNA).
- UUA unlocked nucleic acids
- GAA glycol nucleic acid
- Exemplary abasic modifications include, but are not limited to, the following:
- R is H, Me, Et or OMe; R’ is H, Me, Et or OMe; R” is H, Me, Et or OMe; and * represents either R, S or racemic.
- Exemplary destabilizing sugar modifications include, but are not limited to the following:
- B is a modified or unmodified nucleobase.
- glycol nucleic acid H, OH, CH 3 , CH 2 CH 3 , O-alkyl, NH 2 , NHMe, NMe 2
- R H, methyl, ethyl
- R H, OH, O-alkyl
- R' H, OH, CH 3 , CH 2 CH 3 , O-alkyl, NH 2 , NHMe, NMe 2
- R" H, OH, CH 3 , CH 2 CH 3 , O-alkyl, NH 2 , NHMe, NMe 2
- B is a modified or unmodified nucleobase.
- the thermally destabilizing modification is selected from the group consisting of:
- B is a modified or unmodified nucleobase and the asterisk on each structure represents either R, S or racemic.
- acyclic nucleotide refers to any nucleotide having an acyclic ribose sugar, for example, where any of bonds between the ribose carbons (e.g., Cl’-C2’, C2’-C3’, C3’-C4’, C4’-04’, or Cl’-04’) is absent and/or at least one of ribose carbons or oxygen (e.g., Cl’, C2’, C3’, C4’ or 04’) are independently or in combination absent from the nucleotide.
- bonds between the ribose carbons e.g., Cl’-C2’, C2’-C3’, C3’-C4’, C4’-04’, or Cl’
- ribose carbons or oxygen e.g., Cl’, C2’, C3’, C4’ or 04’
- UNA refers to unlocked acyclic nucleic acid, wherein any of the bonds of the sugar has been removed, forming an unlocked“sugar” residue.
- UNA also encompasses monomers with bonds between CU-C4’ being removed (i.e. the covalent carbon-oxygen-carbon bond between the CU and C4’ carbons).
- bonds between CU-C4’ being removed (i.e. the covalent carbon-oxygen-carbon bond between the CU and C4’ carbons).
- the C2’-C3’ bond i.e.
- the acyclic derivative provides greater backbone flexibility without affecting the Watson-Crick pairings.
- the acyclic nucleotide can be linked via 2’-5’ or 3’-5’ linkage.
- glycol nucleic acid which is a polymer similar to DNA or RNA but differing in the composition of its“backbone” in that is composed of repeating glycerol units linked by phosphodiester bonds:
- the thermally destabilizing modification of the duplex can be mismatches (i.e., noncomplementary base pairs) between the thermally destabilizing nucleotide and the opposing nucleotide in the opposite strand within the dsRNA duplex.
- exemplary mismatch base pairs include G:G, G:A, G:U, G:T, A:A, A:C, C:C, C:U, C:T, U:U, T:T, U:T, or a combination thereof.
- Other mismatch base pairings known in the art are also amenable to the present invention.
- a mismatch can occur between nucleotides that are either naturally occurring nucleotides or modified nucleotides, i.e., the mismatch base pairing can occur between the nucleobases from respective nucleotides independent of the modifications on the ribose sugars of the nucleotides.
- the dsRNA molecule comprises at least one nucleobase in the mismatch pairing that is a 2’-deoxy nucleobase; e.g., the 2’-deoxy nucleobase is in the sense strand.
- the thermally destabilizing modification in the seed region of the antisense strand includes nucleotides with impaired W-C H-bonding to complementary base on the target mRNA.
- nucleotides with impaired W-C H-bonding to complementary base on the target mRNA include, but are not limited to, nucleotides comprising a nucleobase independently selected from the following:
- the thermally destabilizing modifications can also include a universal nucleobase with reduced or abolished capability to form hydrogen bonds with the opposing bases, and phosphate modifications.
- the thermally destabilizing modification includes nucleotides with non-canonical bases such as, but not limited to, nucleobase modifications with impaired or completely abolished capability to form hydrogen bonds with bases in the opposite strand.
- nucleobase modifications have been evaluated for destabilization of the central region of the dsRNA duplex as described in WO 2010/0011895, which is herein incorporated by reference in its entirety. Exemplary such nucleobase modifications are:
- the thermally destabilizing modification includes one or more ⁇ -nucleotide complementary to the base on the target mRNA, such as:
- R is H, OH, OCH3, F, NH2, NHMe, NMe2 or O-alkyl
- Exemplary phosphate modifications known to decrease the thermal stability of dsRNA duplexes compared to natural phosphodiester linkages include, but are not limited to, the following:
- the alkyl for the R group can be a Ci-C6alkyl.
- Specific alkyls for the R group include, but are not limited to methyl, ethyl, propyl, isopropyl, butyl, pentyl and hexyl.
- the destabilizing modification is selected from the following:
- the antisense strand comprises at least one stabilizing modification adjacent to the destabilizing modification.
- the stabilizing modification can be the nucleotide at the 5’-end or the 3’-end of the destabilizing modification, i.e., at position -1 or +1 from the position of the destabilizing modification.
- the antisense strand comprises a stabilizing modification at each of the 5’-end and the 3’-end of the destabilizing modification, i.e., positions -1 and +1 from the position of the destabilizing modification.
- the antisense strand comprises at least two stabilizing modifications at the 3’-end of the destabilizing modification, i.e., at positions +1 and +2 from the position of the destabilizing modification.
- the sense strand does not comprise a thermally stabilizing modification in position opposite or complimentary to the thermally destabilizing modification of the duplex in the antisense strand.
- the antisense strand comprises at least one 2’-fluoro nucleotide adjacent to the destabilizing modification.
- the 2’-fluoro nucleotide can be the nucleotide at the 5’-end or the 3’-end of the destabilizing modification, i.e., at position -1 or +1 from the position of the destabilizing modification.
- the antisense strand comprises a 2’-fluoro nucleotide at each of the 5’-end and the 3’-end of the destabilizing modification, i. e. , positions -1 and +1 from the position of the destabilizing modification.
- the antisense strand comprises at least two 2’-fluoro nucleotides at the 3’-end of the destabilizing modification, i.e., at positions +1 and +2 from the position of the destabilizing modification.
- the sense strand does not comprise a 2’-fluoro nucleotide in position opposite or complimentary to the thermally destabilizing modification of the duplex in the antisense strand.
- every nucleotide in the sense strand and/or the antisense strand of the dsRNA molecule can be modified.
- Each nucleotide can be modified with the same or different modification which can include one or more alteration of one or both of the non-linking phosphate oxygens and/or of one or more of the linking phosphate oxygens; alteration of a constituent of the ribose sugar, e.g., of the 2' hydroxyl on the ribose sugar; wholesale replacement of the phosphate moiety with“dephospho” linkers; modification or replacement of a naturally occurring base; and replacement or modification of the ribose-phosphate backbone.
- nucleic acids are polymers of monomers
- many of the modifications occur at a position which is repeated within a nucleic acid, e.g., a modification of a base, or a phosphate moiety, or a non-linking O of a phosphate moiety.
- the modification will occur at all of the subject positions in the nucleic acid but in many cases it will not.
- a modification may only occur at a 3’ or 5’ terminal position, may only occur in a terminal region, e.g., at a position on a terminal nucleotide or in the last 2, 3, 4, 5, or 10 nucleotides of a strand.
- a modification may occur in a double strand region, a single strand region, or in both.
- a modification may occur only in the double strand region of a RNA or may only occur in a single strand region of a RNA.
- a phosphorothioate modification at a non-linking O position may only occur at one or both termini, may only occur in a terminal region, e.g., at a position on a terminal nucleotide or in the last 2, 3, 4, 5, or 10 nucleotides of a strand, or may occur in double strand and single strand regions, particularly at termini.
- the 5’ end or ends can be phosphorylated.
- Modifications can include, e.g., the use of modifications at the 2’ position of the ribose sugar with modifications that are known in the art, e.g., the use of deoxyribonucleotides, 2’-deoxy-2’-fluoro (2’-F) or 2’-0-methyl modified instead of the ribosugar of the nucleobase, and modifications in the phosphate group, e.g., phosphorothioate modifications. Overhangs need not be homologous with the target sequence.
- each residue of the sense strand and antisense strand is independently modified with LNA, HNA, CeNA, 2’-methoxyethyl, 2’- O-methyl, 2’-0-allyl, 2’- C- allyl, 2’-deoxy, or 2’-fluoro.
- the strands can contain more than one modification.
- each residue of the sense strand and antisense strand is independently modified with 2’-0-methyl or 2’-fluoro. It is to be understood that these modifications are in addition to the at least one thermally destabilizing modification of the duplex present in the antisense strand.
- the sense strand and antisense strand each comprises two differently modified nucleotides selected from 2’ -O-methyl or 2’-deoxy.
- each residue of the sense strand and antisense strand is independently modified with 2’-0-methyl nucleotide, 2’-deoxy nucleotide, 2'-deoxy-2’-fluoro nucleotide, 2’-0-N-methylacetamido (2’-0-NMA) nucleotide, a 2’-0-dimethylaminoethoxyethyl (2’-0-DMAEOE) nucleotide, 2’-0-aminopropyl (2’-0-AP) nucleotide, or 2’-ara-F nucleotide.
- these modifications are in addition to the at least one thermally destabilizing modification of the duplex present in the antisense strand.
- the dsRNA molecule comprises modifications of an alternating pattern, particular in the Bl, B2, B3, BG, B2’, B3’, B4’ regions.
- the term“alternating motif’ or“alternative pattern” as used herein refers to a motif having one or more modifications, each modification occurring on alternating nucleotides of one strand.
- the alternating nucleotide may refer to one per every other nucleotide or one per every three nucleotides, or a similar pattern.
- the alternating motif can be “ABABABABABAB... ,” “AABBAABBAABB... ,” “AABAABAABAAB ... ,” “AAABAAABAAAB... ,” “AAABBB AAABBB ... ,” or
- the type of modifications contained in the alternating motif may be the same or different.
- the alternating pattern i.e., modifications on every other nucleotide
- each of the sense strand or antisense strand can be selected from several possibilities of modifications within the alternating motif such as “ABABAB...”, “AC AC AC...” “BDBDBD...” or “CDCDCD... ,” etc.
- the dsRNA molecule comprises the modification pattern for the alternating motif on the sense strand relative to the modification pattern for the alternating motif on the antisense strand is shifted.
- the shift may be such that the modified group of nucleotides of the sense strand corresponds to a differently modified group of nucleotides of the antisense strand and vice versa.
- the sense strand when paired with the antisense strand in the dsRNA duplex the alternating motif in the sense strand may start with“ABABAB” from 5’-3’ of the strand and the alternating motif in the antisense strand may start with “BABABA” from 3’-5’of the strand within the duplex region.
- the alternating motif in the sense strand may start with“AABBAABB” from 5’-3’ of the strand and the alternating motif in the antisense strand may start with“BBAABBAA” from 3’-5’of the strand within the duplex region, so that there is a complete or partial shift of the modification patterns between the sense strand and the antisense strand.
- the dsRNA molecule comprises mismatch(es) with the target, within the duplex, or combinations thereof.
- the mismatch can occur in the overhang region or the duplex region.
- the base pair can be ranked on the basis of their propensity to promote dissociation or melting (e.g., on the free energy of association or dissociation of a particular pairing, the simplest approach is to examine the pairs on an individual pair basis, though next neighbor or similar analysis can also be used).
- A:U is preferred over G:C
- G:U is preferred over G:C
- Mismatches e.g., non-canonical or other than canonical pairings (as described elsewhere herein) are preferred over canonical (A:T, A:U, G:C) pairings; and pairings which include a universal base are preferred over canonical pairings.
- the dsRNA molecule comprises at least one of the first 1, 2, 3, 4, or 5 base pairs within the duplex regions from the 5’- end of the antisense strand can be chosen independently from the group of: A:U, G:U, I:C, and mismatched pairs, e.g., non-canonical or other than canonical pairings or pairings which include a universal base, to promote the dissociation of the antisense strand at the 5’-end of the duplex.
- the nucleotide at the 1 position within the duplex region from the 5’-end in the antisense strand is selected from the group consisting of A, dA, dU, U, and dT.
- at least one of the first 1, 2 or 3 base pair within the duplex region from the 5’- end of the antisense strand is an AU base pair.
- the first base pair within the duplex region from the 5’- end of the antisense strand is an AU base pair.
- introducing 4’-modified and/or 5’-modified nucleotides to the 3’-end of a phosphodiester (PO), phosphorothioate (PS), and/or phosphorodithioate (PS2) linkage of a dinucleotide at any position of single stranded or double stranded oligonucleotide can exert steric effect to the intemucleotide linkage and, hence, protecting or stabilizing it against nucleases.
- PO phosphodiester
- PS phosphorothioate
- PS2 phosphorodithioate
- 5’-modified nucleoside is introduced at the 3’-end of a dinucleotide at any position of the dsRNA molecule.
- a 5’-alkylated nucleoside can be introduced at the 3’-end of a dinucleotide at any position of the dsRNA.
- the alkyl group at the 5’ position of the ribose sugar can be racemic or chirally pure R or S isomer.
- An exemplary 5’-alkylated nucleoside is 5’-methyl nucleoside. The 5’-methyl can be either racemic or chirally pure R or S isomer.
- a 4’-modified nucleoside is introduced at the 3’-end of a dinucleotide at any position of the dsRNA.
- a 4’-alkylated nucleoside may be introduced at the 3’-end of a dinucleotide at any position of dsRNA.
- the alkyl group at the 4’ position of the ribose sugar can be racemic or chirally pure R or S isomer.
- An exemplary 4’- alkylated nucleoside is 4’-methyl nucleoside. The 4’-methyl can be either racemic or chirally pure R or S isomer.
- a 4’-//-alkylated nucleoside may be introduced at the 3’-end of a dinucleotide at any position of single stranded or double stranded siRNA.
- the 4’ -//-alkyl of the ribose sugar can be racemic or chirally pure R or S isomer.
- An exemplary 4’ -//-alkylated nucleoside is 4’ -//-methyl nucleoside.
- the 4’ -//-methyl can be either racemic or chirally pure R or S isomer.
- a 5’-alkylated nucleoside is introduced at any position on the sense strand or antisense strand of the dsRNA, and such modification maintains or improves potency of the dsRNA.
- the 5’-alkyl can be either racemic or chirally pure R or S isomer.
- An exemplary 5’-alkylated nucleoside is 5’-methyl nucleoside.
- the 5’-methyl can be either racemic or chirally pure R or S isomer.
- a 4’-alkylated nucleoside is introduced at any position on the sense strand or antisense strand of the dsRNA, and such modification maintains or improves potency of the dsRNA.
- the 4’-alkyl can be either racemic or chirally pure R or S isomer.
- An exemplary 4’-alkylated nucleoside is 4’-methyl nucleoside.
- the 4’-methyl can be either racemic or chirally pure R or S isomer.
- a 4’-//-alkylated nucleoside is introduced at any position on the sense strand or antisense strand of the dsRNA, and such modification maintains or improves potency of the dsRNA.
- the 5’-alkyl can be either racemic or chirally pure R or S isomer.
- An exemplary 4’-//-alkylated nucleoside is 4’-ZZ-methyl nucleoside.
- the 4’-ZZ-methyl can be either racemic or chirally pure R or S isomer.
- the 2’-5’ linkages modifications can be used to promote nuclease resistance or to inhibit binding of the sense to the antisense strand, or can be used at the 5’ end of the sense strand to avoid sense strand activation by RISC.
- the sense strand comprises a 2’-5’-linkage between positions N-l and N-2, counting from 5’-end.
- the dsRNA molecule can comprise L sugars (e.g., L ribose, L- arabinose with 2’-H, 2’-OH and 2’-OMe).
- L sugars e.g., L ribose, L- arabinose with 2’-H, 2’-OH and 2’-OMe.
- these L sugars modifications can be used to promote nuclease resistance or to inhibit binding of the sense to the antisense strand, or can be used at the 5’ end of the sense strand to avoid sense strand activation by RISC.
- the sense strand comprises a L sugar nucleotide at the 5’-end.
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 6, 8, 9, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 7 (counting
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 6, 9, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 7 (counting
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; and 2’-fluoro modifications at positions 7, 10, and 11 (counting from the 5’ end); and; and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 6, 8, 9, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 7 (counting from the 5’ end); and wherein the dsRNA molecule has a two nucleotide overhang at the 3’-end of the antisense strand, and a blunt end at the 5’-end of the antisense strand.
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having: a length of 23 nucleotides; 2’- fluoro modifications at positions 2, 6, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 7 (counting
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally a thermally destabilizing modification of the duplex at position 6 or 7 (counting from
- the dsRNA molecule comprises: (i) a sense strand having the linker attached to the 3’-end; and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having: 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 6 or 7 (counting from the 5’ end).
- the dsRNA molecule comprises: (i) a sense strand having the linker attached to the 3’-end and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 6 or 7 (counting from the 5’ end); and wherein the dsRNA molecule has a two nucleotide overhang at the 3’-end of the antisense strand, and a blunt end at
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3-end; 2’-fluoro modifications at positions 7, 10, and 11 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 5, 6 or 7 (counting from the 5’ end); and wherein the dsRNA molecule has a two nucleotide overhang at the 3’-end of the antisense strand, and a blunt end at the 5’-end of the antisense strand.
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’- fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 5, 6 or 7 (count
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and at least one, e.g., one, two, three, four, five, six, seven, eight, nine, ten or more LNA modification; and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 5, 6 or 7 (counting from the 5’ end); and wherein
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and a LNA modification at least at one, e.g., one, two or three of positions 1, 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 5, 6 or 7 (counting from the 5’ end); and wherein the
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); at least one, e.g., one, two, three, four, five, six, seven, eight, nine, ten or more LNA modifications; and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and a LNA modification at least at one, e.g., one, two or three of positions 1, 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 5, 6 or 7 (counting from the 5’ end); and wherein
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 3’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); a LNA modification at least at one, e.g., one, two or three of positions 1, 2 and 3 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’- fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 6, 8, 9, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 7 (count
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 6, 9, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 7 (counting
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; and 2’-fluoro modifications at positions 7, 10, and 11 (counting from the 5’ end); and; and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 6, 8, 9, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 7 (counting from the 5’ end); and wherein the dsRNA molecule has a two nucleotide overhang at the 3’-end of the antisense strand, and a blunt end at the 5’-end of the antisense strand.
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having: a length of 23 nucleotides; 2’- fluoro modifications at positions 2, 6, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 7 (counting
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally a thermally destabilizing modification of the duplex at position 6 or 7 (counting from
- the dsRNA molecule comprises: (i) a sense strand having the linker attached to the 5’-end; and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having: 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 6 or 7 (counting from the 5’ end).
- the dsRNA molecule comprises: (i) a sense strand having the linker attached to the 5’-end and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 6 or 7 (counting from the 5’ end); and wherein the dsRNA molecule has a two nucleotide overhang at the 3’-end of the antisense strand, and a blunt end at
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 10, and 11 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 5, 6 or 7 (counting from the 5’ end); and wherein the dsRNA molecule has a two nucleotide overhang at the 3’-end of the antisense strand, and a blunt end at the 5’-end of the antisense strand.
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’- fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 5, 6 or 7 (count
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and at least one, e.g., one, two, three, four, five, six, seven, eight, nine, ten or more LNA modification; and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 5, 6 or 7 (counting from the 5’ end); and wherein
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and a LNA modification at least at one, e.g., one, two or three of positions 1, 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 5, 6 or 7 (counting from the 5’ end); and wherein the
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); at least one, e.g., one, two, three, four, five, six, seven, eight, nine, ten or more LNA modifications; and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); and a LNA modification at least at one, e.g., one, two or three of positions 1, 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’-fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23 (counting from the 5’ end); and optionally, a thermally destabilizing modification of the duplex at position 5, 6 or 7 (counting from the 5’ end); and wherein
- the dsRNA molecule comprises: (i) a sense strand having a length of 21 nucleotides; the linker attached to the 5’-end; 2’-fluoro modifications at positions 7, 9, 10, and 11 (counting from the 5’ end); a LNA modification at least at one, e.g., one, two or three of positions 1, 2 and 3 (counting from the 5’ end); and phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3 (counting from the 5’ end); and (ii) an antisense strand having a length of 23 nucleotides; 2’- fluoro modifications at positions 2, 14, and 16 (counting from the 5’ end); phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22
- the sense strand comprises at least one, e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen or seventeen 2’-OMe modifications.
- the antisense strand comprises at least one, e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen or twenty 2’-OMe modifications.
- the sense strand comprises at least one, e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen or seventeen 2’-OMe modifications
- the antisense strand comprises at least one, e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen or twenty 2’- OMe modifications.
- aspects of the invention include dual variable domain (DVD) immunoglobulin molecules (Ig).
- the dual variable domain immunoglobulin molecule comprises a first variable domain that binds to a target antigen, and a second variable domain that includes uniquely reactive residues that provide a site for covalent attachment of a linker molecule.
- the DVD immunoglobulin molecule includes two identical light chains, as well as two identical heavy chains. Each light chain and each heavy chain includes an N- terminus and a C- terminus. Assembly of two light chains and two heavy chains results in the formation of a DVD immunoglobulin molecule, with various inter-chain and intra-chain disulfide bonds stabilizing the interactions of the light and heavy chains.
- Each light chain includes a first and a second variable domain, designated as VLI and VL2, as well as a constant domain, designated as CL.
- a light chain comprises a kappa light chain. In some other embodiments, a light chain comprises a lambda light chain.
- the second variable domain comprises a single, uniquely reactive lysine residue that provides a site for covalent attachment of a linker molecule.
- the second variable domain comprises a single, uniquely reactive arginine residue that provides a site for covalent attachment of a linker molecule.
- each heavy chain independently includes a first and a second variable domain, designated as VHI and VH2, as well as a constant domain designated as Cnl, followed by heavy chain Fc region domains.
- Fc region domains on a heavy chain can include Fc region domains that are specific to a particular immunoglobulin type or subtype, including but not limited to Fc regions from an IgG (such as an IgGl, IgG2, IgG3 or IgG4), IgA (such as an IgA! or IgA2), IgM, IgE or IgD antibody.
- an immunoglobulin belongs to the IgG class, and the heavy chain comprises a g heavy chain.
- an immunoglobulin belongs to the IgGl class, and the heavy chain comprises a yl heavy chain. In some other embodiments, an immunoglobulin belongs to the IgG2 class, and the heavy chain comprises a y2 heavy chain. In still some embodiments, an immunoglobulin belongs to the IgG3 class, and the heavy chain comprises a g3 heavy chain. In some embodiments, an immunoglobulin belongs to the IgG4 class, and the heavy chain comprises y4 heavy chain.
- an immunoglobulin belongs to the IgA class.
- an immunoglobulin belongs to the IgA class and a heavy chain comprises an a heavy chain.
- an immunoglobulin belongs to the IgAl class, and a heavy chain comprises an al heavy chain in some embodiments, an immunoglobulin belongs to the IgA2 class, and a heavy chain comprises an a2 heavy chain.
- an immunoglobulin belongs to the IgD class and a heavy chain comprises a d heavy chain. In some embodiments, an immunoglobulin belongs to the IgE class, and a heavy chain comprises an e heavy chain. In some embodiments, an immunoglobulin belongs to the IgM class, and a heavy chain comprises a m heavy chain.
- an immunoglobulin molecule can comprise a native polypeptide sequence that occurs in nature.
- the organization of the variable and constant domains along the light chain generally proceeds from the N-termmus to the C-termmus as VLI -VL2-CL.
- the organization of the variable domains on the light chain can be reversed, such that the organization from N- to C -terminus is VL2-VL1 -CL.
- This same organization applies to binding fragments of the subject DVD immunoglobulins, wherein the organization from N- to C- iermmus can be VL1 -VL2 or Vi.2-Vi.l.
- the light chain does not comprise a second variable domain.
- the organization of the variable and constant domains along a light chain can be organized such that the sequence of the domains along the light chain proceeds from N- to C-termmus as VLI -CLI or VL-CL.
- variable and constant domains along the heavy- chain generally proceeds from the N-terminus to the C-terminus, such as VH1 -VH2-CH1 , VHI - CH1 ⁇ VH2-CH1 , VH1 ⁇ VH2 ⁇ CH! -FC or VHI -CH1 ⁇ VH2-CH1 -FC, but can be modified to mirror the organization of the domains on a light chain so that the appropriate domains on a light chain are paired with the appropriate domains on a heavy chain when the immunoglobulin molecule, or binding fragment thereof, is assembled
- the organization of the variable and constant domains along a light and heavy chain can be organized such that the sequence of the domains along a light chain proceeds from N- to C-termmus as VL1 -VL2-CH1, and the organization of domains along a heavy chain proceeds from N- to C- terminus as VHI -VH2-CL-FC.
- This particular organization is referred to as a CrossMAb organization, and is described in detail m Klein et al., mAbs 4, 653- 663 (2012), the disclosure of which is incorporated by reference herein m its entirety.
- a CrossMAb organization can be used to generate bi specific DVD immunoglobulins, which are described further below.
- the organization of the variable and constant domains along a light chain can be organized such that the sequence of the domains along the light chain proceeds from N- to C -terminus as VLI -CHI and the organization of the variable and constant domains along a heavy chain can be organized such that the sequence of the domains along a heavy chain proceeds from N- to C- terminus as VH1-VH2-CH1, VHI -CHI -VH2-CH1 , VH1-VH2-CH1-FC or VH1 -CH1 -VH2-CH1 -FC.
- the organization of the variable and constant domains along a light chain can be organized such that the sequence of the domains along the light chain proceeds from N- to C-terminus as VLI-CHI and the organization of the variable and constant domains along a heavy chain can be organized such that the sequence of the domains along a heavy chain proceeds from N- to C- terminus as VH1-CH1-VH2-CH1 or VH1 - €H1 -VH2-CH1 -F €
- different domains e.g., two variable domains, a variable domain and a constant domain, a variable domain and an Fc domain, and/or a constant domain and an Fc domain can be linked together via a linker.
- the linker can be a chemical linker, a single peptide bond (e.g., linked directly to each other) or a peptide linker containing one or more amino acid residues (e.g. with an intervening amino acid or amino acid sequence between the domain.
- the term“peptide linker” as used herein denotes a peptide with amino acid sequences, which is in some embodiments of synthetic origin.
- peptide linkers may affect folding of a given fusion protein, and may also react/bind with other proteins, and these properties can be screened for by known techniques.
- a peptide linker can comprise 1 amino acid or more, 5 amino acids or more, 10 amino acids or more, 15 amino acids or more, 20 amino acids or more, 25 amino acids or more, 30 amino acids or more, 35 amino acids or more, 40 amino acids or more, 45 amino acids or more, 50 amino acids or more and beyond.
- a peptide linker can comprise less than 50 amino acids, less than 45 amino acids, less than 40 amino acids, less than 35 amino acids, less than 30 amino acids, less than 30 amino acids, less than 25 amino acids, less than 20 amino acids, less than 15 amino acids or less than 10 amino acids.
- the peptide linker comprises from about 5 amino acids to about 40 amino acids.
- the peptide linker can comprise from about 5 amino acids to about 35 amino acids, from about 5 amino acids to 30 amino acids, or from about 5 amino acids to about 25 amino acids.
- the peptide linker comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 amino acids.
- Exemplary peptide linkers include those that consist of glycine and serine residues, the so-called Gly-Ser polypeptide linkers.
- the term“Gly-Ser polypeptide linker” refers to a peptide that consists of glycine and serine residues.
- the peptide linker comprises the amino acid sequence (Gly x Ser)n, where x is 2, 3, 4 or 5, and n is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- x is 3 and n is 1, 2, 3 or 4.
- x is 3 and n is 3 or 4.
- x is 4 and n is 1, 2, 3 or 4.
- x is 4 and n is 1, 2 or 3.
- the linker comprises an amino acid sequence selected from the group consisting of ASTKGP (SEQ ID NO: 1), TVAAPSVFIFPP (SEQ ID NO: 2), GS (SEQ ID NO: 3), (648)2 (SEQ ID NO: 4), (648)3 (SEQ ID NO: 5), EPKSCDGiS (SEQ ID NO: 6), HPKSCDCGiS ⁇ ' (SEQ ID NO: 7), EPKSCDiGiS ⁇ (SEQ ID NO: 8), and any combinations thereof.
- ASTKGP SEQ ID NO: 1
- TVAAPSVFIFPP SEQ ID NO: 2
- GS SEQ ID NO: 3
- 648)2 SEQ ID NO: 4
- 648)3 SEQ ID NO: 5
- EPKSCDGiS SEQ ID NO: 6
- HPKSCDCGiS ⁇ ' SEQ ID NO: 7
- EPKSCDiGiS ⁇ SEQ ID NO: 8
- the first and second variable domains are linked along their light chain or heavy chain by a peptide linker sequence.
- a peptide linker sequence can be a single amino acid or a polypeptide sequence.
- the first and second variable domain are linked by a peptide linker, where the peptide linker sequence is ASTKGP (SEQ ID NO: 1), TVAAPSVFIFPP (SEQ ID NO: 2), GS (SEQ ID NO: 3), (G 4 S) 2 (SEQ ID NO: 4), (6 1 8) .
- SEQ ID NO: 5 EPKSCDGiS
- the DVD immunoglobulin molecules comprise a first variable domain with antigen binding functionality.
- VLI and Vnl sequences of the subject DVD immunoglobulin molecules are selected to specifically bind to a target, such as, a cell-surface marker or antigen.
- a target such as, a cell-surface marker or antigen.
- antigens are known for virtually any type of cell.
- Vi l and Vnl sequences of the subject DVD immunoglobulin molecules are selected to specifically bind to virtually any known antigen on virtually any type of cell.
- the VLI and VHI sequences of the subject DVD immunoglobulin molecules are selected to specifically bind to an antigen on a tumor cell.
- Immunoglobulins can exert antitumor effects by inducing apoptosis, redirected cytotoxicity, interfering with ligand-receptor interactions, or preventing the expression of proteins that are critical to a neoplastic phenotype.
- immunoglobulins can target components of the tumor microenvironment, perturbing vital structures such as the formation of tumor-associated vasculature immunoglobulins can also target receptors whose ligands are growth factors, such as the epidermal growth factor receptor, thus inhibiting binding of natural ligands that stimulate cell to targeted tumor cells.
- immunoglobulins can induce ADCC ADCP or CDC,
- tumor-associated binding targets that can be targeted by the first variable domain of the DVD immunoglobulin molecule include, but are not limited to, CD! 38, BCMA, 8LAMF7, HER2 (ERBB2), FOLR1, FOLR2, CD19, CD79A, CD79B, RORi, ROR2, FCRM, CSl, GPA33, PSMA, Siglec-i , Siglec-4, Siglec-5, Siglec-6, Siglec-7, Siglec-8, Siglec-9.
- EDG1 FI N A L EFNA3, EFNB2, EGF, EPHB4, FGFR3, HGF, IGF1, ITGB3, PDGFA, TEK, TGFA, TGFB1 , TGFB2, TGFBR1 , CCL2, CDH5, C0L18A1 , EDG1 , ENG, ITGAV, ITGB3, THBS1, TBBS2, BAD, BAG1 , BCL2, CCNA1, CCNA2, CCND1 , CCNE1 , CCNE2, CDH1 (E-cadherin), CDKN1B (p27Kipl), CDKN2.A (pl61NK4a), C0L6A1, CTNNB1 (b-catenin), CTSB (cathepsm B), ESR1, ESR2, F3 (TF), F0SL1 (FRA-1), GAT A3, GSN (Gelsolin), IGFBP2, IL2RA, IL6, IL6R, IL
- ammo acid sequences of a first variable domain region which provides antigen binding functionality, can include chimeric, humanized, or human ammo acid sequences. Any suitable combination of such sequences can be incorporated into a first variable domain of the DVD immunoglobulin molecule.
- Antigen-binding variable region sequences can be selected from various monoclonal antibodies capable of binding specific targets and well known m the art. These include, but are not limited to anti-TNF antibody (U.8. Pat. No. 6,258,562), anti-IL-12 and or anti-IL-12p40 antibody (U.S. Pat.
- anti-IL-18 antibody US 2005/0147610 Al
- anti-C5 anti-CBL
- anti-CD147 anti-gpl20
- anii-VLA4 anti-CDl la
- anti-CD18 anti-VEGF
- anti-CD40L anti- id
- anti-ICAM-1 anti-CXCL13
- anti-CD2, anti-EGFR anti-TGF-beta 2
- anti-E-selectin anti-Fact VII
- anti-Her2/neu anti-F gp
- anti-CDl 1/18 anti-CDl 4
- anti-IC AM-3 anti-CD80
- anti-CD4 anti- CD3, anti-CD23, anti-beta2-integnn, anti-alpha4beta7, anti-CD52, anti-HLA DR, anti-CD22, anti-CD2G, anti-MIF, anti-CD64 (FcR), anti -TCR alpha beta, anti-CD2, anti-Hep B, anti -C A 125
- Antigen-bin ding variable region sequences can also be selected from various therapeutic antibodies approved for use, in clinical trials, or in development for clinical use.
- therapeutic antibodies include, but are not limited to, RITUXAN®, IDEC/Genentech/Roche) (see for example U.S. Pat. No. 5,736, 137), a chimeric anti-CD20 antibody approved to treat Non- Hodgkin’s lymphoma; HUMAX-CD20®, an anti-CD20 currently being developed by Genmab, an an ⁇ i ⁇ CD20 antibody described in U.S. Pat. No.
- trastuzumab HERCEPTF ®, Genentecb
- trastuzumab HERCEPTF ®, Genentecb
- pertuzumab rhuMab-2C4, OMN1TARG®
- pertuzumab rhuMab-2C4, OMN1TARG®
- cetuxxmab (ERBITUX®, Imcione) (U.S. Pat. No. 4,943,533; PCX WO 96/40210), a chimeric anti-EGFR antibody in clinical trials for a variety of cancers; ABX-EGF (U.S. Pat. No. 6,235,883), currently being developed by Abgenix-Immunex- Amgen; HUMAX-EGFRTM (U.S. Ser. No. 10/172,317), currently being developed by Genmab; 425, EMD55900, EMD62000, and EMD72000 (Merck KGaA) (U.S. Pat. No. 5,558,864; Murthy et al.
- KSB-102 KS Biomedix
- MRl-1 WAX, National Cancer Institute
- SCIOO Scancell
- PCX WO 01/88138 alemtuzumab (CAMPATH®, Millennium), a humanized monoclonal antibody currently approved for treatment of B-cell chronic lymphocytic leukemia; muromonab-CD3 (Orthoclone OKT3®), an anti-CD3 antibody developed by Ortho Biotech/Johnson & Johnson, ibritumomab tiuxetan (ZEVALIN®), an anti-CD20 antibody developed by IDEC/Schering AG, gemtuzumab ozogamicin (MYLOT ARG®), an anti-CD33 (p67 protein) antibody developed by Celltech/Wyeth, alefacept (AMEVIVE®), an anti-LFA-3 Fc fusion developed by Biogen), abciximab (REOPRO®
- the DVD immunoglobulin molecule comprises a second variable domain from a 38C2 antibody, which includes a reactive lysine residue.
- a 38C2 antibody is described, for example, in IJ.S. Patent No. 8,252,902, the disclosure of which is herein incorporated by reference in its entirety.
- a heavy chain variable region of the 38C2 antibody includes a single, uniquely reactive lysine residue that can react with a linker, thereby providing an attachment point for conjugation with a drug moiety.
- immunoglobulin molecules that include a variable domain of the 38C2 antibody contain two such attachment points (one on each heavy chain) that can be used for conjugation with a drug moiety.
- variable domain of 38C2 antibody that is used in the subject DAT immunoglobulin molecules provides an attachment point for conjugation, but does not provide antigen binding functionality.
- the DVD immunoglobulin molecule comprises a second variable domain from a 38C2 antibody as described in WO20I7/049139, content of which is incorporated herein by reference in its entirety
- VL light chain variable
- VH heavy chain variable
- VL light chain variable domain of an anti- BCMA Fab
- VH heavy chain variable domain
- VL light chain variable domain
- VH heavy chain variable domain of humanized VOOI Fab
- SEQ ID NO: 14 An exemplary amino acid sequence of heavy chain variable (VH) domain of humanized VOOI Fab is as follows: EVQLVESGGGLVQPGGSLRLSCAASGFTLSNYHMSWVRQAPGKGLEWVSFITSG GSTYY AS WAKGRFTISRDN SKNTLYLQMN SLRAEDTAVYY C ARWNGY GGNMW GQGTLVTVS (SEQ ID NO: 14)
- VL light chain variable
- CL constant
- VH heavy chain variable
- CHI constant domains of a humanized 38C2 antibody
- the DVD immunoglobulin molecule includes a light chain variable domain sequence of a humanized 38C2 antibody (SEQ ID NO: 9 and SEQ ID NO: 15) as a VL2 domain sequence.
- the DVD immunoglobulin molecule includes a VL2 domain sequence that is substantially similar to SEQ ID NO: 9 or SEQ ID NO: 15, for example, has at least about 80% ammo acid sequence identity , alternatively has at least about 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity to SEQ ID NO: 9 or SEQ ID NO: 15.
- the DVD immunoglobulin molecule includes a heavy chain variable domain sequence of a humanized 38C2 antibody (SEQ ID NO: 10 and SEQ ID NO: 16) as a VH2 domain sequence.
- the DVD immunoglobulin molecule includes a VH2 domain sequence that is substantially similar to SEQ ID NO: 10 or SEQ ID NO: 16, for example, has at least about 80%) amino acid sequence identity, alternatively has at least about 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity to SEQ ID NO: 10 or SEQ ID NO: 16, and includes a reactive lysine residue.
- the DVD immunoglobulin molecule can encompass chimeric, humanized and human immunoglobulin sequences, and in some embodiments, can contain any mixture thereof.
- a DVD immunoglobulin molecule can include a chimeric first variable domain, and can include a human second variable domain.
- a DVD immunoglobulin molecule can include a humanized first variable domain, and can contain a human second variable domain. Any suitable combination of chimeric, humanized and human immunoglobulin sequences can be utilized m the subject DVD immunoglobulin molecules.
- a DVD immunoglobulin described herein can be modified with respect to effector function of the immunoglobulin. This can be achieved by introducing one or more amino acid substitutions in an Fc region of an immunoglobulin. Alternatively, or additionally, cysteine residue(s) can be introduced in the Fc region, thereby allowing inter-chain disulfide bond formation in this region.
- An immunoglobulin thus generated can have improved internalization capability and/or increased effector function. See Caron et al, J. Exp Med. 176: 1191-1195 (1992) and Shopes, B. F Immunol. 148:2918-2922 (1992).
- a salvage receptor binding epitope can be incorporated into an immunoglobulin (especially an immunoglobulin fragment) as described in U.S. Patent 5,739,277, for example.
- the term“salvage receptor binding epitope” refers to an epitope of the Fc region of an IgG molecule (e.g., IgGl, IgG2, IgG3, or IgG4) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
- a DVD immunoglobulin molecule in accordance with aspects of the invention includes a first variable domain that provides antigen binding functionality, and a second variable domain from a 38C2 antibody, which includes a single, uniquely reactive lysine residue that can be conj ugated to a linker.
- the DVD immunoglobulin molecule is bispecific, in that one arm of the immunoglobulin includes a first variable domain with binding specificity for a first binding target, and the second arm includes a first variable domain with binding specificity for a second binding target.
- one arm of the immunoglobulin includes a first variable domain with binding specificity for a first binding target
- the second arm includes a first variable domain with binding specificity for a second binding target.
- the DVD immunoglobulin molecule is bi-paratopic, in that one arm of the immunoglobulin includes a first variable domain with binding specificity' for a first binding target, and the second arm includes a first variable domain with binding specificity for the same binding target, but a different binding epitope.
- Such aspects provide the ability ' to bind to the same target covering two different, but potentially somewhat overlapping binding epitopes, thereby providing target crosslinking functionality, triggering lysosomal trafficking after internalization.
- the immunoglobulin molecule comprises an additional chain.
- the immunoglobulin molecule comprises a first heavy chain, a second heavy chain and a light chain.
- the first heavy chain comprises a first variable domain and a second variable domain.
- the second heavy chain comprises a first variable domain and a second variable domain, and the light chain comprises a variable domain and a constant domain.
- the first heav chain and the second heavy chain are capable of forming a heterodimer.
- the organization of the variable and constant domains along a light chain can he organized such that the sequence of the domains along the light chain proceeds from N ⁇ to C-terminus as VL1 -CII1
- the organization of the variable and constant domains along a first heavy chain can be organized such that the sequence of the domains along a first heavy chain proceeds from N ⁇ to C- terminus as VH1-VH2-CH1 , VHI -CH!
- variable and constant domains along a second heavy chain can be organized such that the sequence of the domains along a second heavy chain proceeds from N- to C- terminus as VH1’-VH2 ⁇ VH1’-VH2’-CH1 ⁇ VH1’-CH1’-VH2’-CH1 ⁇ VH - VH2’ -FC” , VHI’ -VH2’ -CHI ’ -FC’ or VHI’ -CHI’ -VH2’ -CH2’ -FC’ .
- variable domains of the first and second heavy chain can bind to the same epitope or different epitopes on the same antigen.
- DVD-Ig described herein is a multispecific, e.g., bispecific DVD-Ig, where the variable domains of the first and second heavy chain can bind to different epitopes, where the different epitopes can be on the same antigen or on different antigens.
- Techniques for making multispecific Ig molecules include, but are not limited to, recombinant co-expression of two i munoglobulin heavy chain-light chain pairs having different specificities (see Mi (stein, C.
- Multi- specific antibodies can also be made by- engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004); cross-linking two or more antibodies or fragments (see e.g., ITS Patent No. 4,676,980, and Brennan, M.
- the first or the second heavy chain comprises a modification in the CH3 domain to reduce the ability of the domain to interact with itself, i.e., form homodimers.
- one or more residues that make up the CH3-CH3 interface are replaced with a charged ammo acid such that the interaction becomes electrostatically unfavorable.
- a positive-charged ammo acid in the interface such as a lysine, arginine, or histidine, is replaced with a negative charged a ino acid, such as aspartic acid or glutamic acid.
- a negative-charged amino acid in the interface is replaced with a positive-charged amino acid
- the amino acid is replaced with an unnatural amino acid having the desired charge characteristic.
- the first and the second heavy- chain comprise a modification in the €113 domains to reduce the ability of each CH3 domain to interact with itself but to increase the ability of the domains to interact with each other, i.e., form heterodimers. This can be achieved by replacing one or more residues that make up the CH3- 013 interface in both CH3 domains with a charged amino acid such that homodimer formation is electrostatically unfavorable but heterodimerization is electrostat cally favorable.
- a charged amino acid in each CH3 domain is replaced with an amino acid with an opposite charge.
- a positive-charged amino acid may be replaced with a negative charged amino acid in the first CH3 domain and a negative charged amino acid may be replaced with a positive-charged a ino acid in the second CH3 domain.
- the reversed charges are electrostatically favorable, i.e., opposing charges in the interface, for heterodimerization formation.
- Table 1 List of some possible pair-wise charge residue mutations to enhance heterodimer formation 3
- Lys409 - Asp399’ interaction pair mutations could be combined with Lys439 - Asp356’ pair mutations.
- b Histidine (His) could also be added to this list of positively charged residues, however, increase in side chain volume and pH dependency should be taken into account in the design.
- These single residue mutations could be combined with other pair-wise mutations listed in the table to enhance the heterodimer formation.
- the first CH3 domain comprises the amino acid modifications I.351 Y, F405A, and Y407V
- the second CH3 domain comprises the ammo acid modifications T366L, K392M, and T394W.
- the first CH3 domain comprises the amino acid modifications L351Y, F405A, and Y407V
- the second CH3 domain comprises the ammo acid modifications T366L, K392L, and T394W.
- the first CH3 domain comprises the amino acid modifications T350V, L35IY, F405A, and Y407V
- the second CH3 domain comprises the amino acid modifications T350V, T366L.
- the first CH3 domain comprises the amino acid modifications T350V, L351Y, F405A, and Y407V
- the second CH3 domain comprises the amino acid modifications T350V. T366L, K392L, and T394W.
- the first CH3 domain comprises the amino acid modifications T366L, N390R, K392R, and T 94W
- the second CH3 domain comprises the ammo acid modifications L351Y, S400E, F405A, and Y407V.
- the first CH3 domain comprises the amino acid modifications T350V, T366L, N390R, K392R, and T394W and the second CHS domain comprises the ammo acid modifications T350V, L351Y, S400E, F405A, and Y407V.
- one of the CH3 domains comprises one or more, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more of the following modifications K392D, K392E, N392D, N392E, R409D, R409E, K409D, K409E, D399K, D399R, E356R, E356K, D356R, D356K, Y349T, L351T, L368T, L398T, F405T, Y407T, Y407R, L234A and L235A.
- the first CEB domain comprises the ammo acid modifications S345C and T366W
- the second CHS domain comprises the ammo acid modifications Y349C, T3665, 1,368 A and Y407V.
- an immunoglobulin molecule is an intact immunoglobulin molecule that includes a first and second variable region, as described above, and also includes a CL domain on the light chain, as well as heavy chain constant domains CHI, CH2, and CH3.
- a constant domain can comprise a native or non-native sequence, or an amino acid sequence variant thereof.
- an immunoglobulin molecule can be an immunoglobulin fragment. Examples of immunoglobulin fragments include, but are not limited to, (Fab’)?., Fab’, Fab, and Fv fragments.
- a wide variety of entities can be coupled to the DVD immunoglobulin described herein.
- Preferred moieties are ligands, which are coupled, preferably covalently, either directly or indirectly via a linker to the DVD immunoglobulin described herein.
- Ligands can include a naturally occurring substance, such as peptides, polypeptides, a carbohydrate (e.g., a dextran, pullulan, chitin, chitosan, inulin, cyclodextrin or hyaluronic acid), a vitamin, or a lipid.
- the ligand can also be a recombinant or synthetic molecule, such as a synthetic polymer.
- a ligand alters the distribution, targeting or lifetime of the DVD immunoglobulin into which it is incorporated.
- Some ligands can have endosomolytic properties. Such ligands are also referred to as endosomolytic ligands herein.
- the endosomolytic ligands promote the lysis of the endosome and/or transport of the composition of the invention, or its components, from the endosome to the cytoplasm of the cell.
- Endosomolytic ligands include, but are not limited to, imidazoles, poly or oligoimidazoles, PEIs, peptides, fusogenic peptides, polycarboxylates, polycations, masked oligo or poly cations or anions, acetals, polyacetals, ketals/polyketals, orthoesters, polymers with masked or unmasked cationic or anionic charges, dendrimers with masked or unmasked cationic or anionic charges.
- the endosomolytic ligand can be a polyanionic peptide or peptidomimetic which shows pH-dependent membrane activity and fusogenicity. In some embodiments, the endosomolytic ligand assumes its active conformation at endosomal pH.
- the “active” conformation is that conformation in which the endosomolytic ligand promotes lysis of the endosome and/or transport of the composition of the invention, or its components, from the endosome to the cytoplasm of the cell.
- Exemplary endosomolytic ligands include the GALA peptide (Subbarao et al, Biochemistry, 1987, 26: 2964-2972, which is incorporated by reference in its entirety), the EALA peptide (Vogel et al., J. Am. Chem. Soc., 1996, 118: 1581-1586, which is incorporated by reference in its entirety), and their derivatives (Turk et al., Biochem. Biophys. Acta, 2002, 1559: 56-68, which is incorporated by reference in its entirety).
- the endosomolytic ligand can contain a chemical group (e.g., an amino acid) which will undergo a change in charge or protonation in response to a change in pH.
- the endosomolytic ligand can be linear or branched.
- the endosomolytic ligand is a peptide comprising an amino acid sequence FSEAIKKIIDFLG (SEQ ID NO: 17).
- the ligand e.g., endosomolytic ligand can be attached to the heavy- chain, light chain or the double-stranded RNA molecule of a DVD-Ig described herein.
- the ligand, e.g., endosomolytic ligand can be attached to the N- or C- terminus of the light chain or the heavy chain.
- the ligand, e.g , endosomo!ytic ligand is attached to the C-terminus of the light chain.
- the DVD immunoglobulin includes a first variable domain that binds to CD138.
- the DVD immunoglobulin comprises a first variable domain that binds to CD138 and a humanized 38C2 antibody variable domain as the second variable domain.
- variable domains are connected on each light and heavy chain with a peptide linker sequence, e.g., selected from ASTKGP (SEQ ID NO: 1 ), TVAAPSVFIFPP (SEQ ID NO: 2), CfiS (SEQ ID NO: 3), (GrSfi (SEQ ID NO: 4), (G-rSy (SEQ ID NO: 5), EPKSCDGiS (SEQ ID NO:6), HPkSCD(GiS) ⁇ (SEQ ID NO: 7), and EPKSCD(G4S (SEQ ID NO: 8).
- a peptide linker sequence e.g., selected from ASTKGP (SEQ ID NO: 1 ), TVAAPSVFIFPP (SEQ ID NO: 2), CfiS (SEQ ID NO: 3), (GrSfi (SEQ ID NO: 4), (G-rSy (SEQ ID NO: 5), EPKSCDGiS (SEQ ID NO:6), HPkSCD(GiS) ⁇ (
- a light chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- a heavy chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- the DVD immunoglobulin includes a first variable domain that binds to BCMA.
- the DVD immunoglobulin comprises a first variable domain that binds to BCMA and a humanized 38C2 antibody variable domain as the second variable domain.
- variable domains are connected on each light and heavy chain with a peptide linker sequence, e.g., selected from ASTKGP (SEQ ID NO: 1), TVAAPSVFIFPP (SEQ ID NO: 2), GrS (SEQ ID NO: 3), (048)2 (SEQ ID NO: 4), (G 4 S)s (SEQ ID NO: 5), EPKSCDGrS (SEQ ID NO:6), EPKSCD(G 4 S) 2 (SEQ ID NO: 7), and EPKSCD(G 4 S)s (SEQ ID NO: 8).
- a peptide linker sequence e.g., selected from ASTKGP (SEQ ID NO: 1), TVAAPSVFIFPP (SEQ ID NO: 2), GrS (SEQ ID NO: 3), (048)2 (SEQ ID NO: 4), (G 4 S)s (SEQ ID NO: 5), EPKSCDGrS (SEQ ID NO:6), EPKSCD(G 4 S) 2 (SEQ ID NO: 7), and EPKSCD(
- a light chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- a heavy chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- the DVD immunoglobulin includes a first variable domain that binds to SLAMF7.
- the DVD immunoglobulin comprises a first variable domain that binds to SLAMF7 and a humanized 38C2 antibody variable domain as the second variable domain.
- the variable domains are connected on each light and heavy chain with a peptide linker sequence, e.g., selected from A8TKGP (SEQ ID NO: 1), TVAAPSVFIFPP (SEQ ID NO: 2), G:S (SEQ ID NO: 3), (048)2 (SEQ ID NO: 4), (GiS) .
- the DVD immunoglobulin comprises:
- a light chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- a heavy chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence: MPMGSLQPLATLYLLGMLVASVLAEVQLVESGGGLVQPGGSLRLSCAAS GFDF SRYWMS WVRQ APGKGLEWIGEINPD S STINY APSLKDKFIISRDNA KNSLYLQMNSLRAEDTAVYYCARPDGNYWYFDVWGQGTLVTVSSASTK GPEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQSPEKGLEW V SEIRLRSDNY ATHY AESVKGRFTISRDN SKNTLYLQMN SLRAEDTGIYY CKTYFYSFSYWGQGTLVTVSSAST
- the DVD immunoglobulin includes a first variable domain that binds to HER2.
- the DVD immunoglobulin comprises a first variable domain that binds to HER2 and a humanized 38C2 antibody variable domain as the second variable domain.
- variable domains are connected on each light and heavy chain with a peptide linker sequence, e.g., selected from ASTKGP (SEQ ID NO: 1 ), TVAAPSVFIFPP (SEQ ID NO: 2), G 4 8 (SEQ ID NO: 3), (G*S>2 (SEQ ID NO: 4), (0.18)3 (SEQ ID NO: 5), EPKSCDGiS (SEQ ID NO:6), EPKSCD(GIS) 2 (SEQ ID NO: 7), and EPKSCD(G 4 S (SEQ ID NO: 8).
- a peptide linker sequence e.g., selected from ASTKGP (SEQ ID NO: 1 ), TVAAPSVFIFPP (SEQ ID NO: 2), G 4 8 (SEQ ID NO: 3), (G*S>2 (SEQ ID NO: 4), (0.18)3 (SEQ ID NO: 5), EPKSCDGiS (SEQ ID NO:6), EPKSCD(GIS) 2 (SEQ ID NO: 7), and EPKSCD(
- a light chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- a heavy chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- the DVD immunoglobulin includes a first variable domain that binds to SLAMF7, and the DVD immunoglobulin further includes a endosomolytic ligand.
- the DVD immunoglobulin comprises a first variable domain that binds to SLAMF7 and a humanized 38C2 antibody variable domain as the second variable domain.
- variable domains are connected on each light and heavy chain with a peptide linker sequence, e.g., selected from ASTKGP (SEQ ID NO: 1), TVAAPSVFIFPP (SEQ ID NO: 2), G 4 S, (G 4 S) 2 , (G 4 S) 3 , EPKSCDG 4 S, EPKSCD(G 4 S) 2 , and EPKSCD(G 4 S) 3 .
- a peptide linker sequence e.g., selected from ASTKGP (SEQ ID NO: 1), TVAAPSVFIFPP (SEQ ID NO: 2), G 4 S, (G 4 S) 2 , (G 4 S) 3 , EPKSCDG 4 S, EPKSCD(G 4 S) 2 , and EPKSCD(G 4 S) 3 .
- the DVD immunoglobulin comprises:
- a light chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- a heavy chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- the DVD immunoglobulin comprises:
- a first heavy chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- a second heavy chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- a light chain comprising an amino acid sequence that has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity or is substantially similar to the amino acid sequence:
- DVD immunoglobulins of the present invention can be produced by any of a number of techniques known in the art. For example, expression from host cells, wherein expression vector(s) encoding the DVD heavy and/or DVD light chains is transfected into a host cell by standard techniques.
- Various forms of the term“transfection” are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, calcium-phosphate precipitation, DEAE-dextran transfection and the like.
- DVD immunoglobulins of the invention are preferable, and most preferable in mammalian host cells, because such eukaryotic cells (and in particular mammalian cells) are more likely than prokaryotic cells to assemble and secrete a properly folded and immunoiogically active DVD immunoglobulin.
- Preferred mammalian host cells for expressing the recombinant immunoglobulins of the invention include Chinese Hamster Ovary (CHO cells) (including dhfr-CHO cells, described in Urlaub and Chasm, (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in R. J. Kaufman and P. A. Sharp (1982) Mol. Biol. 139:601 - 621), Human Embryonic Kidney (HEK) cells, NS0 myeloma cells, COS cells and SP2 cells.
- CHO cells including Chinese Hamster Ovary (CHO cells) (including dhfr-CHO cells, described in Urlaub and Chasm, (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in R. J. Kaufman and P. A. Sharp
- DVD immunoglobulins When recombinant expression vectors encoding DVD immunoglobulins are introduced into mammalian host cells, the DVD immunoglobulins are produced by culturing the host cells for a period of time sufficient to allow for expression of the DVD immunoglobulins in the host cells or, more preferably, secretion of the DVD immunoglobulins into the culture medium in which the host ceils are grown. DVD immunoglobulins can be recovered from the culture medium using standard protein purification methods.
- a recombinant expression vector encoding both the DVD heavy chain and the DVD light chain is introduced into dhfr-CHO cells by calcium phosphate-mediated transfection.
- the DVD heavy and light chain genes are each operatively- linked to CMV enhancer/ AdMLP promoter regulator ⁇ ' elements to drive high levels of transcription of the genes
- a recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification.
- Selected transformant host cells are cultured to allow- for expression of the DVD heavy and light chains and intact DVD immunoglobulin is recovered from the culture medium.
- Standard molecular biology and tissue culture techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the DVT) immunoglobulin from the culture medium.
- aspects of the invention include a method of synthesizing a DVD immunoglobulin of the invention by culturing a host cell of the invention in a suitable culture medium until a DVD immunoglobulin of the invention is synthesized.
- a method can further comprise isolating the DVD immunoglobulin from the culture medium to yield an isolated immunoglobulin.
- a feature of the subject DVD immunoglobulins is that they can be produced and purified in ways that are similar to conventional antibodies. Production of DVD immunoglobulins can result in a homogeneous, single major product with desired activity, without any sequence modification of the constant region or chemical modifications of any kind.
- linkers which can comprise one or more linker components.
- linker means an organic moiety that connects two parts of a compound, e.g., a DVD immunoglobulin to a dsRNA.
- Linkers typically comprise a direct bond or an atom such as oxygen or sulfur, a unit such as NR 1 , C(O), C(0)0, C(0)NR 1 , SO, SO2, SO2NH or a chain of atoms, such as substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, arylalkyl, arylalkenyl, arylalkynyl, heteroarylalkyl, heteroarylalkenyl, heteroarylalkynyl, heterocyclylalkyl, heterocyclylalkenyl, heterocyclylalkynyl, aryl, heteroaryl, heterocyclyl, cycloalkyl, cycloalkenyl, alkylarylalkyl, alkylarylalkenyl, alkylarylalkynyl, alkenylarylalkyl, alkenylarylalkenyl, alkeny
- linker functionality can be included in the subject conjugates, including but not limited to cleavable linkers, and non-cleavable linkers, as well as reversible linkers and irreversible linkers.
- the linker is a cleavable linker.
- Cleavable linkers are those that rely on processes inside a target cell to liberate the two parts the linker is holding together, e.g., the DVD-Ig and the dsRNA, as reduction in the cytoplasm, exposure to acidic conditions in a lysosome or endosome, or cleavage by specific enzymes (e.g. proteases) within the cell.
- cleavable linkers allow' the two dsRNA to be released in its original form after the conjugate has been internalized and processed inside a target cell.
- Cleavable linkers include, but are not limited to, those whose bonds can be cleaved by enzymes (e.g., peptide linkers); reducing conditions (e.g., disulfide linkers); or acidic conditions (e.g., hydrazones and carbonates).
- enzymes e.g., peptide linkers
- reducing conditions e.g., disulfide linkers
- acidic conditions e.g., hydrazones and carbonates.
- the deavable linker comprises at least one cleavable linking group.
- a cleavable linking group is one which is sufficiently stable outside the cell, but which upon entry into a target cell is cleaved to release the two parts the linker is holding together.
- the cleavable linking group is cleaved at least 10 times or more, preferably at least 100 times faster in the target cell or under a first reference condition (which can, e.g., be selected to mimic or represent intracellular conditions) than in the blood or serum of a subject, or under a second reference condition (which can, e.g., be selected to mimic or represent conditions found in the blood or serum).
- Cleavable linking groups are susceptible to cleavage agents, e.g., pH, redox potential or the presence of degradative molecules. Generally, cleavage agents are more prevalent or found at higher levels or activities inside cells than in serum or blood.
- degradative agents include: redox agents which are selected for particular substrates or which have no substrate specificity, including, e.g., oxidative or reductive enzymes or reductive agents such as mercaptans, present in cells, that can degrade a redox cleavable linking group by reduction; esterases; endosomes or agents that can create an acidic environment, e.g., those that result in a pH of five or lower; enzymes that can hydrolyze or degrade an acid cleavable linking group by acting as a general acid, peptidases (which can be substrate specific), and phosphatases.
- redox agents which are selected for particular substrates or which have no substrate specificity, including, e.g., oxidative or reductive enzymes or reductive agents such as mercaptans, present in cells, that can degrade a redox cleavable linking group by reduction; esterases; endosomes or agents that can create an acidic environment, e.g
- a cleavable linkage group such as a disulfide bond can be susceptible to pH.
- the pH of human serum is 7.4, while the average intracellular pH is slightly lower, ranging from about 7.1-7.3.
- Endosomes have a more acidic pH, in the range of 5.5-6.0, and lysosomes have an even more acidic pH at around 5.0.
- Some linkers will have a cleavable linking group that is cleaved at a preferred pH, thereby releasing the cationic lipid from the ligand inside the cell, or into the desired compartment of the cell.
- a linker can include a cleavable linking group that is cleavable by a particular enzyme.
- the type of cleavable linking group incorporated into a linker can depend on the cell to be targeted. For example, liver targeting ligands can be linked to the cationic lipids through a linker that includes an ester group. Liver cells are rich in esterases, and therefore the linker will be cleaved more efficiently in liver cells than in cell types that are not esterase-rich. Other cell- types rich in esterases include cells of the lung, renal cortex, and testis. Linkers that contain peptide bonds can be used when targeting cell types rich in peptidases, such as liver cells and synoviocytes.
- the suitability of a candidate cleavable linking group can be evaluated by testing the ability of a degradative agent (or condition) to cleave the candidate linking group. It will also be desirable to also test the candidate cleavable linking group for the ability to resist cleavage in the blood or when in contact with other non-target tissue.
- a degradative agent or condition
- the candidate cleavable linking group for the ability to resist cleavage in the blood or when in contact with other non-target tissue.
- the evaluations can be carried out in cell free systems, in cells, in cell culture, in organ or tissue culture, or in whole animals. It may be useful to make initial evaluations in cell-free or culture conditions and to confirm by further evaluations in whole animals.
- useful candidate compounds are cleaved at least 2, 4, 10 or 100 times faster in the cell (or under in vitro conditions selected to mimic intracellular conditions) as compared to blood or serum (or under in vitro conditions selected to mimic extracellular conditions).
- cleavable linking groups are redox cleavable linking groups, which may be used in the dsRNA molecule according to the present invention that are cleaved upon reduction or oxidation.
- An example of reductively cleavable linking group is a disulfide linking group (-S-S-).
- a candidate cleavable linking group is a suitable“reductively cleavable linking group,” or for example is suitable for use with a particular iRNA moiety and particular targeting agent one can look to methods described herein.
- a candidate can be evaluated by incubation with dithiothreitol (DTT), or other reducing agent using reagents know in the art, which mimic the rate of cleavage which would be observed in a cell, e.g., a target cell.
- the candidates can also be evaluated under conditions which are selected to mimic blood or serum conditions.
- candidate compounds are cleaved by at most 10% in the blood.
- useful candidate compounds are degraded at least 2, 4, 10 or 100 times faster in the cell (or under in vitro conditions selected to mimic intracellular conditions) as compared to blood (or under in vitro conditions selected to mimic extracellular conditions).
- the rate of cleavage of candidate compounds can be determined using standard enzyme kinetics assays under conditions chosen to mimic intracellular media and compared to conditions chosen to mimic extracellular media.
- Phosphate-based cleavable linking groups which may be used in the dsRNA molecule according to the present invention, are cleaved by agents that degrade or hydrolyze the phosphate group.
- agents that degrade or hydrolyze the phosphate group are enzymes such as phosphatases in cells.
- phosphate-based linking groups are -0-P(0)(0Rk)- 0-, -0-P(S)(0Rk)-0-, -0-P(S)(SRk)-0-, -S-P(0)(0Rk)-0-, -0-P(0)(0Rk)-S-, -S-P(0)(ORk)-S-, -0-P(S)(ORk)-S-, -S-P(S)(ORk)-0-, -0-P(0)(Rk)-0-, -0-P(S)(Rk)-0-, -S-P(0)(Rk)-0-, -S- P(S)(Rk)-0-, -S-P(0)(Rk)-S-, -0-P(S)( Rk)-S-.
- Preferred embodiments are -0-P(0)(0H)-0-, -O- P(S)(OH)-0-, -0-P(S)(SH)-0-, -S-P(0)(0H)-0-, -0-P(0)(0H)-S-, -S-P(0)(OH)-S-, -O- P(S)(OH)-S-, -S-P(S)(0H)-0-, -0-P(0)(H)-0-, -0-P(S)(H)-0-, -S-P(0)(H)-0-, -S-P(S)(H)-0-, - S-P(0)(H)-S-, -0-P(S)(H)-S-.
- a preferred embodiment is -0-P(0)(0H)-0-. These candidates can be evaluated using methods analogous to those described above.
- Acid cleavable linking groups which may be used in the dsRNA molecule according to the present invention, are linking groups that are cleaved under acidic conditions.
- acid cleavable linking groups are cleaved in an acidic environment with a pH of about 6.5 or lower (e.g., about 6.0, 5.5, 5.0, or lower), or by agents such as enzymes that can act as a general acid.
- specific low pH organelles such as endosomes and lysosomes can provide a cleaving environment for acid cleavable linking groups.
- acid cleavable linking groups include but are not limited to hydrazones, esters, and esters of amino acids.
- a preferred embodiment is when the carbon attached to the oxygen of the ester (the alkoxy group) is an aryl group, substituted alkyl group, or tertiary alkyl group such as dimethyl pentyl or t-butyl.
- Ester-based cleavable linking groups which may be used in the dsRNA molecule according to the present invention, are cleaved by enzymes such as esterases and amidases in cells.
- ester-based cleavable linking groups include but are not limited to esters of alkylene, alkenylene and alkynylene groups.
- Ester cleavable linking groups have the general formula -C(0)0-, or -OC(O)-. These candidates can be evaluated using methods analogous to those described above.
- Peptide-based cleavable linking groups which may be used in the dsRNA molecule according to the present invention, are cleaved by enzymes such as peptidases and proteases in cells.
- Peptide-based cleavable linking groups are peptide bonds formed between amino acids to yield oligopeptides (e.g., dipeptides, tripeptides etc.) and polypeptides.
- Peptide-based cleavable groups do not include the amide group (-C(O)NH-).
- the amide group can be formed between any alkylene, alkenylene or alkynylene.
- a peptide bond is a special type of amide bond formed between amino acids to yield peptides and proteins.
- the peptide based cleavage group is generally limited to the peptide bond (i.e., the amide bond) formed between amino acids yielding peptides and proteins and does not include the entire amide functional group.
- Peptide-based cleavable linking groups have the general formula - NHCHR A C(0)NHCHR B C(0)-, where R A and R B are the R groups of the two adjacent amino acids. These candidates can be evaluated using methods analogous to those described above.
- Non-limiting examples of cleavable linkers are described in FIG. 7 of WO2017/049139, content of which is incorporated herein by reference in its entirety.
- Non-cleavable linkers utilize catabolic degradation of an immunoconjugate for the release of the drug moiety. A released drug moiety generally retains the linker as well as the amino acid residue of the immunoglobulin to which the linker was conjugated.
- Non-cleavable linkers include, but are not limited to, PEG linkers, hydrocarbon linkers, and thioether linkers.
- Non-limitmg examples of non-cleavable linkers are described m FIG. 8 of WO2017/049139, content of which is incorporated herein by reference in its entirety.
- aspects of the subject conjugates can also include reversible and irreversible linkers.
- Reversible linkers utilize chemical bonds that can readily be broken, or reversed, using suitable reagents. As such, after the formation of a reversible linker, the linker can be broken in a desired position by treatment with a reagent, thereby releasing the immunoglobulin molecule from the linker.
- Non-limiting examples of reversible linkers are described in FIG. 9 of WO2017/049139, content of which is incorporated herein by reference in its entirety .
- Irreversible linkers utilize chemical bonds that cannot readily he broken or reversed after their formation.
- irreversible linkers are provided are described in FIG. 10 of WO2017/049139, content of which is incorporated herein by reference in its entirety ⁇ .
- Example linker reactions in which an immunoglobulin is conjugated to a reversible or irreversible linker are described in FIG. 13 of WQ2017/049139, content of which is incorporated herein by reference in its entirety .
- other moieties such as, e.g., vinyl diketones and pro-vinyl diketones can be used for conjugation.
- electrophilic moieties can be used, either alone or in combination, with such moieties. Electrophilic moieties can be used for site-specific conjugation with the single, uniquely reactive lysine of an h38C2 variable domain, and can also be used for non-specific conjugation after an h38C2 lysine has been conjugated to a drug moiety .
- Non- limiting examples of other moieties include 6-maleimidocaproyl (“MC”), maleimidopropanoyl (“MP”), valme-eitruilme (“val-cit” or “vc”), alanine-phenylalanine (“ala-phe”), p- aminobenzyl oxy carbonyl (a“PAB”), and those resulting from conjugation with linker reagents: N-Succinimidyl 4-(2-pyridylthio) pentanoate forming linker moiety 4-mercaptopentanoic acid (“SPF’X N-succinimidyl 4-(N-maleimidom ethyl) cyclohexane- 1 carboxylate forming linker moiety 4-((2,5-dioxopyrrolidin-l-yl)methyl)cyclohexanecarboxylic acid (“SMCC”, also referred to herein as“MCC”), 2,5-dioxopyrrol
- a linker component can comprise an amino acid unit.
- an amino acid unit allows for cleavage of the linker by a protease, thereby facilitating release of the drug from the immunoconjugate upon exposure to intracellular proteases, such as lysosomal enzymes. See, e.g., Domnina et al. (2003) Nat. Biotechnol. 21 : 778- 784.
- Non-limiting examples of amino acid units include, but are not limited to, a dipeptide, a tripeptide a tetrapeptide, and a pentapeptide.
- Non-limiting examples of dipeptides include: valme-citrulline (vc or val-eit), alanine-phenylalanine (af or ala-phe); phenylalanine-lysine (fk or phe-lys); or N-methyl-valine-citrulline (Me-val-cit).
- Non-limiting examples of tripeptides include: glycine-vaiine-citrulline (gly-val-cit) and glycine-glycine- glycine (gly-gly-gly).
- An ammo acid unit can comprise ammo acid residues that occur naturally, as well as minor amino acids and non-naturally occurring amino acid analogs, such as citrulline.
- Amino acid units can be designed and optimized m their selectivity for enzymatic cleavage by a particular enzyme, for example, a tumor-associated protease, cathepsin B, C and D, or a plasmin protease.
- a linker L can be a branched or dendritic type linker for covalent attachment of more than dsRNA through a branching, multifunctional linker moiety to an immunoglobulin (Sun et al (2002) Bioorganic & Medicinal Chemistry Letters 12:2213-2215; Sun et al (2003) Bioorganic & Medicinal Chemistry 11 : 1761-1768).
- Non-limiting examples of branched, dendritic linkers include 2,6-bis(hydroxymethyl)-p-cresol and 2,4,6- tris(hydroxymethyl)-phenol dendrimer units (WO 2004/01993; Szalai et al (2003) J Amer. Chem. Soc.
- Branched linkers can increase the molar ratio of RNA to immunoglobulin, i.e., loading, which is related to the potency of the ADC
- a multitude of dsRNAs can be attached through a branched linker.
- the branch point of the branched linker can be at least trivalent, but can be a tetravalent, pentavalent or hexavalent atom, or a group presenting such multiple valencies.
- the branch-point can be -N, -N(Q)-C, -O-C, -S-C, -SS-C, -C(0)N(Q)-C, -OC(0)N(Q)-C, -N(Q)C(0)- C, or -N(Q)C(0)0-C; wherein Q is independently for each occurrence H or optionally substituted alkyl.
- the branch-point can be glycerol or a glycerol derivative.
- Linker components including stretcher, spacer, and ammo acid units, can be synthesized by methods known in the art, such as those described in US Patent Publication No. 2005/0238649 Al, which is herein incorporated by reference in its entirety
- the linker is of structure: wherem X is a spacer.
- Spacer X typically comprises a direct bond or an atom such as oxygen or sulfur, a unit such as NR 1 , C(O), C(0)0, C(0)NR 1 , SO, SO2, SO2NH or a chain of atoms, such as substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, arylalkyl, arylalkenyl, arylalkynyl, heteroarylalkyl, heteroarylalkenyl, heteroarylalkynyl, heterocyclylalkyl, heterocyclylalkenyl, heterocyclylalkynyl, aryl, heteroaryl, heterocyclyl, cycloalkyl, cycloalkenyl, alkylarylalkyl, alkylarylalkenyl, alkylarylalkynyl, alkenylarylalkyl, alkenylarylalkenyl, al
- spacer X is -0(CH2CH20) P CH2CH20-, where p can be 0 or an integer from 1 to 1000.
- p can be 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- p is 2.
- the sapcer X comprises at least one cleavable linking group.
- sapcer X comprises a disulfide, e.g., -SS- linkage.
- spacer X is -0(alkyl)-SS-(alkyl)0-, where each alkyl can be interrupted by one, e.g., two, three or more of groups independently selected from O, S, S(O), SO2, NH, C(O) or C(0)0.
- spacer X can be -0(CH2)q0(CH2)rSS(CH20) s (CH2)t0-, where q, r, s and t are independently selected integers from 1-15.
- each q, r, s, and t can be independently 1, 2, 3, 4, 5, 6, 7 or 8. It is noted that q, r, s, and t can all be same, all same or some same and some different. For example, q and t can be same and selected from 2, 3, 4, 5 and 6. Similarly r and s can be same and selected from 1, 2, 3, and 4. In some embodiments, q and t are same, and r and s are the same but different from q and t. In some preferred embodiments, q and t are 4; and r and s are 2.
- the conjugates described herein can be prepared using any method known in the art for conjugating two molecules together.
- the conjugates can be prepared using the method disclosed in the Examples section herein.
- the second variable domain of DVD-Ig includes a reactive lysine residue, and a conjugate is created using a controlled conjugation reaction wherein a linker/dsRNA molecule composition is conjugated to the reactive lysine residue on each heavy chain of a naked Ig. Conditions for this reaction are described, for example, in US Patent No. 8,252,902, which is herein incorporated by reference in its entirety.
- the reaction can be carried out at room temperature in a solution of PBS, pH 7.4, 2% DM80 by reacting the Ig with a linker/dsRNA moiety composition, thereby resulting in the attachment of one linker/dsRNA moiety to each of the reactive lysine residues on the Ig.
- the result is conjugate having two dsRNA moieties attached via linkers to the reactive iysme residues on each heavy chain of the Ig.
- additional dsRNA molecule can be conjugated to the DVD-Ig molecule using uncontrolled conjugation techniques.
- amino acid residues other than the single, uniquely reactive lysine residue of the 38C2 variable domain can be used as attachment points for conjugation of a dsRNA molecule via a linker.
- the result of such uncontrolled conjugation is a conjugate having one or more dsRNA molecules attached to the other amino acid residues on the immunoglobulin molecule.
- Such additional conjugation can be accomplished by reacting a linker/dsRNA molecule composition with, e.g., lysine residues on the immunoglobulin molecule other than the single, uniquely reactive lysine in the second variable domain, or standard or engineered cysteine residues on the immunoglobulin molecule, or one or more engineered selenocysteine residues on the immunoglobulin molecule, or a uniquely reactive arginine residue in the second variable domain.
- the result of such uncontrolled conjugation is a conjugate with an average number of dsRNA molecules that ranges from about 1 to about 20 dsRNA molecules per antibody, depending on the number of amino acid residues that are available to react with the linker/dsRNA molecule composition.
- the average number of dsRNA molecules per immunoglobulin molecule achieved using an uncontrolled conj ugation approach is about 1 to about 8, such as 2, 3, 4, 5, 6, or 7 dsRNA molecules per immunoglobulin.
- an immunoglobulin is composed of two identical light chains and two identical heavy chains.
- an immunoglobulin light chain comprises a kappa light chain.
- an immunoglobulin light chain comprises a lambda light chain.
- an immunoglobulin is an IgA immunoglobulin, having a heavy chain.
- an immunoglobulin is an XgAl immunoglobulin.
- an immunoglobulin is an IgA2 immunoglobulin.
- an immunoglobulin is an IgD immunoglobulin, having a d heavy chain.
- an immunoglobulin is an IgE immunoglobulin, having an e heavy chain.
- an immunoglobulin is an IgG immunoglobulin, having a g heavy chain. In one aspect, an immunoglobulin is an IgG! immunoglobulin. In one aspect, an immunoglobulin is an IgG2 immunoglobulin. In one aspect, an immunoglobulin is an IgG3 immunoglobulin. In one aspect, an immunoglobulin is an IgG4 immunoglobulin. In one aspect, an immunoglobulin is an IgM immunoglobulin, having a m heavy chain.
- an immunoglobulin is an intact immunoglobulin. In one aspect, an immunoglobulin is a naked immunoglobulin. In one aspect, an immunoglobulin is an immunoglobulin fragment. In one aspect, an immunoglobulin fragment is selected from the group consisting of: Fab, Fab’, F(ab’)2, Fv and scFv.
- an immunoglobulin is a dual variable domain immunoglobulin.
- an immunoglobulin comprises a native polypeptide sequence.
- an immunoglobulin comprises a non-native polypeptide sequence.
- an immunoglobulin comprises a polypeptide.
- an immunoglobulin is a monoclonal immunoglobulin.
- an immunoglobulin comprises a chimeric immunoglobulin.
- an immunoglobulin comprises a humanized immunoglobulin.
- an immunoglobulin comprises a human immunoglobulin.
- an immunoglobulin is an isolated immunoglobulin.
- an immunoglobulin comprises a polypeptide sequence that is a fusion of two or more polypeptide sequences.
- an immunoglobulin is a conjugated immunoglobulin.
- an immunoglobulin specifically binds to or is specific for a binding target.
- an immunoglobulin has a binding affinity'.
- an immunoglobulin has a Kd value.
- an immunoglobulin binds to an epitope.
- an immunoglobulin binds to a target or binding target.
- a binding target comprises a binding region, to which an immunoglobulin binds.
- an immunoglobulin binds to an antigen.
- an immunoglobulin comprises an antigen binding site or antigen binding region.
- an immunoglobulin is produced in a host cell in some aspects, an immunoglobulin is produced by a cell line or a cell culture. In some aspects, an immunoglobulin is produced from a nucleic acid sequence that is operably linked to another nucleic acid sequence. [00296] In some aspects, an immunoglobulin amino acid sequence has a percent amino acid sequence identity to another amino acid sequence.
- the conjugates described herein can he used for inhibiting the expression of a target gene. Accordingly, in another aspect, provided herein is a method for inhibiting the expression of a target gene. The method comprises the step of administering a conjugate described herein to a cell in an amount sufficient to inhibit expression of the target gene. In a preferred embodiment, the present invention further relates to a use of a conjugate described herein for inhibiting expression of a target gene in a target cell in vitro.
- target genes include, but are not limited to, b-catenin (CTNNBl), IRF4, Factor VII, Eg5, PCSK9, TPX2, apoB, SAA, TTR, RSV, PDGF beta gene, Erb-B gene, Src gene, CRK gene, GRB2 gene, RAS gene, MEKK gene, INK gene, RAF gene, Erkl/2 gene, PCNA(p21) gene, MYB gene, JUN gene, FOS gene, BCF-2 gene, hepcidin, Activated Protein C, Cyclin D gene, VEGF gene, EGFR gene, Cyclin A gene, Cyclin E gene, WNT-1 gene, beta- catenin gene, c-MET gene, PKC gene, NFKB gene, STAT3 gene, survivin gene, Her2/Neu gene, topoisomerase I gene, topoisomerase II alpha gene, p73 gene, mutations in the p21(WAFl/CIPl) gene,
- CTNBl
- a conjugate described herein can be used for treatment of a subject or mammal.
- the conj ugates described herein can be used for treatment of various and other diseases by targeting and killing cells that express a particular tumor antigen.
- the conj ugates can broadly be used for the treatment of any of a variety of cancers. It is anticipated that any type of tumor and arty type of tumor-associated antigen can be targeted by the subject conjugates. Examples of cancer types include, without limitation, hematologic cancers, carcinomas, sarcomas, melanoma, and central nervous system cancers.
- Non-limiting examples of hematologic cancers that can be treated with the subject immunoconjugates include leukemia, acute myeloid leukemia, acute lymphoblastic leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, lymphoma, Hodgkin’s lymphoma, non-Hodgkin’s lymphoma, multiple myeloma, plasma cell leukemia, and myelodysplasia syndrome.
- Non-limiting examples of carcinomas that can be treated with the subject immunoconjugates include skin cancer, head and neck, thyroid, lung, nasopharyngeal, colorectal, liver, urinary bladder, ovarian, cervical, endometrial, prostate, gastric, esophageal, pancreatic, renal, and breast cancer.
- Non-limiting examples of sarcomas that can be treated with the subject immunoconjugates include angiosarcoma, chondrosarcoma, Ewing’s sarcoma, fibrosarcoma, gastrointestinal stromal tumor, leiomyosarcoma, liposarcoma, malignant peripheral nerve sheath tumor, osteosarcoma, pleomorphic sarcoma, rhabdomyosarcoma, Kaposi’s sarcoma and synovial sarcoma.
- Non-limiting examples of central nervous system cancers that can be treated with the subject immunoconjugates include glioma, meningioma and neuroma.
- Non-limiting examples of other cancers that can be treated with the subject immunoconjugates include melanoma.
- methods of use of the subject conjugates involve administering a conjugate described herein to a subject in conjunction with one or more additional therapies to treat a particular cancer.
- a subject conjugate can he used alone to treat a particular cancer, or alternatively, can be used in combination with or as an adjunct to conventional treatment with other medications, e.g., anti -neoplastic agents.
- Immunoconjugates can generally be used in combination with any anti -neoplastic agents, such as conventional and/or experimental chemotherapeutic agents, radiation treatments, and the like.
- an additional therapy can include an antibody, an anti- neoplastic agent, a cytotoxic agent, an anti -angiogenic agent, or an immunosuppressive agent.
- additional therapeutic agents include cisplatin, carbopiatin, oxaliplatin, mechlorethamine, cyclophosphamide, chlorambucil, ifosfamide, doxorubicin, daunorubicin, valrubicin, idarubicin, epiruhicin, actmomycin, bleomycin, plicamycin, mitomycin, bevacizumab, imatinib, erlotimb, gefitimb, ibrulinib, idelalisib, !ena!idomide, vincristine, vinblastine, vmorelbme, vindesine, paciitaxel, and docetaxel.
- conjugates described herein can be formulated into pharmaceutical compositions.
- the invention provides a pharmaceutical composition comprising a conjugate as defined herein.
- Pharmaceutically acceptable compositions comprise a therapeutically-effective amount of one or more of the conjugates described herein, taken alone or formulated together with one or more pharmaceutically acceptable carriers (additives), excipient and/or diluents.
- compositions can be specially formulated for administration in solid or liquid form, including those adapted for the following: (1) oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; (2) parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained- release formulation; (3) topical application, for example, as a cream, ointment, or a controlled- release patch or spray applied to the skin; (4) intravaginally or intrarectally, for example, as a pessary, cream or foam; (5) sublingually; (6) ocularly; (7) transdermally; or (8) nasally. Delivery using subcutaneous or intravenous methods can be particularly advantageous.
- the phrase“therapeutically-effective amount” as used herein means that amount of a compound, material, or composition comprising a conjugate described herein which is effective for producing some desired therapeutic effect in at least a sub-population of cells in an animal at a reasonable benefit/risk ratio applicable to any medical treatment.
- phrases “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- phrases “pharmaceutically acceptable carrier” as used herein means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, manufacturing aid (e.g., lubricant, talc magnesium, calcium or zinc stearate, or steric acid), or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
- manufacturing aid e.g., lubricant, talc magnesium, calcium or zinc stearate, or steric acid
- solvent encapsulating material involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
- Each carrier must be“acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
- materials which can serve as pharmaceutically acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as com starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium state, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, com oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (1
- pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration.
- the use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
- Pharmaceutical carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art.
- the formulations can conveniently be presented in unit dosage form and can be prepared by any methods well known in the art of pharmacy.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the host being treated, the particular mode of administration.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the compound which produces a therapeutic effect. Generally, out of one hundred per cent, this amount will range from about 0.1 per cent to about ninety -nine percent of active ingredient, preferably from about 5 per cent to about 70 per cent, most preferably from about 10 per cent to about 30 per cent.
- a formulation of the present invention comprises an excipient selected from the group consisting of cyclodextrins, celluloses, liposomes, micelle forming agents, e.g., bile acids, and polymeric carriers, e.g., polyesters and polyanhydrides; and a conjugate described herein.
- an aforementioned formulation renders orally bioavailable a conjugate described herein.
- the conjugate preparation can be formulated in combination with another agent, e.g., another therapeutic agent or an agent that stabilizes the conjugate.
- another agent e.g., another therapeutic agent or an agent that stabilizes the conjugate.
- Still other agents include chelating agents, e.g., EDTA (e.g., to remove divalent cations such as Mg 2+ ), salts, RNAse inhibitors (e.g., a broad specificity RNAse inhibitor such as RNAsin) and so forth.
- Methods of preparing these formulations or compositions include the step of bringing into association a compound of the present invention with the carrier and, optionally, one or more accessory ingredients.
- the formulations are prepared by uniformly and intimately bringing into association a compound of the present invention with liquid carriers, or finely divided solid carriers, or both, and then, if necessary, shaping the product.
- the rate of absorption of the drug then depends upon its rate of dissolution which, in turn, may depend upon crystal size and crystalline form.
- delayed absorption of a parenterally-administered drug form is accomplished by dissolving or suspending the drug in an oil vehicle.
- the compounds according to the invention may be formulated for administration in any convenient way for use in human or veterinary medicine, by analogy with other pharmaceuticals.
- compositions can also contain adjuvants such as preservatives, wetting agents, emulsifying agents and/or dispersing agents. Prevention of the presence of microorganisms can be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol, sorbic acid, and the like. It can also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form can be brought about by the inclusion of agents that delay absorption, such as aluminum monostearate and gelatin.
- a composition must be sterile and fluid to the extent that the composition is deliverable by syringe.
- the carrier preferably is an isotonic buffered saline solution.
- conjugates described herein or a pharmaceutical composition comprising same can be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the target disease or condition and the desired results. To administer a conjugate described herein by certain routes of administration, it can be necessary to coat the conjugate with, or eo-administer the conjugate with, a material to prevent its inactivation.
- a conjugate can be administered to a subject in an appropriate carrier, for example, liposomes, or a diluent.
- Pharmaceutically acceptable diluents include saline and aqueous buffer solutions.
- Exemplary routes for administration include, but are not limited to, intravenous, subcutaneous, intratumoral, topical, rectal, anal, vaginal, nasal, pulmonary, and ocular.
- compositions of the present invention can be administered in a number of ways depending upon whether local or systemic treatment is desired and upon the area to be treated. Administration can be topical (including ophthalmic, vaginal, rectal, intranasal, transdermal), oral or parenteral. Parenteral administration includes intravenous drip, subcutaneous, intraperitoneal or intramuscular injection, or intrathecal or intraventricular administration.
- the route and site of administration can be chosen to enhance targeting.
- intramuscular injection into the muscles of interest would be a logical choice.
- Lung cells might be targeted by administering the conjugate in aerosol form.
- the vascular endothelial cells could be targeted by coating a balloon catheter with the conjugate and mechanically introducing the conjugate.
- the pharmaceutical compositions of the present invention can be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- a selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- the unit dose is less than 10 mg per kg of body weight, or less than 10, 5, 2, 1, 0.5, 0.1, 0.05, 0.01, 0.005, 0.001, 0.0005, 0.0001, 0.00005 or 0.00001 mg per kg of bodyweight, and less than 200 nmole of dsRNA molecule (e.g., about 4.4 x 10 16 copies) per kg of body weight, or less than 1500, 750, 300, 150, 75, 15, 7.5, 1.5, 0.75, 0.15, 0.075, 0.015, 0.0075, 0.0015, 0.00075, 0.00015 nmole of dsRNA molecule per kg of body weight.
- dsRNA molecule e.g., about 4.4 x 10 16 copies
- the defined amount can be an amount effective to treat or prevent a disease or disorder, e.g., a disease or disorder associated with the target gene.
- the unit dose for example, can be administered by injection (e.g., intravenous, subcutaneous or intramuscular), an inhaled dose, or a topical application.
- dosages may be less than 10, 5, 2, 1, or 0.1 mg/kg of body weight.
- the unit dose is administered less frequently than once a day, e.g., less than every 2, 4, 8 or 30 days.
- the unit dose is not administered with a frequency (e.g., not a regular frequency).
- the unit dose may be administered a single time.
- the effective dose is administered with other traditional therapeutic modalities.
- a subject is administered an initial dose and one or more maintenance doses.
- the maintenance dose or doses can be the same or lower than the initial dose, e.g., one-half less of the initial dose.
- a maintenance regimen can include treating the subject with a dose or doses ranging from 0.01 pg to 15 mg/kg of body weight per day, e.g., 10, 1, 0.1, 0.01, 0.001, or 0.00001 mg per kg of bodyweight per day.
- the maintenance doses are, for example, administered no more than once every 2, 5, 10, or 30 days. Further, the treatment regimen may last for a period of time which will vary depending upon the nature of the particular disease, its severity and the overall condition of the patient.
- the dosage may be delivered no more than once per day, e.g., no more than once per 24, 36, 48, or more hours, e.g., no more than once for every 5 or 8 days.
- the patient can be monitored for changes in his condition and for alleviation of the symptoms of the disease state.
- the dosage of the compound may either be increased in the event the patient does not respond significantly to current dosage levels, or the dose may be decreased if an alleviation of the symptoms of the disease state is observed, if the disease state has been ablated, or if undesired side-effects are observed.
- the effective dose can be administered in a single dose or in two or more doses, as desired or considered appropriate under the specific circumstances. If desired to facilitate repeated or frequent infusions, implantation of a delivery device, e.g., a pump, semi-permanent stent (e.g., intravenous, intraperitoneal, intracistemal or intracapsular), or reservoir may be advisable.
- a delivery device e.g., a pump, semi-permanent stent (e.g., intravenous, intraperitoneal, intracistemal or intracapsular), or reservoir may be advisable.
- the composition includes a plurality of dsRNA molecule species.
- the dsRNA molecule species has sequences that are non overlapping and non-adjacent to another species with respect to a naturally occurring target sequence.
- the plurality of dsRNA molecule species is specific for different naturally occurring target genes.
- the dsRNA molecule is allele specific.
- conjugates described herein can be administered to mammals, particularly large mammals such as nonhuman primates or humans in a number of ways.
- the administration of the conjugate is parenteral, e.g., intravenous (e.g., as a bolus or as a diffusible infusion), intradermal, intraperitoneal, intramuscular, intrathecal, intraventricular, intracranial, subcutaneous, transmucosal, buccal, sublingual, endoscopic, rectal, oral, vaginal, topical, pulmonary, intranasal, urethral or ocular.
- Administration can be provided by the subject or by another person, e.g., a health care provider.
- the medication can be provided in measured doses or in a dispenser which delivers a metered dose.
- Liposomes and lipid formulations Liposomes and lipid formulations
- the conjugates described herein can be formulated for delivery in a membranous molecular assembly, e.g., a liposome or a micelle.
- a liposome refers to a vesicle composed of amphiphilic lipids arranged in at least one bilayer, e.g., one bilayer or a plurality of bilayers. Liposomes include unilamellar and multilamellar vesicles that have a membrane formed from a lipophilic material and an aqueous interior. The aqueous portion contains the siRNA composition.
- the lipophilic material isolates the aqueous interior from an aqueous exterior, which typically does not include the siRNA composition, although in some examples, it may.
- Liposomes are useful for the transfer and delivery of active ingredients to the site of action. Because the liposomal membrane is structurally similar to biological membranes, when liposomes are applied to a tissue, the liposomal bilayer fuses with bilayer of the cellular membranes. As the merging of the liposome and cell progresses, the internal aqueous contents that include a conjugate described herein are delivered into the cell where the dsRNA can specifically bind to a target RNA and can mediate RNAi. In some cases, the liposomes are also specifically targeted, e.g., to direct the conjugate to particular cell types.
- a liposome containing a conjugate described herein can be prepared by a variety of methods.
- the lipid component of a liposome is dissolved in a detergent so that micelles are formed with the lipid component.
- the lipid component can be an amphipathic cationic lipid or lipid conjugate.
- the detergent can have a high critical micelle concentration and may be nonionic.
- Exemplary detergents include cholate, CHAPS, octylglucoside, deoxy cholate, and lauroyl sarcosine.
- the siRNA preparation is then added to the micelles that include the lipid component.
- the cationic groups on the lipid interact with the dsRNA of the conjugate and condense around the conjugate to form a liposome. After condensation, the detergent is removed, e.g., by dialysis, to yield a liposomal preparation of siRNA.
- a carrier compound that assists in condensation can be added during the condensation reaction, e.g., by controlled addition.
- the carrier compound can be a polymer other than a nucleic acid (e.g., spermine or spermidine). pH can also be adjusted to favor condensation.
- Liposome formation can also include one or more aspects of exemplary methods described in Feigner, P. L. et al, Proc. Natl. Acad. Sci., USA 8:7413-7417, 1987; U.S. Pat. No. 4,897,355; U.S. Pat. No. 5,171,678; Bangham, et al. M. Mol. Biol. 23:238, 1965; Olson, et al. Biochim. Biophys.
- Microfluidization can be used when consistently small (50 to 200 nm) and relatively uniform aggregates are desired (Mayhew, et al. Biochim. Biophys. Acta 775: 169, 1984, which is incorporated by reference in its entirety). These methods are readily adapted to packaging siRNA preparations into liposomes.
- Liposomes that are pH-sensitive or negatively-charged entrap nucleic acid molecules rather than complex with them. Since both the nucleic acid molecules and the lipid are similarly charged, repulsion rather than complex formation occurs. Nevertheless, some nucleic acid molecules are entrapped within the aqueous interior of these liposomes. pH-sensitive liposomes have been used to deliver DNA encoding the thymidine kinase gene to cell monolayers in culture. Expression of the exogenous gene was detected in the target cells (Zhou et al, Journal of Controlled Release, 19, (1992) 269-274, which is incorporated by reference in its entirety).
- liposomal composition includes phospholipids other than naturally-derived phosphatidylcholine.
- Neutral liposome compositions can be formed from dimyristoyl phosphatidylcholine (DMPC) or dipalmitoyl phosphatidylcholine (DPPC).
- Anionic liposome compositions generally are formed from dimyristoyl phosphatidylglycerol, while anionic fusogenic liposomes are formed primarily from dioleoyl phosphatidylethanolamine (DOPE).
- DOPE dioleoyl phosphatidylethanolamine
- Another type of liposomal composition is formed from phosphatidylcholine (PC) such as, for example, soybean PC, and egg PC.
- PC phosphatidylcholine
- Another type is formed from mixtures of phospholipid and/or phosphatidylcholine and/or cholesterol.
- Examples of other methods to introduce liposomes into cells in vitro include U.S. Pat. No. 5,283,185; U.S. Pat. No. 5,171,678; WO 94/00569; WO 93/24640; WO 91/16024; Feigner, J. Biol. Chem. 269:2550, 1994; Nabel, Proc. Natl. Acad. Sci. 90: 11307, 1993; Nabel, Human Gene Ther. 3:649, 1992; Gershon, Biochem. 32:7143, 1993; and Strauss EMBO J. 11 :417, 1992.
- cationic liposomes are used.
- Cationic liposomes possess the advantage of being able to fuse to the cell membrane.
- Non-cationic liposomes although not able to fuse as efficiently with the plasma membrane, are taken up by macrophages in vivo and can be used to deliver siRNAs to macrophages.
- liposomes obtained from natural phospholipids are biocompatible and biodegradable; liposomes can incorporate a wide range of water and lipid soluble drugs; liposomes can protect encapsulated siRNAs in their internal compartments from metabolism and degradation (Rosoff, in“Pharmaceutical Dosage Forms,” Lieberman, Rieger and Banker (Eds.), 1988, volume 1, p. 245).
- Important considerations in the preparation of liposome formulations are the lipid surface charge, vesicle size and the aqueous volume of the liposomes.
- a positively charged synthetic cationic lipid, N-[l-(2,3-dioleyloxy)propyl]-N,N,N- trimethylammonium chloride can be used to form small liposomes that interact spontaneously with nucleic acid to form lipid-nucleic acid complexes which are capable of fusing with the negatively charged lipids of the cell membranes of tissue culture cells, resulting in delivery of siRNA (see, e.g., Feigner, P. L. et al, Proc. Natl. Acad. Sci., USA 8:7413-7417, 1987 and U.S. Pat. No. 4,897,355 for a description of DOTMA and its use with DNA, which are incorporated by reference in their entirety).
- DOTMA N-[l-(2,3-dioleyloxy)propyl]-N,N,N- trimethylammonium chloride
- a DOTMA analogue, l,2-bis(oleoyloxy)-3-(trimethylammonia)propane can be used in combination with a phospholipid to form DNA-complexing vesicles.
- LipofectinTM Bethesda Research Laboratories, Gaithersburg, Md. is an effective agent for the delivery of highly anionic nucleic acids into living tissue culture cells that comprise positively charged DOTMA liposomes which interact spontaneously with negatively charged polynucleotides to form complexes. When enough positively charged liposomes are used, the net charge on the resulting complexes is also positive.
- DOTAP cationic lipid, l,2-bis(oleoyloxy)-3,3-(trimethylammonia)propane
- cationic lipid compounds include those that have been conjugated to a variety of moieties including, for example, carboxyspermine which has been conjugated to one of two types of lipids and includes compounds such as 5-carboxyspermylglycine dioctaoleoylamide (“DOGS”) (TransfectamTM, Promega, Madison, Wisconsin) and dipalmitoylphosphatidylethanolamine 5-carboxyspermyl-amide (“DPPES”) (see, e.g., U.S. Pat. No. 5,171,678).
- DOGS 5-carboxyspermylglycine dioctaoleoylamide
- DPES dipalmitoylphosphatidylethanolamine 5-carboxyspermyl-amide
- Another cationic lipid conjugate includes derivatization of the lipid with cholesterol (“DC-Chol”) which has been formulated into liposomes in combination with DOPE (See, Gao, X. and Huang, L., Biochim. Biophys. Res. Commun. 179:280, 1991). Lipopolylysine, made by conjugating poly lysine to DOPE, has been reported to be effective for transfection in the presence of serum (Zhou, X. et al., Biochim. Biophys. Acta 1065:8, 1991, which is incorporated by reference in its entirety).
- these liposomes containing conjugated cationic lipids are said to exhibit lower toxicity and provide more efficient transfection than the DOTMA- containing compositions.
- Other commercially available cationic lipid products include DMRIE and DMRIE-HP (Vical, La Jolla, California) and Lipofectamine (DOSPA) (Life Technology, Inc., Gaithersburg, Maryland).
- DOSPA Lipofectamine
- Other cationic lipids suitable for the delivery of oligonucleotides are described in WO 98/39359 and WO 96/37194.
- liposomes are particularly suited for topical administration, liposomes present several advantages over other formulations. Such advantages include reduced side effects related to high systemic absorption of the administered drug, increased accumulation of the administered drug at the desired target, and the ability to administer siRNA, into the skin.
- liposomes are used for delivering siRNA to epidermal cells and also to enhance the penetration of siRNA into dermal tissues, e.g., into skin.
- the liposomes can be applied topically. Topical delivery of drugs formulated as liposomes to the skin has been documented (see, e.g., Weiner et al., Journal of Drug Targeting, 1992, vol.
- Non-ionic liposomal systems have also been examined to determine their utility in the delivery of drugs to the skin, in particular systems comprising non-ionic surfactant and cholesterol.
- Non-ionic liposomal formulations comprising Novasome I (glyceryl dilaurate/cholesterol/polyoxyethylene-10-stearyl ether) and Novasome II (glyceryl distearate/ cholesterol/polyoxyethylene- 10-stearyl ether) were used to deliver a drug into the dermis of mouse skin.
- Such formulations with siRNA are useful for treating a dermatological disorder.
- Liposomes that include a conjugate described herein can be made highly deformable. Such deformability can enable the liposomes to penetrate through pore that are smaller than the average radius of the liposome.
- transfersomes are a type of deformable liposomes. Transfersomes can be made by adding surface edge activators, usually surfactants, to a standard liposomal composition. Transfersomes that include siRNA can be delivered, for example, subcutaneously by infection in order to deliver siRNA to keratinocytes in the skin. In order to cross intact mammalian skin, lipid vesicles must pass through a series of fine pores, each with a diameter less than 50 nm, under the influence of a suitable transdermal gradient. In addition, due to the lipid properties, these transfersomes can be self-optimizing (adaptive to the shape of pores, e.g., in the skin), self-repairing, and can frequently reach their targets without fragmenting, and often self-loading.
- a conjugate formulation can include a surfactant.
- a conjugate described herein is formulated as an emulsion that includes a surfactant.
- HLB hydrophile/lipophile balance
- Nonionic surfactants find wide application in pharmaceutical products and are usable over a wide range of pH values. In general, their HLB values range from 2 to about 18 depending on their structure.
- Nonionic surfactants include nonionic esters such as ethylene glycol esters, propylene glycol esters, glyceryl esters, polyglyceryl esters, sorbitan esters, sucrose esters, and ethoxylated esters.
- Nonionic alkanolamides and ethers such as fatty alcohol ethoxylates, propoxylated alcohols, and ethoxylated/propoxylated block polymers are also included in this class.
- the polyoxyethylene surfactants are the most popular members of the nonionic surfactant class.
- Anionic surfactants include carboxylates such as soaps, acyl lactylates, acyl amides of amino acids, esters of sulfuric acid such as alkyl sulfates and ethoxylated alkyl sulfates, sulfonates such as alkyl benzene sulfonates, acyl isethionates, acyl taurates and sulfosuccinates, and phosphates.
- the most important members of the anionic surfactant class are the alkyl sulfates and the soaps.
- Cationic surfactants include quaternary ammonium salts and ethoxylated amines. The quaternary ammonium salts are the most used members of this class.
- amphoteric surfactants include acrylic acid derivatives, substituted alkylamides, N-alkylbetaines and phosphatides.
- micellar formulation a particular type of molecular assembly in which amphipathic molecules are arranged in a spherical structure such that all the hydrophobic portions of the molecules are directed inward, leaving the hydrophilic portions in contact with the surrounding aqueous phase. The converse arrangement exists if the environment is hydrophobic.
- a mixed micellar formulation suitable for delivery through transdermal membranes may be prepared by mixing an aqueous solution of the siRNA composition, an alkali metal Cx to C22 alkyl sulphate, and a micelle forming compounds.
- Exemplary micelle forming compounds include lecithin, hyaluronic acid, pharmaceutically acceptable salts of hyaluronic acid, glycolic acid, lactic acid, chamomile extract, cucumber extract, oleic acid, linoleic acid, linolenic acid, monoolein, monooleates, monolaurates, borage oil, evening of primrose oil, menthol, trihydroxy oxo cholanyl glycine and pharmaceutically acceptable salts thereof, glycerin, polyglycerin, lysine, polylysine, triolein, polyoxyethylene ethers and analogues thereof, polidocanol alkyl ethers and analogues thereof, chenodeoxycholate, deoxycholate, and mixtures thereof.
- the micelle forming compounds may be added at the same time or after addition of the alkali metal alkyl sulphate. Mixed micelles will form with substantially any kind of mixing of the ingredients but vigorous mixing in order to provide
- a first micellar composition is prepared which contains conjugate described herein and at least the alkali metal alkyl sulphate.
- the first micellar composition is then mixed with at least three micelle forming compounds to form a mixed micellar composition.
- the micellar composition is prepared by mixing conjugate described herein, the alkali metal alkyl sulphate and at least one of the micelle forming compounds, followed by addition of the remaining micelle forming compounds, with vigorous mixing.
- Phenol and/or m-cresol may be added to the mixed micellar composition to stabilize the formulation and protect against bacterial growth. Alternatively, phenol and/or m-cresol may be added with the micelle forming ingredients.
- An isotonic agent such as glycerin may also be added after formation of the mixed micellar composition.
- micellar formulation For delivery of the micellar formulation as a spray, the formulation can be put into an aerosol dispenser and the dispenser is charged with a propellant.
- the propellant which is under pressure, is in liquid form in the dispenser.
- the ratios of the ingredients are adjusted so that the aqueous and propellant phases become one, i.e., there is one phase. If there are two phases, it is necessary to shake the dispenser prior to dispensing a portion of the contents, e.g., through a metered valve.
- the dispensed dose of pharmaceutical agent is propelled from the metered valve in a fine spray.
- Propellants may include hydrogen-containing chlorofluorocarbons, hydrogen- containing fluorocarbons, dimethyl ether and diethyl ether.
- HFA 134a (1,1, 1,2 tetrafluoroethane) may be used.
- the specific concentrations of the essential ingredients can be determined by relatively straightforward experimentation. For absorption through the oral cavities, it is often desirable to increase, e.g., at least double or triple, the dosage for through injection or administration through the gastrointestinal tract.
- conjugate described herein can be incorporated into a particle, e.g., a microparticle.
- Microparticles can be produced by spray-drying, but may also be produced by other methods including lyophilization, evaporation, fluid bed drying, vacuum drying, or a combination of these techniques.
- kits comprising the conjugates described herein.
- the kit further comprises instructions for use.
- Embodiment 1 A conjugate comprising: (a) a dual variable domain immunoglobulin molecule (Ig), or an antigen-binding fragment thereof, wherein the dual variable domain immunoglobulin molecule comprises: (i) a first variable domain that binds to a binding target, and (ii) a second variable domain that comprises a reactive residue; (b) a linker covalently conjugated to the reactive residue of the second variable domain of the Ig; and (c) a double- stranded RNA (dsRNA) molecule conjugated to the linker.
- the dsRNA is capable of inhibiting the expression of a target gene.
- the dsRNA comprises a sense strand and an antisense strand, each strand having 14 to 40 nucleotides, wherein the antisense strand has sufficient complementarity to the target sequence to mediate RNA interference.
- the dsRNA further has at least one of the following characteristics: (i) a melting temperature (Tm) of from about 40°C to about 80°C; (ii) the antisense strand comprises 2, 3, 4, 5 or 6 2’-fluoro modifications; (iii) the antisense strand comprises 1 , 2, 3 or 4 phosphorothioate internucleotide linkages; (iv) the sense strand is conjugated with the linker; (v) the sense strand comprises 2, 3, 4 or 5 :2’-fiuoro modifications; (vi) the sense strand comprises 1, 2, 3 or 4 phosphorothioate intern ucleotide linkages; (vii) the dsRNA comprises at least four 2’-fiuoro modifications; (Tm)
- Embodiment 2 The conjugate according to Embodiment 1, wherein the dsRNA has a melting temperature (T m ) of from about 40 C C to about 80°C.
- Embodiment 3 The conjugate according to any one of Embodiments 1-2, wherein the dsRNA has a melting temperature of at least 60°C.
- Embodiment 4 The conjugate according to any one of Embodiments 1-3, wherein the dsRNA comprises at least four 2’-fluoro modifications.
- Embodiment 5 The conjugate according to any one of Embodiments 1-4, wherein the dsRNA comprises a duplex region of 12-40 nucleotide base pairs in length
- Embodiment 6 The conjugate according to any one of Embodiments 1 -5, wherein the dsRNA comprises a duplex region of 18-25 nucleotide base pairs in length.
- Embodiment 7 The conjugate according to any one of Embodiments 1 -6, wherein the dsRNA comprises a blunt end at 5’ -end of the antisense strand.
- Embodiment 8 The conjugate according to any one of Embodiments 1-7, wherein the dsRNA comprises an overhang at 3’-end of the antisense strand.
- Embodiment 9 The conjugate according to any one of Embodiments 1-8, wherein the dsRNA comprises an overhang of at least two nucleotides at 3’-end of the antisense strand.
- Embodiment 10 The conjugate according to any one of Embodiments 1-9, wherein the sense strand is covalently conjugated with the linker.
- Embodiment 11 The conjugate according to Embodimemtl O, wherein 5’-end of the sense stand is covalently conjugated with the linker.
- Embodiment 12 The conjugate of Embodiment 10, wherein 3’-end of the sense stand is covalently conjugated with the linker.
- Embodiment 13 The conjugate according to any one of Embodiments 1-12, wherein the sense strand is 19-25 nucleotides in length.
- Embodiment 14 The conjugate according to any one of Embodiments 1-13, wherein the sense strand is 21 nucleotides in length.
- Embodiment 15 The conjugate according to any one of Embodiments 1-14, wherein the sense strand comprises 2, 3, 4 or 5 2’-fluoro modifications.
- Embodiment 16 The conjugate according to any one of Embodiments 1-15, wherein the sense strand comprises 3 or 4 2’-fluoro modifications.
- Embodiment 17 The conjugate according to any one of Embodiments 1-16, wherein the sense strand comprises 2’-fiuoro modifications at positions 7, 10 and 11, counting from the 5’-end.
- Embodiment 18 The conj ugate according to any one of Embodiments 1-17, wherein the sense strand comprises 2’-fluoro modifications at positions 7, 9, 10 and 1 1 , counting from the 5’-end.
- Embodiment 19 The conjugate according to any one of Embodiments 1-18, wherein the sense strand comprises 0, 1 , 2, 3 or 4 phosphorothioate internucleotide linkages.
- Embodiment 20 The conjugate according to any one of Embodiments 1-19, wherein the sense stand comprises phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, and between nucleotide positions 2 and 3, counting from the 5’ end.
- Embodiment 21 The conjugate according to any one of Embodiments 1-20, wherein the antisense strand is 19-25 nucleotides in length.
- Embodiment 22 The conjugate according to any one of Embodiments 1-21, wherein the antisense is 23 nucleotides in length.
- Embodiment 23 The conjugate according to any one of Embodiments 1-22, wherein the Embodiment 3: antisense comprises 2, 3, 4, 5 or 6 2’-fluoro modifications.
- Embodiment 24 The conj ugate according to any one of Embodiments 1-23, wherein the antisense comprises 2’-fluoro modifications at positions 2, 14 and 16, counting from the 5’- en .
- Embodiment 25 The conjugate according to any one of Embodiments 1-24, wherein the antisense comprises 2 , -fluoro modifications at positions 2, 6, 9, 14 and 16, counting from the 5’ -end.
- Embodiment 26 The conjugate according to any one of Embodiments 1-25, wherein the antisense comprises 2’-fluoro modifications at positions 2, 6, 8, 9, 14 and 16, counting from the 5’-end.
- Embodiment 27 The conjugate according to any one of Embodiments 1-26, wherein the antisense comprises 1, 2, 3 or 4 phosphorothioate intemucleotide linkages.
- Embodiment 28 The conjugate according to any one of Embodiments 1-27, wherein the antisense comprises phosphorothioate intemucleotide linkages between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23, counting from the 5’ end.
- Embodiment 29 The conjugate according to any one of Embodiments 1-28, wherein the antisense comprises phosphorothioate intemucleotide linkages between nucleotide positions 1 and 2, between nucleotide positions 2 and 3, between nucleotide positions 21 and 22, and between nucleotide positions 22 and 23, counting from the 5’ end.
- Embodiment 30 The conjugate according to any one of Embodiments 1-29, wtierem the antisense strand comprises at least one thermally destabilizing modification of the duplex within the first 9 nucleotide positions of the 5’ region.
- Embodiment 31 The conjugate of Embodiment 30, wherein said thermally destabilizing modification is at position 4, 5, 6, 7, 8 or 9, counting from 5’-end, of the antisense strand.
- Embodiment 32 The conjugate of Embodiment 31, wherein said thermally destabilizing modification is at position 7, counting from 5’-end, of the antisense strand.
- Embodiment 32 The conjugate according to any one of Embodiments 1-32, wherein the antisense comprises a 5’-vinylphosphonate nucleotide at 5’-end.
- Embodiment 34 The conjugate according to any one of Embodiments 1-33, wherein the dsRNA comprises at least one 2’-QMe modification.
- Embodiment 35 The conjugate according to any one of Embodiments 1-34, wherein the sense strand comprises at least one 2’-OMe modification.
- Embodiment 36 The conjugate according to any one of Embodiments 1-35, wherein the antisense strand comprises at least one 2’-OMe modification.
- Embodiment 37 The conjugate according to any one of Embodiments 1-36, wherein the dsRNA comprises at least one locked nucleic acid (LNA) modification.
- LNA locked nucleic acid
- Embodiment 38 The conjugate according to any one of Embodiments 1-37, wherein the reactive residue is a lysine.
- Embodiment 39 The conjugate according to any one of Embodiments 1-38, wherein the first variable domain of Ig is positioned closer to an N-terminus than the second variable domain.
- Embodiment 40 The conjugate according to any one of Embodiments 1-39, wherein Ig is a bispecific immunoglobulin molecule.
- Embodiment 41 The conjugate according to any one of Embodiments 1-40, wherein the antigen-binding fragment comprises the first and second variable domains of Ig, and is selected from a Fab, Fab’, F(ab’)?., Fv or scFv.
- Embodiment 42 The conjugate according to any one of Embodiments 1-41, wherein the antigen-binding fragment comprises a Fab.
- Embodiment 43 The conjugate according to any one of Embodiments 1-42, wherein Ig comprises a chimeric immunoglobulin sequence.
- Embodiment 44 The conjugate according to any one of Embodiments 1-43, wherein Ig comprises a humanized immunoglobulin sequence,
- Embodiment 45 The conjugate according to any one of Embodiments 1-44, wherein Ig comprises a human immunoglobulin sequence.
- Embodiment 46 The conjugate according to any one of Embodiments 1-45, wherein the binding target is a tumor cell surface antigen.
- Embodiment 47 The conjugate of any one of Embodiments 1-46, wherein the first variable domain binds to CD 138, B-cell maturation antigen (BCMA), SLAMF7, HER2, FOLR1, or CD79b.
- BCMA B-cell maturation antigen
- SLAMF7 SLAMF7
- HER2, FOLR1 CD79b
- Embodiment 48 The conjugate according to any one of Embodiments 1-47, wherein L is a reversible linker.
- Embodiment 49 The conjugate according to any one of Embodiments 1-48, wherein L is an irreversible linker.
- Embodiment 50 The conjugate according to any one of Embodiments 1-49, wherein L is a cieavable linker.
- Embodiment 51 The conjugate according to any one of Embodiments 1-50, wherein L is a non-cieavable linker.
- Embodiment 52 The conjugate according to any one of Embodiments 1-51, wherein L is a branched linker.
- Embodiment 53 The conjugate according to any one of Embodiments 1-52, wherein L is a Smear linker.
- Embodiment 54 The conjugate according to any one Embodiments, 1-53, wherein the Ig comprises a first heavy chain and light chain.
- Embodiment 55 The conjugate according to any one Embodiments, 1-54, wherein the Ig comprises a first heavy chain, a second heav chain and a light chain, wherein the first heavy chain and the second heavy chain are different.
- Embodiment 56 The conjugate according to any one Embodiments, 1-55, wherein the Ig is capable of binding two different epitopes.
- Embodiment 57 The conjugate according to any one Embodiments, 1-54, wherein the Ig comprises a heavy chain, a light chain, and a J chain.
- Embodiment 58 The conjugate according to any one of Embodiments 1-57, wherein the Ig further comprises a ligand.
- Embodiment 59 The conjugate according to Embodiment 58, wherein the ligand is an endosomolytic ligand.
- Embodiment 60 The conjugate according to Embodiment 59, wherein the hgand is linked to the light chain.
- Embodiment 61 The conjugate according to any one of Embodiments 1-60, wherein one of the variable domain, e.g., first or second variable domain comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, and any combinations thereof.
- Embodiment 62 The conjugate of any one of Embodiments 1-61, wherein the Ig comprises a peptide linker between two of the domains, e.g., the first variable domain and the second variable domain.
- Embodiment 63 The conjugate of Embodiment 62, wherein the peptide linker comprises an amino acid sequence selected from the group consisting of ASTKGP (SEQ IS NO: 1), TVAAP8VEIFPP (SEQ IS NO: 2), GrS (SEQ IS NO: 3), (GiSb (SEQ 18 NO: 4), (GiS)s (SEQ IS NO: 5), EPKSCDGtS (SEQ IS NO: 6), EPKSCD(G S) 2 (SEQ IS NO: 7), EPKSCDiGiS h (SEQ IS NO: 8), and any combinations thereof.
- ASTKGP SEQ IS NO: 1
- TVAAP8VEIFPP SEQ IS NO: 2
- GrS SEQ IS NO: 3
- GaSb SEQ 18 NO: 4
- GiS)s SEQ IS NO: 5
- EPKSCDGtS SEQ IS NO: 6
- EPKSCD(G S) 2 SEQ IS NO: 7
- EPKSCDiGiS h S
- Embodiment 64 The conjugate of any one of Embodiments 1-63, wherein the Ig comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEWQ ID NO: 29, SEQ ID NO: 30, and any combinations thereof
- Embodiment 65 A pharmaceutical composition comprising the conjugate of according to any one of Embodiments 1 -64 alone or m combination with a pharmaceutically acceptable carrier or excipient.
- Embodiment 66 A gene silencing kit comprising the conjugate according to any one of claims 1-64.
- Embodiment 67 A method for silencing a target gene m a cell, the method comprising introducing a conjugate according to any one of Embodiments 1 -64 into the cell.
- Embodiment 68 Use of the conjugate according to any one of Embodiments 1-64 in the preparation of a medicament.
- RNA e.g., mRNA
- mRNA e.g., a transcript of a gene that encodes a protein
- mRNA to be silenced e.g., a transcript of a gene that encodes a protein
- target gene e.g., a target gene
- RNA to be silenced is an endogenous gene, exogenous gene or a pathogen gene.
- RNAs other than mRNA e.g., tRNAs, and viral RNAs, can also be targeted.
- the phrase“mediates RNAi” refers to the ability to silence, in a sequence specific manner, a target gene, e.g., mRNA. While not wishing to be bound by theory, it is believed that silencing uses the RNAi machinery or process and a guide RNA, e.g., antisense strand of a dsRNA, where the antisense strand is 21 to 23 nucleotides in length.
- “specifically hybridizable” and“complementary” are terms which are used to indicate a sufficient degree of complementarity such that stable and specific binding occurs between a compound of the invention and a target RNA molecule. Specific binding requires a sufficient degree of complementarity to avoid non-specific binding of the oligomeric compound to non-target sequences under conditions in which specific binding is desired, i.e., under physiological conditions in the case of assays or therapeutic treatment, or in the case of in vitro assays, under conditions in which the assays are performed.
- the non-target sequences typically differ by at least 5 nucleotides.
- a dsRNA molecule is“sufficiently complementary” to a target RNA, e.g., a target mRNA, such that the dsRNA molecule silences production of protein encoded by the target mRNA.
- the dsRNA molecule is“exactly complementary” to a target RNA, e.g., the target RNA and the dsRNA duplex agent anneal, for example to form a hybrid made exclusively of Watson-Crick base pairs in the region of exact complementarity.
- a “sufficiently complementary” target RNA can include an internal region (e.g., of at least 10 nucleotides) that is exactly complementary to a target RNA.
- the dsRNA molecule specifically discriminates a single-nucleotide difference.
- the dsRNA molecule only mediates RNAi if exact complementary is found in the region (e.g., within 7 nucleotides of) the single-nucleotide difference.
- oligonucleotide refers to a nucleic acid molecule (RNA or DNA) for example of length less than 100, 200, 300, or 400 nucleotides.
- BNA refers to bridged nucleic acid, and is often referred as constrained or inaccessible RNA.
- BNA can contain a 5-, 6- membered, or even a 7-membered bridged structure with a“fixed” C3’-endo sugar puckering.
- the bridge is typically incorporated at the 2’-, 4’- position of the ribose to afford a 2’, 4’-BNA nucleotide (e.g., LNA, or ENA).
- BNA nucleotides include the following nucleosides:
- LNA refers to locked nucleic acid, and is often referred as constrained or inaccessible RNA.
- LNA is a modified RNA nucleotide.
- the ribose moiety of an LNA nucleotide is modified with an extra bridge (e.g., a methylene bridge or an ethylene bridge) connecting the 2' hydroxyl to the 4' carbon of the same ribose sugar.
- the bridge can “lock” the ribose in the 3'-endo North) conformation:
- the term ⁇ NA refers to ethylene-bridged nucleic acid, and is often referred as constrained or inaccessible RNA.
- The“cleavage site” herein means the backbone linkage in the target gene or the sense strand that is cleaved by the RISC mechanism by utilizing the iRNA agent. And the target cleavage site region comprises at least one or at least two nucleotides on both side of the cleavage site. For the sense strand, the cleavage site is the backbone linkage in the sense strand that would get cleaved if the sense strand itself was the target to be cleaved by the RNAi mechanism.
- the cleavage site can be determined using methods known in the art, for example the 5’-RACE assay as detailed in Soutschek et ah, Nature (2004) 432, 173-178, which is incorporated by reference in its entirety.
- the cleavage site region for a conical double stranded RNAi agent comprising two 21 -nucleotides long strands (wherein the strands form a double stranded region of 19 consecutive base pairs having 2-nucleotide single stranded overhangs at the 3’-ends)
- the cleavage site region corresponds to positions 9-12 from the 5’-end of the sense strand.
- “decrease”,“reduced”,“reduction”, or“inhibit” are all used herein to mean a decrease by a statistically significant amount.
- “reduce,”“reduction” or “decrease” or“inhibit” typically means a decrease by at least 10% as compared to a reference level (e.g.
- the absence of a given treatment can include, for example, a decrease by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99% , or more.
- “reduction” or“inhibition” does not encompass a complete inhibition or reduction as compared to a reference level. “Complete inhibition” is a 100% inhibition as compared to a reference level. A decrease can be preferably down to a level accepted as within the range of normal for an individual without a given disorder.
- immunoglobulin or“antibody” as used interchangeably herein refers to a basic 4-chain heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains. Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype. Each H and L chain has an N-terrmnus and a C-terminus, and also has regularly spaced intrachain disulfide bridges. Each H chain has at the N-terrmnus a variable domain (VH) followed by three constant domains (CHL CH2 and CH3).
- VH variable domain
- CHL CH2 and CH3 constant domain
- Each L chain has at the N-terminus a variable domain (VL) followed by one constant domain (CL).
- VL is aligned with the VH and the CL IS aligned with the first constant domain of the heavy chain (Ciil ).
- Particular amino acid residues are believed to form an interface between the L chain and H chain variable domains.
- the pairing of a VH and VL together forms a single antigen-binding site.
- the L chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains.
- immunoglobulins can be assigned to different classes or isotypes.
- immunoglobulins There are five classes of immunoglobulins: IgA, IgD, XgE, IgG, and IgM, having heavy chains designated a, 6, e, g, and m, respectively.
- the g and a classes are further divided into subclasses on the basis of relatively minor differences in CH sequence and function, e.g., humans express the following subclasses: IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2.
- The“variable region” or“variable domain” of an immunoglobulin refers to the N- termma! domains of the H or I, chain of the immunoglobulin.
- the variable domain of the H chain can be referred to as“VH”
- the variable domain of the light chain can be referred to as“VL.”
- variable refers to the fact that certain segments of the variable domains differ extensively in sequence among immunoglobulins.
- the V domain mediates antigen binding and defines specificity of a particular immunoglobulin for its particular antigen.
- variability is not evenly distributed across the 110-ammo acid span of most variable domains. Instead, the V regions consist of relatively invariant stretches called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called“hypervanahle regions” that are each 9-12 amino acids long.
- FRs framework regions
- variable domains of native H and L chains each comprise four FRs, largely adopting a b-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming pari of, the b-sheet structure.
- the hypervariable regions each chain are held together in close proximity by the FRs and, with the hypervanabie regions from the other chain, contribute to the formation of the an igen-bmding site of immunoglobulins (see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Se dee, National Institutes of Health, Bethesda, AID. (1991)).
- the constant domains are not involved directly in binding an immunoglobulin to an antigen, but exhibit various effector functions, such as participation of the immunoglobulin in antibody dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and complement-dependent cytotoxicity (CDC).
- ADCC antibody dependent cellular cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- CDC complement-dependent cytotoxicity
- An“intact” immunoglobulin is one that comprises an antigen-binding site as well as a CL and at least H chain constant domains, CH I , CH and CH3.
- the constant domains can be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variants thereof
- An intact immunoglobulin can have one or more effector functions.
- A“naked immunoglobulin” for the purposes herein is an immunoglobulin that is not conjugated to a dsRNA molecule.
- immunoglobulin fragments comprise a portion of an intact immunoglobulin, preferably the antigen binding or variable region of the intact immunoglobulin.
- immunoglobulin fragments include, but are not limited to, Fab, Fab’, Ftyb’ty and Fv fragments; diabodies; linear immunoglobulins (see U.S. Patent No. 5,641 ,870, Example 2; Zapata et al., Protein Eng. 8(10): 1057-1062 [ 1995]); single-chain immunoglobulin molecules; and multi specific immunoglobulins formed from immunoglobulin fragments.
- the immunoglobulin fragments include all possible alternate fragment formats.
- the immunoglobulin fragments may be bispecific. In some aspects, the immunoglobulin fragments may be bi-paratopic. In some aspects, the immunoglobulin fragments may be tri specific. In some aspects, the immunoglobulin fragments may be multimeric. In some aspects, an immunoglobulin fragment comprises an antigen binding site of the intact immunoglobulin and thus retains the ability to bind antigen. In some aspects, the immunoglobulin fragment contains single variable domains which have the ability to bind antigen. In some aspects, the immunoglobulin fragments are further modified (not limited to peptide addition, pegy!ation, hesylation, g!ycosy!ation) to modulate activity, properties, pharmacokinetic behavior and in vivo efficacy.
- Papain digestion of immunoglobulins produces two identical antigen-binding fragments, called“Fab” fragments, and a residual“Fc” fragment, a designation reflecting the ability to crystallize readily.
- the Fab fragment consists of an entire L chain along with the variable region domain of the H chain (VH), and the first constant domain of one heavy chain (CHI).
- VH variable region domain of the H chain
- CHI first constant domain of one heavy chain
- Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen -binding site.
- Pepsin treatment of an immunoglobulin yields a single large F(ab’)2 fragment which roughly corresponds to two disulfide linked Fab fragments having divalent antigen-binding activity and is still capable of cross-linking antigen.
- Fab’ fragments differ from Fab fragments by having additional few residues at the carboxy terminus of the CHI domain including one or more cysteines from the immunoglobulin hinge region.
- Fab’-SH is the designation herein for Fab’ in winch the cysteine residue(s) of the constant domains hear a free thiol group.
- F(ab’)2 immunoglobulin fragments originally were produced as pairs of Fab’ fragments which have hinge cysteines between them. Other chemical couplings of immunoglobulin fragments are also known.
- the Fc fragment comprises the carboxy-terminal portions of both H chains held together by disulfides.
- the effector functions of immunoglobulins are determined by sequences in the Fc region, which region is also the part recognized by Fc receptors (FcR) found on certain types of cells.
- FcR Fc receptors
- Fv is the minimum immunoglobulin fragment which contains a complete antigen- recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association.
- one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a“dimeric” structure analogous to that in a two-chain Fv species. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the immunoglobulin.
- six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the immunoglobulin.
- a single variable domain or half of an Fv comprising only three CDRs specific for an antigen
- the term“Fv” refers to a binding fragment that includes both the first and the second variable domains of the heavy chain and the light chain.
- Single-chain Fv also abbreviated as“sFv” or“scFv” are immunoglobulin fragments that comprise the Yu and Vi. immunoglobulin domains connected into a single polypeptide chain.
- the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding.
- the term“scFv” refers to a binding fragment that includes both the first and the second variable domains of the heavy chain and the light chain.
- the term“dual variable domain immunoglobulin” or“DVD-Ig” as used herein refers to an immunoglobulin molecule as described above, wherein both the H and L chains include a second variable domain located adjacent to the first variable domain.
- the L chain of a DVD-Ig therefore includes, from N-terminus to C-terminus, the following domains: VL1 -VL2-CL.
- the H chain of a DVD-Ig therefore includes, from N-terminus to C-terminus, the following domains: VHI - VH2-CH1 -CH2-CH3.
- the pairing of a ViJ and VH I together forms a first antigen-binding site.
- the pairing of a VL2 and VH2 together forms a second antigen binding site.
- immunoglobulin or “antibody” specifically includes native human and non-human IgGl, IgG2, IgG3, IgG4, IgE, IgAl, IgA2, IgD and IgM antibodies, including naturally occurring variants.
- the term “native” with reference to a polypeptide is used herein to refer to a polypeptide having a sequence that occurs in nature, regardless of its mode of preparation.
- the term“non-native” with reference to a polypeptide is used herein to refer to a polypeptide having a sequence that does not occur in nature.
- polypeptide is used herein in the broadest sense and includes peptide sequences.
- the term“peptide” generally describes linear molecular chains of amino acids containing up to about 30, preferably up to about 60 ammo acids covalently linked by peptide bonds.
- the term“monoclonal” as used herein refers to an antibody or immunoglobulin molecule (e.g., a DVD Ig molecule) obtained from a population of substantially homogeneous immunoglobulins, i.e., the individual immunoglobulins comprising the population are identical except for possible naturally occurring mutations that can be present in minor amounts. Monoclonal immunoglobulins are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional (polyclonal) antibody preparations which typically include different antibodies directed against different determinants (epitopes), each monoclonal immunoglobulin is directed against a single determinant on the antigen.
- the modifier “monoclonal” indicates the character of the immunoglobulin as being obtained from a substantially homogeneous population of immunoglobulins, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal immunoglobulins in accordance with the present invention can be made by the hybndoma method first described by Kohler and Mil stein (1975) Nature 256:495, or can be made by recombinant DNA methods (see, e.g., U.S. Patent No. 4,816,567).
- the monoclonal immunoglobulins herein specifically include “chimeric” immunoglobulins in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species, while the remainder of the cham(s) is identical with or homologous to corresponding sequences in antibodies derived from another species, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; and Morrison et al. (1984) Proc. Natl. Acad. Sci. USA 81 :6851-6855).
- “Humanized” forms of non-human (e.g., rodent, e.g., murine or rabbit) immunoglobulins are immunoglobulins which contain minimal sequences derived from non human immunoglobulin.
- humanized immunoglobulins are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, hamster, rabbit, chicken, bovine or non-human primate having the desired specificity, affinity, and capacity in some instances, Fv framework region (FR) residues of the human immunoglobulin are also replaced by corresponding non-human residues.
- donor antibody such as mouse, rat, hamster, rabbit, chicken, bovine or non-human primate having the desired specificity, affinity, and capacity in some instances
- Fv framework region (FR) residues of the human immunoglobulin are also replaced by corresponding non-human residues.
- humanized antibodies can comprise residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
- the humanized immunoglobulin will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
- the humanized immunoglobulin optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- human immunoglobulin is intended to include immunoglobulins having variable and constant regions derived from human germline immunoglobulin sequences.
- the human immunoglobulins of the invention can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3.
- the term“human immunoglobulin”, as used herein is not intended to include immunoglobulins in which CDR sequences derived from the germime of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- An“isolated” immunoglobulin herein is one w ? hich has been identified and separated and/or recovered from a component of its natural environment in a recombinant host cell. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the immunoglobulin, and can include enzymes, hormones, and other proteinaceous or nonprotemaceous solutes, as w r ell as undesired byproducts of the production.
- an isolated immunoglobulin herein will be purified (1) to greater than 95% by weight, or greater than 98% by weight, or greater than 99% by weight, as determined by SDS-PAGE or SEC-HPLC methods, (2) to a degree sufficient to obtain at least 15 residues of N-termmal or internal ammo acid sequence by use of an ammo acid sequencer, or (3) to homogeneity by SDS-PAGE under reducing or non-reducing conditions using Coomassie blue or, preferably, silver stain.
- an isolated immunoglobulin will be prepared by at least one purification step.
- the term“specific binding” or“specifically binds to” or is“specific for” refers to the binding of a binding moiety to a binding target, such as the binding of an immunoglobulin to a target antigen, e.g., an epitope on a particular polypeptide, peptide, or other target (e.g. a glycoprotein target), and means binding that is measurably different from a non-specific interaction (e.g., a non-specific interaction can be binding to bovine serum albumin or casein). Specific binding can be measured, for example, by determining binding of a binding moiety, or an immunoglobulin, to a target molecule compared to binding to a control molecule.
- specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-label ed target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target.
- the term“specific binding” or“specifically binds to” or is“specific for” a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by a molecule having a Kd for the target of at least about 2.00 nM, alternatively at least about 150 nM, alternatively at least about 100 nM, alternatively at least about 60 nM, alternatively at least about 50 nM, alternatively at least about 40 nM, alternatively at least about 30 nM, alternatively at least about 20 nM, alternatively at least about 10 nM, alternatively at least about 8 nM, alternatively at least about 6 nM, alternatively at least about 4 nM, alternatively at least about 2 nM, alternatively at least about 1 nM, or greater.
- the term“specific binding” refers to binding where a molecule binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other poly
- Binding affinity refers to the strength of the sum total of non covalent interactions between a single binding site of a molecule (e.g., an immunoglobulin) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein,“binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., immunoglobulin and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd).
- the Kd can be about 200 nM, 150 nM, 100 nM, 60 nM, 50 nM, 40 nM, 30 nM, 20 nM, 10 nM, 8 nM, 6 nM, 4 nM, 2 nM, 1 nM, or stronger.
- Affinity can be measured by common methods known the art, including those described herein. Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer. A variety of methods of measuring binding affinity are known in the art.
- the“Kd” or“Kd value” refers to a dissociation constant measured by a technique appropriate for the immunoglobulin and target pair, for example using surface plasmon resonance assays, for example, using a Biacore XI 00 or a Biacore T200 (GE Healthcare, Piscataway, N. J.) at 25°C with immobilized antigen CMS chips.
- the terms“conjugate,”“conjugated,” and“conjugation” refer to any and all forms of covalent or non-covalent linkage, and include, without limitation, direct genetic or chemical fusion, coupling through a linker or a cross-linking agent, and non-covalent association.
- the term“fusion” is used herein to refer to the combination of amino acid sequences of different origin in one polypeptide chain by in-frame combination of their coding nucleotide sequences.
- the term“fusion” explicitly encompasses internal fusions, i.e., insertion of sequences of different origin within a polypeptide chain, addition to fusion to one of its termini.
- the term “fusion” is used herein to refer to the combination of amino acid sequences of different origin
- epitope includes any molecular determinant capable of specific binding to an immunoglobulin.
- epitope determinants include chemically active surface groupings of molecules such as ammo acids, sugar side chains, phosphoryl, or sulfony!, and, m certain aspects, can have specific three dimensional structural characteristics, and/or specific charge characteristics.
- An epitope is a region of an antigen that is bound by an immunoglobulin.
- A“binding region” is a region on a binding target bound by a binding molecule.
- target or“binding target” is used in the broadest sense and specifically includes polypeptides, without limitation, nucleic acids, carbohydrates, lipids, cells, and other molecules with or without biological function as they exist in nature.
- antigen refers to an entity or fragment thereof, which can bind to an immunoglobulin or trigger a cellular immune response.
- An immunogen refers to an antigen, which can elicit an immune response in an organism, particularly an animal, more particularly a mammal including a human.
- antigen includes regions known as antigenic determinants or epitopes, as defined above.
- An“antigen-binding site” or“antigen-binding region” of an immunoglobulin of the present invention typically contains six complementarity determining regions (CDRs) within each variable domain, and which contribute in varying degrees to the affinity of the binding site for antigen.
- CDRHl, CDRH2 and CDRH3 three heavy chain variable domain CDRs
- CDRL1, CDRL2 and CDRL3 three light chain variable domain CDRs
- the extent of CDR and framework regions (FRs) is determined by comparison to a complied database of amino acid sequences in which those regions have been defined according to variability among the sequences and/or structural information from antibody /antigen complexes.
- the term“host cell” as used in the current application denotes any kind of cellular system which can be engineered to generate the immunoglobulins according to the current invention.
- Chinese hamster ovary (CHO) cells are used as host cells.
- E. coli are used as host ceils.
- the expressions “cell,” “cell line,” and“cell culture” are used interchangeably and all such designations include progeny.
- the words“transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that all progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Variant progeny that have the same function or biological activity as screened for in the originally transformed cell are included.
- a nucleic acid is“operably linked” when it is placed in a functional relationship with another nucleic acid sequence.
- DNA for a pre-sequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a pre-protein that participates in the secretion of the polypeptide;
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or
- a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
- operably linked means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading frame. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
- Percent (%) amino acid sequence identity with respect to a peptide or polypeptide sequence, i.e., the h38C2 antibody polypeptide sequences identified herein, is defined as the percentage of ammo acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent ammo acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- Treating” or“treatment” refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) a targeted pathologic condition or disorder.
- a subject or mammal is successfully“treated” for cancer, if, after receiving a therapeutic amount of a conjugate described herein, the subject shows observable and/or measurable reduction in or absence of one or more of the following: reduction in the number of cancer cells or absence of the cancer cells; reduction in the tumor size, inhibition (i.e., slowing to some extent and preferably stopping) of cancer cell infiltration into peripheral organs, including the spread of cancer into soft tissue and bone; inhibition (i.e., slowing to some extent and preferably stopping) of tumor metastasis; inhibition, to some extent, of tumor growth, and/or relief to some extent of one or more of the symptoms associated with the specific cancer; reduced morbidity and/or mortality , and improvement in quality' of life
- a“subject” means a human or animal. Usually the animal is a vertebrate such as a primate, rodent, domestic animal or game animal. Primates include chimpanzees, cynomologous monkeys, spider monkeys, and macaques, e.g., Rhesus. Rodents include mice, rats, woodchucks, ferrets, rabbits and hamsters.
- Domestic and game animals include cows, horses, pigs, deer, bison, buffalo, feline species, e.g., domestic cat, canine species, e.g., dog, fox, wolf, avian species, e.g., chicken, emu, ostrich, and fish, e.g., trout, catfish and salmon.
- the subject is a mammal, e.g., a primate, e.g., a human.
- the terms,“individual,”“patient” and“subject” are used interchangeably herein.
- the subject is a mammal.
- the mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, or cow, but is not limited to these examples. Mammals other than humans can be advantageously used as subjects that represent animal models of cancer.
- a subject can be male or female.
- a subject can be one who has been previously diagnosed with or identified as suffering from or having a condition in need of treatment (e.g. cancer) or one or more complications related to such a condition, and optionally, have already undergone treatment for cancer or the one or more complications related to cancer.
- a subject can also be one who has not been previously diagnosed as having cancer or one or more complications related to cancer.
- a subject can be one who exhibits one or more risk factors for cancer or one or more complications related to cancer or a subject who does not exhibit risk factors.
- A“subject in need” of treatment for a particular condition can be a subject having that condition, diagnosed as having that condition, or at risk of developing that condition.
- RNA interference enables the selective knockdown of any disease-related RNA-based factor making it a powerful strategy for the treatment of cancer.
- ARCs antibody-siRNA conjugates
- This strategy utilizes engineered dual-variable-domain antibodies (DVDs) containing a natural, highly reactive buried lysine residue to generate ARCs that are mutation free and site-specific.
- DVDs engineered dual-variable-domain antibodies
- Three exemplary DVDs were prepared against SLAMF7, BCMA, and CD138 for the targeting of multiple myeloma (MM) and conjugated with siRNA targeting b-catenin.
- the BCMA targeting ARC resulted in high b-catenin RNA and protein knockdown, thus validating the ARCs as an RNAi based approach for the treatment of cancer.
- ADC antibody-drug conjugate
- D dual-variable-domain antibodies composed of an outer variable light (VL) and heavy chain (VH) domain pair (Fv) that selectively targets a cell surface antigen of interest and an inner Fv derived from the anti -hapten mAh h38C2 which contains a uniquely reactive lysine (Lys) residue at the bottom of an 11 -A deep hydrophobic pocket. Due to its distinctive environment, this Lys is more nucleophilic (pKa ⁇ 6) and reacts specifically with b- lactam functionalized hapten derivatives.
- VL variable light
- VH heavy chain domain pair
- DVD-ADCs antibody-drug conjugates
- Figure 1A When made as IgGl, there are two binding sites (outer Fv) and two drug attachment sites (inner Fv) within one DVD molecule ( Figure 1A).
- the inventor used the DVD platform to generate highly homogeneous antibody-drug conjugates (ADCs) that potently and selectively killed tumor cells in vitro and in vivo.
- ADCs antibody-drug conjugates
- DVD-ADCs have several advantages including low immunogenicity and ease of conjugation in physiological conditions.
- the inventors selected multiple myeloma (MM), a hematologic malignancy characterized by aberrant growth of plasma cells in the bone marrow. 19 This indication was a suitable place to start as there are several established cell surface antigens expressed in MM that have been successfully targeted by ADCs in clinical trials. 7
- b-lactam hapten functionalized siRNAs (4 and 5) targeting human b-catenin (CTNNBl) mRNA were synthesized.
- CTNNBl was chosen as the target gene because it is overexpressed in MM. 25 ⁇ 26
- the b-lactam hapten functionality serves as the reactive handle to conjugate the siRNA to the uniquely reactive Lys residue contained in the inner Fv of the DVD- IgGls.
- Two compounds were prepared targeting CTNNBl : an siRNA with the b-lactam hapten handle at the 3’ end ( Figure 2, compound 4) and an siRNA with the b-lactam hapten handle at the 5’ end ( Figure 2, compound 5) of the passenger (sense) strand.
- the passenger strand was modified with the b-lactam hapten handle in all cases so RISC complex formation would not be effected.
- two control siRNAs were synthesized as negative controls.
- One compound is an siRNA targeting human transthyretin (TTR), an irrelevant gene in this study, with a b-lactam hapten handle at the 3’ end ( Figure 2, compound 6) and the other compound is an mRNA targeting CTNNBl that lacks the b-lactam hapten moiety ( Figure 2, compound 7) Error ⁇ Bookmark not defined.
- this work provides a method that generates site-specific ARCs using engineered DVDs that are mutation free and rely on rapid conjugation chemistry under neutral conditions.
- the generated ARCs retain binding towards the target antigen and successfully induce mRNA and protein knockdown in target cancer cells.
- Antibody cloning, expression, and purification All variable domain sequences were based on published or patented amino acid sequences. All DVD-IgGs (1-3) were prepared as previously described. 28 DVD-IgGls were prepared by linking the VH and VL of the targeting domain (anti-SLAMF7, BCMA, or CD138) to the VH and VL of h38C2 via a short (ASTKGP; the N-terminal 6 amino acids of human CHI) spacer. The desired sequences were synthesized as gBlocks (Integrated DNA Technologies) and expressed with human IgGl heavy chain and k light chain constant domains.
- the DVD expression cassettes were Nhel/BamHI-cloned into a mammalian expression vector 29 and transiently transfected into Expi293F cells using Expifectamine according to the manufacturer’s instructions (Life Technologies). After 5-7 days, the media was collected, filtered through a 0.22 micron filter, and purified using 1-mL HiTrap Protein A HP columns (GE Healthcare) in conjunction with an AKTA FPLC instrument (GE Healthcare). Yields were typically ⁇ 40 mg/L. The purity of DVDs was confirmed by SDS-PAGE followed by Coomassie staining, and the concentration was determined by measuring the absorbance at 280 nm. The following protein sequences were prepared.
- Anti-BCMA DVD-IgGl (2) [00506] Anti-BCMA DVD-IgGl (2):
- Anti-HER2 DVD-IgGl
- Flow cytometry In a V-bottom 96-well plate (Coming), 100,000 cells per well were dispensed. The cells were washed with 200 pL flow cytometry buffer (PBS, 2% (v/v) FBS, 0.01% (w/v) NaN3, pH 7.4), incubated with DVD-IgGl or IgGl (50 pL of a 20 nM solution in PBS) for 30 min on ice, washed with 200 pL ice-cold flow cytometry buffer, and stained with Alexa Fluor 647 conjugated polyclonal (Fab’)2 donkey anti-human Fc (Jackson ImmunoResearch Laboratories) for 20 min on ice. After washing twice with 200 pL ice-cold flow cytometry buffer, the cells were analyzed using a Canto II Flow Cytometer (Becton-Dickinson). Data were analyzed using FlowJo software (Tree Star).
- Antibody conjugation Conjugations in Figure 3 were performed in PBS (pH 7.4) after the antibodies were diluted to 15.7 mM (3.13 mg/mL). Next, 16.3 pL (2.75 mM H2O solution of compound 4 shown in Figure 2; 10 eq) or 19.8 pL (2.27 mM H2O solution of compound 5 shown in Figure 2; 10 eq) of b-lactam-siRNA was added to 900 pg of each antibody (1-3).
- Control anti-BCMA ARC 14 was prepared by diluting the anti-BCMA DVD to 4.08 mg/ml (20.4 pM), dispensing 2.0 mg, and adding 38 pL (2.59 mM H2O solution of compound 6; 10 eq) of b-lactam-siRNA.
- the anti-HER2 ARCs (15 and 16) were prepared by diluting the anti-HER2 DVD to 4.47 mg/ml (22.4 pM), dispensing 2.0 mg, and adding 36 pL (2.75 mM H2O solution of compound 4 or 5; 10 eq) of b-lactam-siRNA. The solutions were incubated for 2 h at room temperature (rt).
- the anti-BCMA DVD was concentrated to 50.0 (10 mg/ml) using a 30-kDa cutoff centrifugal filter device (Millipore).
- 2 eq of b-lactam-siRNA was added using a 2.75 mM solution of compound 4 or a 2.27 mM solution of compound 5.
- the solutions were incubated for 4 h at room temperature (rt). All conjugations were deemed complete by loss of catalytic activity using the methodol assay for which a portion of the crude reaction diluted to 1 pM in PBS was used.
- unreacted compound was removed by using a PD- 10 desalting column (GE Healthcare).
- Protein containing fractions were concentrated using a 4-ml 30-kDa cutoff centrifugal filter device (Millipore) and washed with ⁇ 4 ml of PBS (x3). During the last wash, the samples were concentrated to a final volume of -250 pL.
- concentration of the ARCs was determined using a BCA Assay kit (Thermo Fisher Scientific) according to the manufacturer’s instructions with bovine gamma globulin (Thermo Fisher Scientific) as standard.
- DVD-Fab conjugation 2.0 mg of the anti-BCMA DVD-Fab was diluted to 7 mg/ml (100 pM) and 21.0 pL (2.75 mM H2O solution of compound 4 or 5 shown in Figure 2; 2 eq) of b-lactam-siRNA was added. The solutions were incubated for 4 h at room temperature (rt) and purified as described previously. All conjugates were stored in PBS at 4 °C.
- SPR Surface Plasmon Resonance
- Each sensor chip included an empty flow cell for instantaneous background depletion. All binding assays used 1 x HBS-EP + running buffer (10 mM Hepes, 150 mM NaCl, 3 mM EDTA (pH 7.4), and 0.05% (v/v) Surfactant P20) and a flow rate of 30 pL/min. For affinity measurements, the anti-BCMA DVV-Fab or ARCs were injected at five different concentrations, one of which was tested in duplicate. The sensor chips were regenerated with 3 M MgCh from the Human Antibody Capture Kit without any loss of binding capacity. Calculation of association (fen) and dissociation (feff) rate constants was based on a 1 : 1 Langmuir binding model. The equilibrium dissociation constant (fei) was calculated from fee/fe n ..
- SEC Size-Exclusion Chromatography
- Thermo Fisher RIPA Lysis Buffer
- Thermo Fisher protease inhibitor cocktail
- Thermo Fisher Thermo Fisher 7 days later, the cells were washed with PBS and lysed using RIPA Lysis Buffer (Thermo Fisher) containing protease inhibitor cocktail (Thermo Fisher).
- the samples were diluted with 1 c NuPAGE LDS sample buffer (Thermo Fisher) containing 2% (v/v) b-mercaptoethanol and boiled for 5 min before running on NuPAGE Novex 4%-12% Bis-Tris gels (Thermo Fisher).
- the membrane was washed with TBST followed by incubation with a 1 :5000 dilution (5% (v/v) western blot blocking in TBST) of HRP-conjugated goat anti-mouse IgG (Biolegend, Cat# 405306) at room temperature for 3h before washing with TBST and development using ECL Prime Western Blotting Detection Reagent (GE Healthcare).
- the membrane was incubated with a 1 : 10,000 dilution (5% (v/v) western blot blocking in TBST) of monoclonal mouse anti ⁇ -actin peroxidase (Sigma Aldrich, Clone AC-15, Cat# A3854) at 4 °C overnight, washed with TBST, then imaged using ECL Prime Western Blotting Detection Reagent (GE Healthcare).
- Duplex 5 ( Figure 2) was prepared analogously from 15 and 17 followed by annealing with 22.
- Negative control (hTTR) duplex 7 ( Figure 2) was prepared analogously from 15 and 18 followed by annealing with the corresponding antisense strand (23). Unconjugated control siRNA 6 was prepared by annealing of 17 with 22. For details on automated synthesis of oligonucleotides 16, 17, 18, 22, 23, and analytical data for all oligonucleotides 16-23 see below.
- Catalytic activity assay Catalytic activity was analyzed using methodol Err0r! Bookmark not defined. as described previously. 30 DVD-IgGs, IgGls, and ARCs were diluted to 1 mM in PBS (pH 7.4) and dispensed in 98-pl aliquots into a 96-well plate in triplicate.
- Cell lines Human MM cell lines U-266, NCI-H929, and RPMI-8226 were obtained from American Type Culture Collection (ATCC) and cultured in RPMI 1640 medium, supplemented with 10% FBS, 100 pg/mL streptomycin, and 100 U/mL penicillin at 37°C in an atmosphere of 5% CCh and 100% humidity.
- Expi293F cells were grown in Expi293 Expression media (Life Technologies, Carlsbad, CA) at 37°C in an atmosphere of 8% CCh and 100% humidity.
- RNA from cell lysates was performed using Qiagen RNeasy kit (Qiagen) followed by cDNA synthesis of 1 pg DNase- digested RNA, using the Maxima First-Strand cDNA Synthesis Kit for quantitative RT-PCR (Invitrogen) according to the manufacturer’s instructions.
- Quantitative PCR of the synthesized cDNA was conducted using SYBR Green PCR Master Mix (Applied Biosystems) according to the manufacturer’s protocol.
- qRT-PCR reactions were performed on StepOnePlus Real-Time PCR System (Applied Biosystems) and analyzed using StepOne Software v2.2.2. All measurements were conducted three times using biological duplicates or triplicates and standardized to the levels of b-actin. Relative changes in gene expression were calculated according to the 2 AAtT algorithm. 31
- oligonucleotide 16 the inventors placed a N-(aminocaproyl)prolinol-4-phosphate modification at the 5’ end, where the amine was protected with a TFA group.
- the oligo was cleaved and deprotected in 50/50 v/v solution of AMA: Aq. ammonia (30% wt/v) and Aq. methylamine (40% wt/v) for 3 hrs at R.T.
- Oligonucleotides 17 and 18 had a similar N- (aminocaproyl)-4-hydroxyprolinol modification at the 3’ terminus, which was introduced on the CPG support. This was also TFA protected and cleaved the same way.
- Oligonucleotides 22 and 23 have a 5’-(E)-vinylphosophonate 2’ N-methylacetamide 5’-methyluridine monomer, which was introduced and cleaved using previously published protocols. 34
- siRNA samples were analyzed for purity, endotoxin, and osmolality, and the observed values were within the allowed range for the concentration tested.
- Analytical data for b-lactam-conjugated single strands 19, 20, and 21 Reverse phase LC/MS analyses of b-lactam conjugates 19, 20, and 21 was carried out using an Agilent 6130 Quadrupole LC/MS connected to an Agilent 1260 Infinity HPLC system. Standard oligonucleotide LC conditions were used with a column temperature of 60 °C and 95 mM of HFIP and 16 mM TEA in water as a mobile phase A and MeOH as a mobile phase B.
- the inventors observed an apparent shoulder before the main peak of the butylamine adduct that showed the same mass of the adduct, and which formation was attributed to change in composition of the cationic butylamine bound to siRNA during a run.
- MALDI analysis of conjugates 19, 20, and 21 MALDI mass spectra were collected using a Bruker Microflex LRF MALDI mass spectrometer. Samples were analyzed in the linear positive ion mode, with 500 laser shots collected at random across each sample spot and summed using the automated sample collection mod.
- MALDI Sample Preparation After the reaction of sense strands 16, 17, and 18 with bis ⁇ -lactam compound 15, the solutions of siRNA conjugates 19, 20, and 21 in water in concentration of ⁇ 3 mg/mL were used for MALDI analysis. Matrix solutions were prepared as saturated solutions and used within 1 day. A 50 mg/mL solution of diammonium citrate in deionized water and a solution of 10 mg of THAP in 1.0 mL acetonitrile - deionized water (1 : 1, v/v) were separately prepared, combined in 1 :8 ratio, and vortexed to obtain the matrix prior to analysis.
- Conjugate 19 MS calc for [M + H + ] 7799.47, observed 7800.79; [M + Na + ] calc. 7821.45, observed 7823.56.
- Conjugate 20 MS calc for [M + H + ] calc. 7768.35, observed 7769.62; [M + Na + ] calc. 7790.33, observed 7791.84; [M] as Na salt + Na + ([M - H + + 2Na + ]) calc. 7812.31, observed 7813.70.
- Conjugate 21 MS calc for [M + H + ] 7790.41, observed 7792.21.
- Double-stranded RNAs comprising b-lactam-conjugated strands:
- the b-lactam conjugated strands were annealed with complementary strands using a low temperature duplex annealing.
- the duplexes were annealed by lyophilization as follows.
- the purified b-lactam sense strand as an aqueous solution was analyzed by UV spectrophotometry to obtain an exact concentration.
- a subsequent equimolar amount of anti- sense strand was added at a concentration of 20-100 mg/mL in water.
- the combined strands were vortexed for 30 seconds and centrifuged to the bottom of a conical tube.
- the strands were frozen on dry ice and lyophilized to a powder during which the two strands anneal to each other.
- the monoclonal antibody nBT062 conjugated to cytotoxic Maytansinoids has selective cytotoxicity against CD138-positive multiple myeloma cells in vitro and in vivo.
- Clinical cancer research an official journal of the American Association for Cancer Research 2009, 15, 4028-4037.
- MM Human multiple myeloma (MM) cell lines NCI-H929 and MM. IS were purchased directly from American Type Culture Collection (ATCC), and subsequently cultured in RPMI-1640 medium that was supplemented with 10% (v/v) FBS, 100 pg/mL streptomycin, and 100 U/mL penicillin (Thermo Fisher Scientific) at 37 °C, 5% CO2 and 100% humidity. In addition, Expi293F cells for antibody production were grown in Expi293 Expression Medium (Thermo Fisher Scientific) at 37 °C, 8% CO2 and 100% humidity.
- BCMA Antigen expression The BCMA sequence was obtained from NCBI GenBank (accession # NM_001192). Subsequently, Fc-BCMA was cloned, expressed, followed by purification and biotinylation as described in previous literature (Peng et al, 2017).
- Anti-BCMA antibodies were selected via phage display from a previously described (Peng et al., 2017) naive chimeric rabbit/human library against biotinylated Fc-BCMA with a total of four rounds of panning. Briefly, streptavidin-coated magnetic beads (Dynabeads My One Streptavidin Cl, Thermo Fisher) were incubated with the biotinylated antigen, and subsequently employed to competitively select anti-BCMA antibodies from the phage library as described previously (Peng et al., 2017). Polyclonal human IgG (Pierce) was added during each round of panning as decoy at a concentration of 5 pg/pL. Multiple clones tested positive by ELISA against Fc-BCMA after selection. Upon further analysis via DNA fingerprinting and sequencing, these clones revealed only one unique kappa clone (VOOl) against Fc-BCMA.
- VEOl unique kappa clon
- Fab cloning, expression and purification The selected chimeric rabbit/human clone VOOl (in bacterial vector pC3C) or humanized VOOl (hVOOl) Fab was cloned into pETl la using the restriction enzyme Sfil, and transformed into E. coli strain Rosetta (DE3) (EMD Millipore) and cultured in autoinduction media. The Fab protein was purified from the supernatant with CaptureSelect CHI -XL pre-packed column, and purity was analyzed via SDS- PAGE and Coomassie staining of both reduced and non-reduced Fabs. Yields generated were in the range of 1-5 mg/L of culture media. Amino acid sequences of VOOl and hVOOl Fab are displayed in the order variable light chain (VL) followed by variable heavy chain (VH) domain.
- VL variable light chain
- VH variable heavy chain
- VOOl Fab VH QEQLEESGGRLVTPGTPLTLTCTVSGFSLSNYHMSWVRQAPGKGLEWIGFITSGG STYYASWAKGRFTISRTSTTVDLKITSPTTEDTATYFCARWNGYGGNMWGPGTL VTVSS (SEQ ID NO: 12) hVOOl Fab VL:
- variable domain encoding cDNA sequence of h38C2 was PCR-amplified from VOOl x (h38C2)2 and the constant domains (Cp2- Cp3-Cp4) of the heavy chain of human IgM were cloned from a previously published plasmid (Vire et al, 2014).
- the h38C2 IgM (light and heavy chains) was assembled by overlap extension PCR and Nhel/BamHI-cloned into previously described mammalian expression vector (Gardner et al, 2016).
- VOOl x (h38C2)2 IgGl and VOOl/hVOOl x h38C2 DVD-IgMs was confirmed by nonreducing and reducing SDS-PAGE followed by Coomassie blue staining, and the concentration was determined by measuring the absorbance at 280 nm and BCA assay.
- VOOl x fh38C2E IgGl (1) VOOl VL-(G4S) 3 -VH-hmge-CH2-CH3 (holes):
- Antibody conjugation Conjugations were performed in PBS (pH 7.4) after the various IgMs constructs were diluted to 10 mg/mL (10.5 mM). In general, 10 pL of 3 mM beta lactam linker functionalized siRNA in H2O (13.5 eq) was added to 2 mg of each IgM construct. The mixture was incubated overnight at 4 °C. As for VOOl x (h38C2)2 IgG bio-conjugation, 5 equivalents (eq) of lactam linker-functionalized siRNA was added using 5 pL of 3 mM siRNA in H2O and incubated with 1 mg of IgG (11.4 mM) for 4 h at RT.
- ARCs antibody-siRNA conjugates obtained after SEC were then concentrated using a 15-mL Millipore Ultra-15 30-kDa cut-off Centrifugal Filter Unit, washed with 4 mL of PBS three times, and were concentrated to a final volume of about 250 pL. The concentration of the ARCs was measured with a BCA assay, using BSA as standard. The samples were loaded on a NuPAGE Novex Bis-Tris 4-12% gradient gel in SDS-PAGE Sample Buffer, and the gel was stained with Coomassie blue followed by washing to determine the purity.
- Size-exclusion chromatography The AKTA FPLC instrument was utilized to perform SEC by installing a Superdex® 200 10/300 GL column (GE Healthcare) for separation. During analytical runs, 15 pg (not exceeding 200 pL) of sample was loaded into the loop and analyzed under a flow rate of 0.5 mL/min in PBS and at a wavelength of 280 nm. As for actual ARC purification, 1-2 mg of ARC (not exceeding 700 pL) was loaded and passed through the SEC column, with the desired ARC peak separated from the free siRNA that was not conjugated. Exemplary results are shown in Fig. 18.
- Catalytic activity assay The methodol assay was employed to detect the catalytic activity of unreacted reactive lysine within the h38C2 fragment within the antibody after conjugation as described previously (Nanna et al, 2017; Nanna and Rader, 2019). Both antibodies and ARCs were made up to a concentration of 1 pM in PBS (pH 7.4) and a volume of 98 pL, before aliquoting them into a 96-well plate with triplicates of each sample. Subsequently, 2 pL of 10 mM methodol in ethanol was added and the fluorescence was determined using a SpectraMax M5 instrument (Molecular Devices) with SoftMax Pro software.
- the excitation wavelength (ext) was set to 330 nm, while the emission wavelength (em) was calibrated to 452 nm, starting at time point of 0 min while obtaining data at 5-min intervals. Finally, all data were normalized to the data set of 98 pL PBS with 2 pL of the methodol solution added.
- Flow cytometry During the process of flow cytometry, 100,000 cells were dispensed in each well of a V-bottom 96-well plate (Coming) and washed with 150 pL of flow cytometry buffer (PBS, 2% (v/v) FBS, 0.01% (w/v) NaN3, pH 7.4). Subsequently, the cells were incubated with the antibodies (200 nM in 50 pL PBS) for 1 h on ice, followed by 3 rounds of washing (200 pL flow buffer).
- PBS flow cytometry buffer
- the cells were stained with R-Phycoerythrin AffiniPure F(ab’)2 Fragment Goat Anti-Human IgG, F(ab’)2 fragment specific (for Fabs and IgGl or IgGl ARCs), or R-Phycoerythrin AffiniPure F(ab’)2 Fragment Donkey Anti-Human IgM, Fey, fragment specific (IgM or IgM ARCs) purchased from Jackson ImmunoResearch Laboratories for 30 min on ice. After 3 rounds of washing, the cells were passed through a BD FACSCantoTM II and the data were extracted and analyzed via FlowJo software. Exemplary results are shown in Fig. 18.
- SPR Surface plasmon resonance
- RT-qPCR To analyze mRNA knockdown by RT-qPCR, 500 pL of cells (200,000 cells per well) were dispensed in a 12-well cell culture dish initially. Subsequently, 500 pL of VOOl x (h38C2)2 IgGl, IgGl ARCs, VOOl/hVOOl x h38C2 IgM, and its corresponding ARCs were diluted with RPMI 1640 medium (10% (v/v) FBS supplemented with 100 pg/ml streptomycin and 100 U/ml penicillin) was immediately added to the desired concentrations.
- RPMI 1640 medium 10% (v/v) FBS supplemented with 100 pg/ml streptomycin and 100 U/ml penicillin
- Free IRF4 siRNA was diluted to 18 pM in 50 pL of Opti-MEM medium, and subsequently added to a mixture of 3 pL of Lipofectamine RNAiMAX Transfection Reagent (Thermo Fisher Scientific) in 47 pL of Opti-MEM following the manufacturer’s instructions. After 5-min incubation at RT, 100 pL of this mixture was added to cells (200,000 cells per well), and finally made up to 1 mL with RPMI 1640 medium (final siRNA concentration of 1.8 pM).
- RNA from cell lysates was performed using the RNeasy Mini Kit (Qiagen) followed by cDNA synthesis of 1 pg DNase-digested RNA, using the Maxima First-Strand cDNA Synthesis Kit for RT-qPCR (Invitrogen) according to the manufacturer’s instructions.
- qPCR of the synthesized cDNA was performed using the SYBR Green PCR Master Mix (Thermo Fisher Scientific) according to the manufacturer’s instructions, performed on an Applied Biosystems’ StepOnePlus Real-Time PCR System, and analyzed using StepOne Software v2.2.2 (both from Thermo Fisher Scientific). All measurements were conducted three times using biological duplicates or triplicates and standardized to the levels of b-actin.
- AAACTCCGGATGGCCTCAT-3’ (SEQ ID NO: 50)]; Actin Forward: [5’-
- Free IRF4 siRNA was diluted to 18 pM in 50 pL of Opti-MEM medium, and subsequently added to a mixture of 3 pL of Lipofectamine RNAiMAX Transfection Reagent (Thermo Fisher Scientific) in 47 pL of Opti-MEM following the manufacturer’s instructions. After 5 min incubation at RT, 100 pL of this mixture was added to the cells (200,000 cells per well), and finally made up to 1 mL with RPMI 1640 medium (final siRNA concentration of 1.8 pM).
- Thermo Fisher Scientific RIPA Lysis Buffer (Thermo Fisher Scientific) containing a protease inhibitor cocktail and EDTA (Thermo Fisher Scientific).
- the samples were diluted with l x NuPAGE LDS sample buffer (Thermo Fisher Scientific) containing 2% (v/v) b-mercaptoethanol and boiled at 100 °C for 5 min before running on NuPAGE Novex 4-12% Bis-Tris gels (Thermo Fisher Scientific). After transfer to a poly vinyli dene difluoride (PVDF) membrane (Millipore) and blocking with 10% (v/v) Western Blocking Reagent (Thermo Fisher, cat. no.
- PVDF poly vinyli dene difluoride
- the PVDF membrane was washed with TBST followed by incubation with a 1 : 10,000 dilution (10% (v/v) Western Blocking Reagent in TBST) of Peroxidase AffmiPure Goat Anti-Rabbit IgG (H+L) polyclonal antibody (Jackson ImmunoResearch Laboratories, cat. no. 111-035-144) at RT for 1 h before washing with TBST and development using ECL Prime Western Blotting Detection Reagent (GE Healthcare). The membrane was stripped thereafter and re-stained for housekeeping protein b-actin after blocking.
- the membrane was incubated with a 1 : 10,000 dilution (10% (v/v) Western Blocking Reagent in TBST) of peroxidase-conjugated mouse anti-human b-actin mAh AC-15 (Sigma Aldrich, cat. no. A3854) at 4 °C overnight, washed with TBST, and then imaged using ECL Prime Western Blotting Detection Reagent. ImageJ software was used for quantification. Exemplary results are shown in Fig. 21. [00560] Cytotoxicity assay: To determine the cytotoxicity of the various antibody constructs and siRNA, NCI-H929 or MM.
- IS cells were plated in 96-well plates at 2 c 10 4 cells per well initially in 50 pL. Subsequently, serial dilutions of unconjugated antibody and ARCs were added to the cells at concentrations ranging from 11.3 to 360 nM.
- Free IRF4 siRNA was diluted to 5.4 mM in 5 pL of Opti-MEM medium, and subsequently added to a mixture of 0.3 pL of Lipofectamine RNAiMAX Transfection Reagent (Thermo Fisher Scientific) in 4.7 pL of Opti- MEM following the manufacturer’s instructions.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Biophysics (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/621,029 US20230049529A1 (en) | 2019-06-21 | 2020-06-18 | Modified double stranded oligonucleotide |
| CA3138627A CA3138627A1 (en) | 2019-06-21 | 2020-06-18 | Structurally defined sirna-dual variable domain immunoglobulin conjugates |
| JP2021576064A JP7785543B2 (ja) | 2019-06-21 | 2020-06-18 | 構造的に明確なsiRNA-二重可変ドメイン免疫グロブリンコンジュゲート |
| EP20826493.7A EP3986475A4 (en) | 2019-06-21 | 2020-06-18 | Structurally defined sirna-dual variable domain immunoglobulin conjugates |
| AU2020295485A AU2020295485A1 (en) | 2019-06-21 | 2020-06-18 | Structurally defined siRNA-dual variable domain immunoglobulin conjugates |
| JP2025225443A JP2026041866A (ja) | 2019-06-21 | 2025-12-03 | 構造的に明確なsiRNA-二重可変ドメイン免疫グロブリンコンジュゲート |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962864755P | 2019-06-21 | 2019-06-21 | |
| US62/864,755 | 2019-06-21 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020257483A1 true WO2020257483A1 (en) | 2020-12-24 |
Family
ID=74040502
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/038475 Ceased WO2020257483A1 (en) | 2019-06-21 | 2020-06-18 | Structurally defined sirna-dual variable domain immunoglobulin conjugates |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20230049529A1 (https=) |
| EP (1) | EP3986475A4 (https=) |
| JP (2) | JP7785543B2 (https=) |
| AU (1) | AU2020295485A1 (https=) |
| CA (1) | CA3138627A1 (https=) |
| WO (1) | WO2020257483A1 (https=) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113512557A (zh) * | 2021-04-15 | 2021-10-19 | 山西大学 | 飞蝗脱水抗性基因LmDesi及其dsRNA的应用 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20170275626A1 (en) * | 2014-08-20 | 2017-09-28 | Alnylam Pharmaceuticals, Inc. | Modified double-stranded rna agents |
| US20180250415A1 (en) * | 2015-09-17 | 2018-09-06 | The Scripps Research Institute | Dual variable domain immunoconjugates and uses thereof |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP4851940B2 (ja) * | 2004-11-19 | 2012-01-11 | 宮城県 | がんまたは糖尿病治療のための医薬組成物 |
| US20110223665A1 (en) * | 2008-07-25 | 2011-09-15 | Alnylam Pharmaceuticals, Inc. | ENHANCEMENT OF siRNA SILENCING ACTIVITY USING UNIVERSAL BASES OR MISMATCHES IN THE SENSE STRAND |
| CA3049133A1 (en) * | 2017-01-18 | 2018-07-26 | Alnylam Pharmaceuticals, Inc. | Endosomal cleavable linkers |
-
2020
- 2020-06-18 CA CA3138627A patent/CA3138627A1/en active Pending
- 2020-06-18 JP JP2021576064A patent/JP7785543B2/ja active Active
- 2020-06-18 WO PCT/US2020/038475 patent/WO2020257483A1/en not_active Ceased
- 2020-06-18 US US17/621,029 patent/US20230049529A1/en active Pending
- 2020-06-18 AU AU2020295485A patent/AU2020295485A1/en active Pending
- 2020-06-18 EP EP20826493.7A patent/EP3986475A4/en active Pending
-
2025
- 2025-12-03 JP JP2025225443A patent/JP2026041866A/ja active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20170275626A1 (en) * | 2014-08-20 | 2017-09-28 | Alnylam Pharmaceuticals, Inc. | Modified double-stranded rna agents |
| US20180250415A1 (en) * | 2015-09-17 | 2018-09-06 | The Scripps Research Institute | Dual variable domain immunoconjugates and uses thereof |
Non-Patent Citations (2)
| Title |
|---|
| ADDEPALLI ET AL.: "Modulation of thermal stability can enhance the potency of siRNA", NUCLEIC ACIDS RES., vol. 38, no. 20, November 2010 (2010-11-01), pages 7320 - 7331, XP055001288, DOI: 10.1093/nar/gkq568 * |
| See also references of EP3986475A4 * |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3986475A4 (en) | 2023-07-12 |
| JP2022538404A (ja) | 2022-09-02 |
| AU2020295485A1 (en) | 2021-12-23 |
| US20230049529A1 (en) | 2023-02-16 |
| JP2026041866A (ja) | 2026-03-10 |
| EP3986475A1 (en) | 2022-04-27 |
| CA3138627A1 (en) | 2020-12-24 |
| JP7785543B2 (ja) | 2025-12-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN110770255B (zh) | 具有受限cd3结合的多特异性多肽构建体及其使用方法 | |
| TWI564306B (zh) | 雙特異性抗體 | |
| JP5671531B2 (ja) | 二重特異性抗体および治療剤または診断剤と結合体化したジゴキシゲニンの複合体 | |
| JP7269167B2 (ja) | モジュラー四価二重特異性抗体プラットフォーム | |
| Hong et al. | Chemoenzymatic Synthesis of a Rhamnose‐Functionalized Bispecific Nanobody as a Bispecific Antibody Mimic for Cancer Immunotherapy | |
| CN112218686A (zh) | 具有受限cd3结合的多特异性多肽构建体以及相关方法和用途 | |
| JP2022530524A (ja) | バイパラトピックFR-α抗体及びイムノコンジュゲート | |
| AU2021219676B2 (en) | Tandem repeat cancer-targeting peptides for molecular conjugation or engineering and uses thereof in cancer theranostics | |
| JP2026041866A (ja) | 構造的に明確なsiRNA-二重可変ドメイン免疫グロブリンコンジュゲート | |
| WO2023050826A1 (en) | Immunoconjugates containing tnf-alpha and related methods and compositions thereof | |
| CN113825772B (zh) | 抗her2亲合体及将其用作开关分子的可切换嵌合抗原受体 | |
| WO2017049139A2 (en) | Dual variable domain immunoconjugates and uses thereof | |
| EP3735254A1 (en) | Multi-specific ligand binders | |
| WO2024199269A1 (en) | Immunoconjugates containing tnf-alpha and related methods and compositions thereof | |
| JPWO2022159984A5 (https=) | ||
| CN121013865A (zh) | 抗cd180结合分子及其用途 | |
| US12286487B2 (en) | Antibody compounds with reactive arginine and related antibody drug conjugates | |
| US20250312472A1 (en) | Antibody compounds with reactive cysteine and related antibody drug conjugates | |
| CN111133104A (zh) | 通过模板化组装生成结合到识别分子的表位的方法 | |
| WO2026057723A1 (en) | Claudin-1/egfr bispecific antibodies for targeted degradation | |
| WO2023247731A1 (en) | Ror1/ptk7 bi-specific antigen binding molecules |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20826493 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3138627 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2021576064 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020295485 Country of ref document: AU Date of ref document: 20200618 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2020826493 Country of ref document: EP |