WO2020239558A1 - Combination therapies using cdk inhibitors - Google Patents
Combination therapies using cdk inhibitors Download PDFInfo
- Publication number
- WO2020239558A1 WO2020239558A1 PCT/EP2020/064024 EP2020064024W WO2020239558A1 WO 2020239558 A1 WO2020239558 A1 WO 2020239558A1 EP 2020064024 W EP2020064024 W EP 2020064024W WO 2020239558 A1 WO2020239558 A1 WO 2020239558A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- agonist
- cancer
- binding antagonist
- pharmaceutically acceptable
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- AHJRHEGDXFFMBM-UHFFFAOYSA-N CC(C(C(N1C2CCCC2)=O)=C(C)c2c1nc(Nc(cc1)ncc1N1CCNCC1)nc2)=O Chemical compound CC(C(C(N1C2CCCC2)=O)=C(C)c2c1nc(Nc(cc1)ncc1N1CCNCC1)nc2)=O AHJRHEGDXFFMBM-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the .txt file contains a sequence listing entitled "PC72481ApctSEQLISTING_ST25.txt” created on April 15, 2020 and having a size of 22 KB.
- the sequence listing contained in this .txt file is part of the specification and is herein incorporated by reference in its entirety.
- the present invention relates to combination therapies useful for the treatment of cancers.
- the invention relates to combination therapies which comprise administering a CDK inhibitor or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition comprising such compounds or salts, in combination with a PD-1 axis binding antagonist, and optionally an 0X40 agonist and/or a 4-1 BB agonist.
- the invention also relates to associated methods of treatment, pharmaceutical compositions, and pharmaceutical uses. The methods and compositions are useful for any indication for which the therapeutic is itself useful in the detection, treatment and/or prevention of a disease, disorder, or other condition of a subject.
- Cyclin dependent kinases are important cellular enzymes that perform essential functions in regulating eukaryotic cell division and proliferation.
- the cyclin dependent kinase catalytic units are activated by regulatory subunits known as cyclins. At least sixteen mammalian cyclins have been identified (Johnson DG, Walker CL., Cyclins and Cell Cycle Checkpoints. Annu. Rev. Pharmacol. Toxicol. 1999, 39:295312).
- Cyclin B/CDK1 , cyclin A/CDK2, cyclin E/CDK2, cyclin D/CDK4, cyclin D/CDK6, and likely other heterodynes are important regulators of cell cycle progression.
- cyclin/CDK heterodynes include regulation of transcription, DNA repair, differentiation and apoptosis (Morgan DO., Cyclin dependent kinases: engines, clocks, and microprocessors. Annu. Rev. Cell. Dev. Biol. 1997, 13:261291 ).
- Cyclin dependent kinase inhibitors have been demonstrated to be useful in treating cancer. Increased activity or temporally abnormal activation of cyclin dependent kinases has been shown to result in the development of human tumors, and human tumor development is commonly associated with alterations in either the CDK proteins themselves or their regulators (Cordon Cardo C., Mutations of cell cycle regulators: biological and clinical implications for human neoplasia. Am. J. Pathol. 1995, 147:545560; Karp JE, Broder S., Molecular foundations of cancer: new targets for intervention. Nat. Med. 1995, 1 :309320; Hall M, Peters G. Genetic alterations of cyclins, cyclin dependent kinases, and CDK inhibitors in human cancer. Adv.
- CDK4/6 inhibitors palbociclib, ribociclib and abemaciclib have been approved for treatment of hormone receptor (HR)-positive, human epidermal growth factor receptor 2 (HER2)-negative advanced or metastatic breast cancer in combination with aromatase inhibitors in post-menopausal women, and in combination with fulvestrant after disease progression following endocrine therapy, (O’Leary et al., Treating cancer with selective CDK4/6 inhibitors. Nature Reviews 2016, 13:417-430). While CDK4/6 inhibitors have shown significant clinical efficacy in HR-positive metastatic breast cancer, as with other kinases their effects may be limited over time by the development of primary or acquired resistance.
- HR hormone receptor
- HER2 human epidermal growth factor receptor 2
- CDK2 Overexpression of CDK2 is associated with abnormal regulation of cell-cycle.
- the cyclin E/CDK2 complex plays an important role in regulation of the G1/S transition, histone biosynthesis and centrosome duplication. Progressive phosphorylation of Rb by cyclin D/Cdk4/6 and cyclin E/Cdk2 releases the G1 transcription factor, E2F, and promotes S-phase entry. Activation of cyclin A/CDK2 during early S-phase promotes phosphorylation of endogenous substrates that permit DNA replication and inactivation of E2F, for S-phase completion. (Asghar et al., The history and future of targeting cyclin- dependent kinases in cancer therapy, Nat. Rev. Drug. Discov. 2015, 14(2): 130-146).
- Cyclin E the regulatory cyclin for CDK2, is frequently overexpressed in cancer. Cyclin E amplification or overexpression has long been associated with poor outcomes in breast cancer. (Keyomarsi et al., Cyclin E and survival in patients with breast cancer. N Engl J Med. 2002, 347:1566-75). Cyclin E2 (CCNE2) overexpression is associated with endocrine resistance in breast cancer cells and CDK2 inhibition has been reported to restore sensitivity to tamoxifen or CDK4 inhibitors in tamoxifen-resistant and CCNE2 overexpressing cells. (Caldon et al., Cyclin E2 overexpression is associated with endocrine resistance but not insensitivity to CDK2 inhibition in human breast cancer cells. Mol Cancer Ther.
- Cyclin E amplification also reportedly contributes to trastuzumab resistance in HER2+ breast cancer.
- Scaltriti et al. Cyclin E amplification/overexpression is a mechanism of trastuzumab resistance in HER2+ breast cancer patients, Proc Natl Acad Sci. 201 1 , 108: 3761 -6).
- Cyclin E overexpression has also been reported to play a role in basal-like and triple negative breast cancer (TNBC), as well as inflammatory breast cancer.
- TNBC basal-like and triple negative breast cancer
- Cyclin E overexpression has also been reported to play a role in basal-like and triple negative breast cancer (TNBC), as well as inflammatory breast cancer.
- TNBC basal-like and triple negative breast cancer
- Cyclin E overexpression as a biomarker for combination treatment strategies in inflammatory breast cancer, Noske, et. al., Detection of CCNE1/URI (19q12) amplification by in situ hybridisation is common in high grade and type II endometrial cancer, Oncotarget 2017, 8: 14897-1491 1 ).
- CCNE1 cyclin E1
- CCNE1 Amplification or overexpression of cyclin E1
- CCNE1 is associated with poor outcomes in ovarian, gastric, endometrial and other cancers.
- CCNE1 Gene amplification
- Etemadmoghadam et al. Resistance to CDK2 Inhibitors Is Associated with Selection of Polyploid Cells in CCNE1 -Amplified Ovarian Cancer, Clin Cancer Res 2013, 19:5960-71 ; Au-Yeung et al., Selective Targeting of Cyclin E1 -Amplified High-Grade Serous Ovarian Cancer by Cyclin-Dependent Kinase 2 and AKT Inhibition, Clin.
- Palbociclib or 6-acetyl-8-cyclopentyl-5-methyl-2-(5-piperazin-1 -yl-pyridin-2- ylamino)-8/-/-pyrido[2,3-d]pyrimidin-7-one (also referred to as“palbo,”“Palbo” or“PD- 0332991”) is a potent and selective inhibitor of CDK4 and CDK6, having the structure:
- Palbociclib is described in WHO Drug Information, 2013, Vol. 27, No. 2, page 172. Palbociclib and pharmaceutically acceptable salts thereof, are disclosed in International Publication No. WO 2003/062236 and U.S. Patent Nos. 6,936,612, 7,208,489 and 7,456, 168; International Publication No. WO 2005/005426 and U.S. Patent Nos. 7,345, 171 and 7,863,278; International Publication No. WO 2008/032157 and U.S. Patent No. 7,781 ,583; and International Publication No. WO 2014/128588. The contents of each of the foregoing references are incorporated herein by reference in their entirety.
- the compound PF-06873600, or 6-(difluoromethyl)-8-((1 R ⁇ R ⁇ -hydroxy ⁇ - methylcyclopentyl ⁇ - ⁇ methylsulfony piperidin ⁇ -ylamino ⁇ yrido ⁇ S-dlpyrimidin- 7(8H)-one, is a potent and selective inhibitor of CDK2, CDK4 and CDK6, having the structure:
- PF-06873600 and pharmaceutically acceptable salts thereof are disclosed in International Publication No. WO 2018/033815 published February 22, 2018. The contents of that reference are incorporated herein by reference in its entirety.
- the programmed death 1 (PD-1 ) receptor and PD-1 ligands 1 and 2 (PD-L1 and PD-L2, respectively) play integral roles in immune regulation.
- PD-1 is expressed by activated T cells, B cells, and myeloid cells.
- PD-1 has two known ligands, programmed death ligand 1 (PD-L1 ) and programmed death ligand 2 (PD-L2).
- PD-1 is activated by PD-L1 (also referred to as B7- H 1 , B7-4, CD274, and B7-H) and PD-L2 expressed by stromal cells, tumor cells, or both, initiating T-cell death and localized immune suppression (Dong et al., B7-H1 , a third member of the B7 family, co-stimulates T-cell proliferation and interleukin-10 secretion, Nat Med 1999; 5: 1365-69; Freeman et al., Engagement of the PD-1 immunoinhibitory receptor by a novel B7 family member leads to negative regulation of lymphocyte activation, J Exp Med 2000; 192: 1027-34), potentially providing an immune-tolerant environment for tumor development and growth.
- PD-L1 also referred to as B7- H 1 , B7-4, CD274, and B7-H
- PD-L2 expressed by stromal cells, tumor cells, or both
- PD-L1 is a cell-surface protein and member of the B7 family. PD-L1 is found on almost all types of lymphohematopoietic cells and is expressed at low levels by resting T cells, B cells, macrophages and dendritic cells and is further up regulated by an anti- CD40 antibody for B cells, anti-CD3 antibody for T cells, anti-CD40 antibody, IFNy and granulocyte macrophage colony-stimulating factor (GM-CSF) for macrophages and/or anti-CD40 antibody, IFNy, IL-4, IL-12 and GM-CSF for Dendritic cells (DCs).
- an anti- CD40 antibody for B cells anti-CD3 antibody for T cells
- anti-CD40 antibody IFNy and granulocyte macrophage colony-stimulating factor (GM-CSF) for macrophages and/or anti-CD40 antibody
- IFNy, IL-4, IL-12 and GM-CSF Dendritic cells
- PD-L1 is also expressed by some non-hemoatopoietic cells and is overexpressed in many cancers, wherein its overexpression is often associated with poor prognosis (Okazaki T et al., PD-1 and PD-1 ligands: from discovery to clinical application, Intern. Immun. 2007 19(7):813) (Thompson R FI et a!., Tumor B7-H 1 is associated with poor prognosis in renal cell carcinoma patients with long-term follow-up, Cancer Res 2006, 66(7):3381 ). Interestingly, the majority of tumor infiltrating T lymphocytes predominantly express PD- 1 , in contrast to T lymphocytes in normal tissues and peripheral blood.
- PD-1 on tumor- reactive T cells can contribute to impaired antitumor immune responses (Ahmadzadeh et al., Tumor antigen-specific CD8 T cells infiltrating the tumor express high levels of PD-1 and are functionally impaired, Blood 2009 1 14(8): 1537). This may be due to exploitation of PD-L1 signaling mediated by PD-L1 expressing tumor cells interacting with PD-1 expressing T cells to result in attenuation of T cell activation and evasion of immune surveillance (Sharpe et al., The B7-CD28 superfamily, Nat Rev 2002) (Keir ME et al., PD- 1 and its ligands in tolerance and immunityAn /. Rev. Immunol. 2008, 26:677). Therefore, inhibition of the PD-L1 /PD-1 interaction may enhance CD8+ T cell-mediated killing of tumors.
- the other known ligand for PD-1 , PD-L2, also known as B7-DC, Btdc, and CD273, is a cell surface protein.
- PD-L2 is expressed by antigen presenting cells, including dendritic cells, with expression also found in other non-hematopoietic tissues.
- PD-1 axis signaling through its direct ligands has been proposed as a means to enhance T cell immunity for the treatment of cancer (e.g., tumor immunity).
- cancer e.g., tumor immunity
- similar enhancements to T cell immunity have been observed by inhibiting the binding of PD-L1 to the binding partner B7-1 (Ribas A. and Wolchok J., Cancer immunotherapy using checkpoint blockade, Science, 2018, 359: 1350-1355).
- the 0X40 receptor (also known as CD134, TNFRSF4, ACT-4, ACT35, and TXGP1 L) is a member of the TNF receptor superfamily. 0X40 is found to be expressed on activated CD4+ and CD8+ T-cells. High numbers of 0X40+ T cells have been demonstrated within tumors (tumor infiltrating lymphocytes) and in the draining lymph nodes of cancer patients (Weinberg, A. et al., Assessment of activity of an adhesion molecule CD134 and CD137 in colorectal cancer patients, J. Immunol. 2000, 164:2160- 69; Petty, J.
- 4-1 BB (also known as CD137 and TNFRSF9), which was first identified as an inducible costimulatory receptor expressed on activated T cells, is a membrane spanning glycoprotein of the Tumor Necrosis Factor (TNF) receptor superfamily.
- TNF Tumor Necrosis Factor
- Current understanding of 4-1 BB indicates that expression is generally activation dependent and encompasses a broad subset of immune cells including activated NK and NKT cells; regulatory T cells; dendritic cells (DC) including follicular DC; stimulated mast cells, differentiating myeloid cells, monocytes, neutrophils, eosinophils, and activated B cells. 4-1 BB expression has also been demonstrated on tumor vasculature (19-20) and atherosclerotic endothelium.
- the ligand that stimulates 4-1 BB (4-1 BBL) is expressed on activated antigen presenting cells (APCs), myeloid progenitor cells and hematopoietic stem cells.
- APCs activated antigen presenting cells
- 4-1 BB agonist mAbs increase costimulatory molecule expression and markedly enhance cytolytic T lymphocyte responses, resulting in anti-tumor efficacy in various models.
- 4-1 BB agonist mAbs have demonstrated efficacy in prophylactic and therapeutic settings and both monotherapy and combination therapy tumor models and have established durable anti-tumor protective T cell memory responses
- Improved therapies for treating, stabilizing, preventing, and/or delaying development of various cancers, including cancers resistant to CDK inhibitors, comprise a large unmet medical need and the identification of novel combination regimens are required to improve treatment outcome.
- Preferred combination therapies of the present invention show greater efficacy than treatment with the individual therapeutic agents alone.
- This invention relates to therapeutic methods, combinations, and pharmaceutical compositions for use in the treatment of cancer. Also provided are combination therapies comprising the compounds of the invention, in combination with other therapeutic agents. The present invention also provides kits comprising one or more of the compositions of the invention.
- the invention provides a method for treating cancer comprising administering to a subject in need thereof an amount of a cyclin dependent kinase (CDK) inhibitor in combination with an amount of a PD-1 axis binding antagonist, wherein the amounts together are effective in treating cancer, and wherein the CDK inhibitor is an inhibitor of CDK4 and CDK6 (CDK4/6 inhibitor), or an inhibitor of CDK2, CDK4 and CDK6 (CDK2/4/6 inhibitor).
- CDK cyclin dependent kinase
- the method further comprises the combined administration to the subject of an amount of: a. an 0X40 agonist; b. a 4-1 BB agonist; or c. an 0X40 agonist and a 4-1 BB agonist; wherein the amounts together are effective in treating cancer.
- the PD-1 axis binding antagonist in any of the above methods comprises a PD-1 binding antagonist, a PD-L1 binding antagonist, or a PD-L2 binding antagonist.
- the PD-1 axis binding antagonist comprises a PD-1 binding antagonist.
- the PD-1 binding antagonist inhibits the binding of PD-1 to its ligand binding partners.
- the PD-1 binding antagonist inhibits the binding of PD-1 to PD-LI.
- the PD-1 binding antagonist inhibits the binding of PD-1 to PD-L2.
- the PD-1 binding antagonist inhibits the binding of PD-1 to both PD-L1 and PD-L2.
- the PD-1 binding antagonist is AMP-224.
- the PD-1 binding antagonist is an anti-PD-1 antibody.
- the anti-PD-1 antibody is nivolumab (MDX 1 106), pembrolizumab (MK-3475), pidilizumab (CT-01 1 ), cemiplimab (REGN2810), tislelizumab (BGB-A317), spartalizumab (PDR001 ), RN888, mAb15, MEDI-0680 (AMP-514), BGB- 108, or AGEN-2034, or a combination thereof.
- the PD-1 axis binding antagonist comprises a PD-L1 binding antagonist. In certain embodiments, wherein the PD-L1 binding antagonist inhibits the binding of PD-L1 to PD-1 . In some embodiments, the PD-L1 binding antagonist inhibits the binding of PD-L1 to B7-1 . In some embodiments, the PD-L1 binding antagonist inhibits the binding of PD-L1 to both PD-1 and B7-1 . In a particular embodiment, the PD-L1 binding antagonist is an anti-PD-L1 antibody.
- the anti-PD-L1 antibody is BMS-936559 (MDX- 1 105), AMP-714, atezolizumab (MPDL3280A), durvalumab (MEDI4736), avelumab, or an antibody comprising a VH region produced by the expression vector with ATCC Accession No. PTA-121 183 and having the VL region produced by the expression vector with ATCC Accession No. PTA-121 182, or a combination thereof.
- the invention provides a method for treating cancer comprising administering to a subject in need thereof, an amount of a cyclin dependent kinase (CDK) inhibitor in combination with an amount of a PD-1 axis binding antagonist and an amount of an 0X40 agonist, wherein the amounts together are effective in treating cancer, and wherein the CDK inhibitor is an inhibitor of CDK4 and CDK6 (CDK4/6 inhibitor), or an inhibitor of CDK2, CDK4 and CDK6 (CDK2/4/6 inhibitor).
- CDK cyclin dependent kinase
- the 0X40 agonist is an anti-OX40 antibody, an OX40L agonist fragment, an 0X40 oligomeric receptor, a trimeric OX40L-Fc protein or an 0X40 immunoadhesin, or a combination thereof.
- the 0X40 agonist is an anti-OX40 antibody.
- the anti-OX40 antibody is MEDI6469, MEDI0562, MEDI6383, MOXR0916, or GSK3174998, or a combination thereof.
- the anti-OX40 antibody is a full-length human lgG-1 antibody.
- the 0X40 agonist is an OX40L agonist fragment comprising one or more extracellular domains of OX40L.
- the invention provides a method for treating cancer comprising administering to a subject in need thereof, an amount of a cyclin dependent kinase (CDK) inhibitor in combination with an amount of a PD-1 axis binding antagonist and an amount of a 4-1 BB agonist, wherein the amounts together are effective in treating cancer, and wherein the CDK inhibitor is an inhibitor of CDK4 and CDK6 (CDK4/6 inhibitor), or an inhibitor of CDK2, CDK4 and CDK6 (CDK2/4/6 inhibitor).
- CDK cyclin dependent kinase
- the invention provides a method for treating cancer comprising administering to a subject in need thereof, an amount of a cyclin dependent kinase (CDK) inhibitor in combination with an amount of a PD-1 axis binding antagonist, an amount of an 0X40 agonist and an amount of a 4-1 BB agonist, wherein the amounts together are effective in treating cancer, and wherein the CDK inhibitor is an inhibitor of CDK4 and CDK6 (CDK4/6 inhibitor), or an inhibitor of CDK2, CDK4 and CDK6 (CDK2/4/6 inhibitor).
- the 4-1 BB agonist is an anti-4-1 BB antibody.
- the 4-1 BB agonist is utomilumab (PF-05082566), 1 D8, 3Elor, 4B4, H4-1 BB- M127, BBK2, 145501 , antibody produced by cell line deposited as ATCC No. HB-1 1248, 5F4, C65-485, urelumab (BMS-663513), 20H4.9-lgG-1 (BMS-663031 ), 4E9, BMS- 554271 , BMS-469492, 3H3, BMS- 469497, 3EI, 53A2, or 3B8.
- the CDK inhibitor is a CDK4/6 inhibitor.
- the CDK4/6 inhibitor is palbociclib, or a pharmaceutically acceptable salt thereof.
- the CDK inhibitor is a CDK2/4/6 inhibitor.
- the CDK2/4/6 inhibitor is 6-(difluoromethyl)-8-((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 -(methylsulfonyl)- piperidin-4-ylamino)pyrido[2,3-d]pyrimidin-7(8FI)-one, or a pharmaceutically acceptable salt thereof.
- the subject is a human.
- the cancer is a solid tumor.
- the cancer is a hematologic cancer.
- the cancer is selected from the group consisting of brain cancer, head/neck cancer (including squamous cell carcinoma of the head and neck (SCCFIN)), prostate cancer, ovarian cancer, bladder cancer (including urothelial carcinoma, also known as transitional cell carcinoma (TCC)), lung cancer (including squamous cell carcinoma, small cell lung cancer (SCLC), and non-small cell lung cancer (NSCLC)), breast cancer, bone cancer, colorectal cancer, kidney cancer, liver cancer (including hepatocellular carcinoma (FICC)), stomach cancer, pancreatic cancer, esophageal cancer , cervical cancer, sarcoma, skin cancer (including melanoma and Merkel cell carcinoma (MCC)), multiple myeloma, mesothelioma, malignant rhabdoid tumors, neuroblastoma, diffuse intrinsic pontine glioma (DIPG), carcinoma, lymphoma, diffuse large B-cell lymphoma (DLBCL
- the methods of the present invention further comprise administering chemotherapy, radiotherapy, immunotherapy, or phototherapy, or any combinations thereof to the subject.
- the invention provides a combination comprising a. (i) palbociclib, or a pharmaceutically acceptable salt thereof; and (ii) a PD-1 binding antagonist; b. (i) palbociclib, or a pharmaceutically acceptable salt thereof; (ii) a PD-1 binding antagonist; and (iii) an 0X40 agonist; c. (i) palbociclib, or a pharmaceutically acceptable salt thereof; (ii) a PD-1 binding antagonist; and (iii) a 4-1 BB agonist; or d.
- the invention provides a combination comprising a. (i) palbociclib, or a pharmaceutically acceptable salt thereof; and (ii) a PD-L1 binding antagonist; b. (i) palbociclib, or a pharmaceutically acceptable salt thereof; (ii) a PD-L1 binding antagonist; and (iii) an 0X40 agonist; c. (i) palbociclib, or a pharmaceutically acceptable salt thereof; (ii) a PD-L1 binding antagonist; and (iii) a 4-1 BB agonist; d.
- the invention provides a combination comprising a. (i) 6- (difluoromethyl)-8-((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 -(methylsulfonyl)- piperidin-4-ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof; and (ii) a PD-1 binding antagonist; b.
- the invention provides a combination comprising a. (i) 6- (difluoromethyl)-8-((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 -(methylsulfonyl)- piperidin-4-ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof; and (ii) a PD-L1 binding antagonist; b.
- the PD-1 binding antagonist is an anti-PD-1 antibody; the PD-L1 binding antagonist is an anti-PD-L1 antibody; the 0X40 agonist is an anti-OX40 antibody; and/or the 4-1 BB agonist is an anti-4-1 BB antibody.
- the combination is synergistic.
- the subject is a human.
- the cancer is a solid tumor.
- the cancer is a hematologic cancer.
- the cancer is selected from the group consisting of brain cancer, head/neck cancer (including squamous cell carcinoma of the head and neck (SCCHN)), prostate cancer, ovarian cancer, bladder cancer (including urothelial carcinoma, also known as transitional cell carcinoma (TCC)), lung cancer (including squamous cell carcinoma, small cell lung cancer (SCLC), and non small cell lung cancer (NSCLC)), breast cancer, bone cancer, colorectal cancer, kidney cancer, liver cancer (including hepatocellular carcinoma (HCC)), stomach cancer, pancreatic cancer, esophageal cancer , cervical cancer, sarcoma, skin cancer (including melanoma and Merkel cell carcinoma (MCC)), multiple myeloma, mesothelioma, malignant rhabdoid tumors, neuroblastoma, diffuse intrinsic pontine glioma (DIPG), carcinoma, lymphoma, diffuse large B-cell lymphoma (DLBCL), primary
- the cancer is breast cancer.
- Breast cancer may include luminal A, luminal B, triple negative/basal-like, or HER2-enriched subtypes.
- Breast cancers may be estrogen receptor (ER)-positive and/or progesterone receptor (PR)- positive, alternatively referred to as hormone receptor (HR)-positive.
- HR-positive breast cancers may be human epidermal growth factor receptor 2 (HER2)-negative (i.e., HR+/HER2-) or HER2-positive (i.e., HR+/HER2+).
- HR-negative breast cancers may be HER2-positive (i.e., HR-/HER2+) or HER-negative (HR-/HER2-), i.e. “triple negative” breast cancer (TNBC).
- the breast cancer demonstrates primary or acquired resistance to endocrine therapy, anti-HER2 agents and/or CDK4/CDK6 inhibitors.
- the breast cancer is advanced or metastatic breast cancer.
- the breast cancer is characterized by amplification or overexpression of CCNE1 and/or CCNE2.
- the invention provides a kit comprising: a. (i) a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising a PD-1 binding antagonist and a pharmaceutically acceptable carrier; b. (i) a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising a PD-1 binding antagonist and a pharmaceutically acceptable carrier; (iii) a pharmaceutical composition comprising an 0X40 agonist and a pharmaceutically acceptable carrier; c.
- a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising a PD-1 binding antagonist and a pharmaceutically acceptable carrier; (iii) a pharmaceutical composition comprising a 4-1 BB agonist and a pharmaceutically acceptable carrier; or d.
- a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising PD-1 binding antagonist and a pharmaceutically acceptable carrier; (iii) a pharmaceutical composition comprising an 0X40 agonist and a pharmaceutically acceptable carrier; (iv) a pharmaceutical composition comprising a 4- 1 BB agonist and a pharmaceutically acceptable carrier; and instructions for dosing of the pharmaceutical compositions for the treatment of cancer.
- the PD-1 binding antagonist is an anti- PD-1 antibody
- the 0X40 agonist is an anti-OX40 antibody
- the 4-1 BB agonist is an anti-4-1 BB antibody.
- the invention provides a kit comprising: a. (i) a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising a PD-L1 binding antagonist and a pharmaceutically acceptable carrier; b. (i) a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising a PD-L1 binding antagonist and a pharmaceutically acceptable carrier; (iii) a pharmaceutical composition comprising an 0X40 agonist and a pharmaceutically acceptable carrier; c.
- a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising a PD-L1 binding antagonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising a 4-1 BB agonist and a pharmaceutically acceptable carrier;
- d a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising PD-L1 binding antagonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising an 0X40 agonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising a 4- 1 BB agonist and a pharmaceutically acceptable carrier; or e.
- a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising a PD-1 binding antagonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising PD- L1 binding antagonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising an 0X40 agonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising a 4-1 BB agonist and a pharmaceutically acceptable carrier;
- the PD-L1 binding antagonist is an anti-PD-L1 antibody
- the 0X40 agonist is an anti-OX40 antibody
- the 4-1 BB agonist is an anti-4-1 BB antibody.
- the CDK inhibitor is a CDK4/6 inhibitor.
- the CDK4/6 inhibitor is palbociclib, or a pharmaceutically acceptable salt thereof.
- the CDK inhibitor is a CDK2/4/6 inhibitor.
- the CDK inhibitor is 6-(difluoromethyl)-8-((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 - (methylsulfonyl)piperidin-4-ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof.
- Figure 1 depicts syngeneic MC38 tumor growth inhibition comparing Isotype/Vehicle control with immune checkpoint blockade (PD-L1 (PF-06834635), 0X40 (PF-07201252) or 4-1 BB (PF-072188CDK4/6 inhibition (palbociclib) and the combination of checkpoint blockade with CDK4/6 inhibition (anti-PD-L1 antibody (PF-06834635)/anti- 0X40 antibody (PF-07201252)/anti-4-1 BB antibody (PF-07218859) + palbociclib) as cohort mean tumor volume (error bars represent standard error of the mean).
- PD-L1 PF-06834635
- 0X40 PF-07201252
- 4-1 BB PF-072188CDK4/6 inhibition
- Figure 2A depicts syngeneic MC38 tumor growth inhibition response to isotype and vehicle control from Figure 1 as individual tumor growth curves.
- Figure 2B depicts syngeneic MC38 tumor growth inhibition response to immune checkpoint blockade (anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF- 07201252)/anti-4-1 BB antibody (PF-07218859)) from Figure 1 as individual tumor growth curves.
- immune checkpoint blockade anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF- 07201252)/anti-4-1 BB antibody (PF-07218859)
- Figure 2C depicts syngeneic MC38 tumor growth inhibition response to CDK4/6 inhibition (palbociclib) from Figure 1 as individual tumor growth curves.
- Figure 2D depicts syngeneic MC38 tumor growth inhibition response to the combination of checkpoint blockade with CDK4/6 inhibition (anti-PD-L1 antibody (PF- 06834635)/anti-OX40 antibody (PF-07201252)/anti-4-1 BB antibody (PF-07218859) + palbociclib) from Figure 1 as individual tumor growth curves.
- Figure 3 depicts syngeneic MC38 tumor growth inhibition comparing Isotype/Vehicle control with immune checkpoint blockade (anti-PD-L1 antibody (PF- 06834635)/anti-OX40 antibody (PF-07201252)/anti-4-1 BB antibody (PF-07218859), PD- L1 (PF-06834635)/anti-OX40 antibody (PF-07201252), PD-L1 (PF-06834635)/anti-4- 1 BB antibody (PF-07218859), anti-PD-L1 antibody (PF-06834635)), CDK2/4/6 inhibition (PF-06873600) and the combination of checkpoint blockade with CDK2/4/6 inhibition ((anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF-07201252)/anti-4-1 BB antibody (PF-07218859) + CDK2/4/6 inhibitor (PF-06873600), anti-PD-L1 antibody (PF- 0683
- Figure 4A depicts syngeneic MC38 tumor growth inhibition response to isotype and vehicle control from Figure 3 as individual tumor growth curves.
- Figure 4B depicts syngeneic MC38 tumor growth inhibition response to CDK2/4/6 inhibition (PF-06873600) from Figure 3 as individual tumor growth curves.
- Figure 4C depicts syngeneic MC38 tumor growth inhibition response to immune checkpoint blockade (anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF- 07201252)) from Figure 3 as individual tumor growth curves.
- immune checkpoint blockade anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF- 07201252)
- Figure 4D depicts syngeneic MC38 tumor growth inhibition response to the combination of checkpoint blockade with CDK2/4/6 inhibition (anti-PD-L1 antibody (PF- 06834635)/anti-OX40 antibody (PF-07201252) + CDK2/4/6 inhibitor (PF-06873600)) from Figure 3 as individual tumor growth curves.
- CDK2/4/6 inhibition anti-PD-L1 antibody (PF- 06834635)/anti-OX40 antibody (PF-07201252) + CDK2/4/6 inhibitor (PF-06873600)
- Figure 4E depicts syngeneic MC38 tumor growth inhibition response to immune checkpoint blockade (anti-PD-L1 antibody (PF-06834635)/anti-4-1 BB antibody (PF- 07218859)) from Figure 3 as individual tumor growth curves.
- immune checkpoint blockade anti-PD-L1 antibody (PF-06834635)/anti-4-1 BB antibody (PF- 07218859)
- Figure 4F depicts syngeneic MC38 tumor growth inhibition response to the combination of checkpoint blockade with CDK2/4/6 inhibition (anti-PD-L1 antibody (PF- 06834635)/anti-4-1 BB antibody (PF-07218859) + CDK2/4/6 inhibitor (PF-06873600)) from Figure 3 as individual tumor growth curves.
- Figure 4G depicts syngeneic MC38 tumor growth inhibition response to immune checkpoint blockade (anti-PD-L1 antibody (PF-06834635)) from Figure 3 as individual tumor growth curves.
- Figure 4H depicts syngeneic MC38 tumor growth inhibition response to the combination of checkpoint blockade with CDK2/4/6 inhibition (anti-PD-L1 antibody (PF- 06834635) + CDK2/4/6 inhibitor (PF-06873600)) from Figure 3 as individual tumor growth curves.
- Figure 4I depicts syngeneic MC38 tumor growth inhibition response to immune checkpoint blockade (anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF- 07201252)/anti-4-1 BB antibody (PF-07218859)) from Figure 3 as individual tumor growth curves.
- immune checkpoint blockade anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF- 07201252)/anti-4-1 BB antibody (PF-07218859)
- Figure 4J depicts syngeneic MC38 tumor growth inhibition response to the combination of checkpoint blockade with CDK2/4/6 inhibition (anti-PD-L1 antibody (PF- 06834635)/anti-OX40 antibody (PF-07201252)/anti-4-1 BB antibody (PF-07218859) + CDK2/4/6 inhibitor (PF-06873600)) from Figure 3 as individual tumor growth curves.
- CDK2/4/6 inhibition anti-PD-L1 antibody (PF- 06834635)/anti-OX40 antibody (PF-07201252)/anti-4-1 BB antibody (PF-07218859) + CDK2/4/6 inhibitor (PF-06873600)
- Figure 5 depicts syngeneic 4T1 tumor growth inhibition comparing Isotype/Vehicle control with immune checkpoint blockade (anti-PD-L1 antibody (PF-06834635)/anti- 0X40 antibody (PF-07201252)/anti-4-1 BB antibody (PF-07218859)), CDK2/4/6 inhibition (PF-06873600) and the combination of checkpoint blockade with CDK2/4/6 inhibition (anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF-07201252)/anti-4-1 BB antibody (PF-07218859), (anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF- 07201252)/anti-4-1 BB antibody (PF-07218859) + CDK2/4/6 inhibitor (PF-06873600)) as cohort mean tumor volume (error bars represent standard error of the mean).
- Figure 6A depicts syngeneic 4T1 tumor growth inhibition response to isotype and vehicle control from Figure 5 as individual tumor growth curves.
- Figure 6B depicts syngeneic 4T1 tumor growth inhibition response to immune checkpoint blockade (anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF- 07201252)/anti-4-1 BB antibody (PF-07218859)) from Figure 5 as individual tumor growth curves.
- immune checkpoint blockade anti-PD-L1 antibody (PF-06834635)/anti-OX40 antibody (PF- 07201252)/anti-4-1 BB antibody (PF-07218859)
- Figure 6C depicts syngeneic 4T1 tumor growth inhibition response to CDK2/4/6 inhibition (PF-06873600) from Figure 5 as individual tumor growth curves.
- Figure 6D depicts syngeneic 4T1 tumor growth inhibition response to the combination of checkpoint blockade with CDK2/4/6 inhibition (anti-PD-L1 antibody (PF- 06834635)/anti-OX40 antibody (PF-07201252)/anti-4-1 BB antibody (PF-07218859) + CDK2/4/6 inhibitor (PF-06873600)) from Figure 5 as individual tumor growth curves.
- CDK2/4/6 inhibition anti-PD-L1 antibody (PF- 06834635)/anti-OX40 antibody (PF-07201252)/anti-4-1 BB antibody (PF-07218859) + CDK2/4/6 inhibitor (PF-06873600)
- a numerically defined parameter e.g., the dose of a CDK inhibitor, the dose of a PD-1 axis binding antagonist, the dose of an 0X40 agonist (e.g., anti-OX40 antibody (aOX40)), the dose of a 4-1 BB agonist (e.g., anti-4- 1 BB antibody (a4-BB)), and the like
- the parameter may vary by as much as 10% above or below the stated numerical value for that parameter.
- a dose of about 5 mg/kg should be understood to mean that the dose may vary between 4.5 mg/kg and 5.5 mg/kg.
- terms including, but not limited to,“drug,”“agent,”“component,” “composition,”“compound,”“substance,”“targeted agent,”“targeted therapeutic agent,” “therapeutic agent,” and“medicament” may be used interchangeably to refer to the small molecule compounds of the present invention, e.g., a CDK inhibitor.
- drugs including, but not limited to, “drug,” “agent,” “component,” “composition,” “compound,”“substance,”“targeted agent,”“targeted therapeutic agent,”“therapeutic agent,” therapeutic antibody,” and“medicament” may be used interchangeably to refer to the antibodies of the present invention, e.g., an anti-PD-L1 antibody, an anti-PD-1 antibody, an anti-OX40 antibody, and an anti-4-1 BB antibody, or combinations thereof.
- therapeutic antibody refers to an antibody that is used in the treatment of a disease or a disorder.
- a therapeutic antibody may have various mechanisms of action.
- a therapeutic antibody may bind and neutralize the normal function of a target associated with an antigen.
- a monoclonal antibody that blocks the activity of the protein needed for the survival of a cancer cell causes the cell's death.
- Another therapeutic antibody may bind and activate the normal function of a target associated with an antigen.
- a monoclonal antibody can bind to a protein on a cell and trigger an apoptosis signal.
- Yet another monoclonal antibody may bind to a target antigen expressed only on diseased tissue; conjugation of a toxic payload (effective agent), such as a chemotherapeutic or radioactive agent, to the monoclonal antibody can create an agent for specific delivery of the toxic payload to the diseased tissue, reducing harm to healthy tissue.
- a toxic payload such as a chemotherapeutic or radioactive agent
- A“biologically functional fragment” of a therapeutic antibody will exhibit at least one if not some or all of the biological functions attributed to the intact antibody, the function comprising at least specific binding to the target antigen.
- the therapeutic antibody may bind to any protein, including, without limitation, a PD-L1 , a PD-1 , an 0X40, and/or a 4-1 BB antigen. Accordingly, therapeutic antibodies include, without limitation, anti-PD-L1 antibodies, anti-PD-1 antibodies, anti-OX40 antibodies, and anti-4-1 BB antibodies, or combinations thereof.
- Biotherapeutic agent means a biological molecule, such as an antibody or fusion protein, that blocks ligand / receptor signaling in any biological pathway that supports tumor maintenance and/or growth or suppresses the anti-tumor immune response.
- a “chemotherapeutic agent” is a chemical compound useful in the treatment of cancer.
- chemotherapeutic agents include alkylating agents such as thiotepa and cyclophosphamide (CYTOXAN ® ); alkyl sulfonates such as busulfan, improsulfan, and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARINOL ® ); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (HYCAMTIN ® ), CPT- 1 1 (irt
- dynemicin A an esperamic
- chemotherapeutic agents include anti-hormonal agents that act to regulate, reduce, block, or inhibit the effects of hormones that can promote the growth of cancer, and are often in the form of systemic, or whole-body treatment. They may be hormones themselves. Examples include anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX ® tamoxifen), raloxifene (EVISTA ® ), droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY 1 1 7018, onapristone, and toremifene (FARESTON ® ); anti-progesterones; estrogen receptor down-regulators (ERDs); estrogen receptor antagonists such as fulvestrant (FASLODEX ® ); agents that function to suppress or shut down the ovaries, for example, luteinizing hormone-releasing hormone (LHRFI) agonists such as leuprolide
- chemotherapeutic agents includes bisphosphonates such as clodronate (for example, BONEFOS ® or OSTAC ® ), etidronate (DIDROCAL ® ), NE-58095, zoledronic acid/zoledronate (ZOMETA ® ), alendronate (FOSAMAX ® ), pamidronate (AREDIA ® ), tiludronate (SKELID ® ), or risedronate (ACTONEL ® ); as well as troxacitabine (a 1 ,3- dioxolane nucleoside cytosine analog); anti-sense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in abherant cell proliferation, such as, for example, PKC-alpha, Raf, Fl-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as TFIERATOPE® vaccine and gene therapy vaccines, for example, ALLOVECTIN
- cytokine refers generically to proteins released by one cell population that act on another cell as intercellular mediators or have an autocrine effect on the cells producing the proteins.
- cytokines include lymphokines, monokines; interleukins (“ILs”) such as IL- 1 , IL- la, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL10, IL-1 1 , IL-12, IL-13, IL-15, IL-17A-F, IL-18 to IL-29 (such as IL-23), IL-31 , including PROLEUKIN ® rlL-2; a tumor-necrosis factor such as TNF-a or TNF-b, TGF- I -3; and other polypeptide factors including leukemia inhibitory factor ("LIF”), ciliary neurotrophic factor (“CNTF”), CNTF-like cytokine (“CLC”), cardiotroph
- LIF leukemia inhibitor
- chemokine refers to soluble factors (e.g ., cytokines) that have the ability to selectively induce chemotaxis and activation of leukocytes. They also trigger processes of angiogenesis, inflammation, wound healing, and tumorigenesis.
- cytokines include IL-8, a human homolog of murine keratinocyte chemoattractant (KC).
- abnormal cell growth and “hyperproliferative disorder” are used interchangeably in this application.
- Abnormal cell growth refers to cell growth that is independent of normal regulatory mechanisms (e.g., loss of contact inhibition). Abnormal cell growth may be benign (not cancerous), or malignant (cancerous).
- A“disorder” is any condition that would benefit from treatment with the compounds of the present invention. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the subject to the disorder in question.
- antibody refers to an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
- the term encompasses a polyclonal antibody, a monoclonal antibody, a chimeric antibody, a bispecific antibody, a dual-specific antibody, bifunctional antibody, a trispecific antibody, a multispecific antibody, a bispecific heterodimeric diabody, a bispecific heterodimeric IgG, a labeled antibody, a humanized antibody, a human antibody, and fragments thereof (such as Fab, Fab’, F(ab’)2, Fv), single chain (ScFv) and domain antibodies (including, for example, shark and camelid antibodies), fusion proteins comprising an antibody, any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site, and antibody like binding peptidomimetics (ABiPs).
- ABSiPs binding peptidomimetics
- An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
- immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., lgG-1 , IgG- 2, lgG-3, lgG-4, lgA1 and lgA2.
- the heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
- the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
- a “bispecific antibody,” “dual-specific antibody,” “bifunctional antibody,” “heteromultimer,” “heteromultimeric complex,” “bispecific heterodimeric diabody” or a “heteromultimeric polypeptide” is a molecule comprising at least a first polypeptide and a second polypeptide, wherein the second polypeptide differs in amino acid sequence from the first polypeptide by at least one amino acid residue.
- the bispecific is an artificial hybrid antibody having two different heavy chain region and light chain region.
- the bispecific antibody has binding specificity for at least two different ligands, antigens or binding sites. Accordingly, the bispecific antibodies can bind simultaneously two different antigens. The two antigen binding sites of a bispecific antibody bind to two different epitopes, which may reside on the same or different protein targets, e.g., tumor target.
- the bispecific antibody, dual-specific antibody, bifunctional antibody, heteromultimer, heteromultimeric complex, bispecific heterodimeric diabody or the heteromultimeric polypeptide can be prepared by constructing sFv fragments with short linkers (e.g., about 3-10 residues) between the VH and VL regions such that inter-chain but not intra-chain pairing of the V regions is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen-binding sites.
- Bispecific antibodies can be derived from full length antibodies or antibody fragments (e.g., F(ab') 2 bispecific antibodies). Diabodies are described more fully in, for example, EP404,097; WO 1993/01 1 161 ; and Hollinger et al.
- bispecific antibody construct expressed as a functional single-chain molecule with high tumor cell cytotoxicity, Proc. Natl. Acad. Sci. 1993, 90:6444-6448.
- Bispecific antibodies are heterodimers of two "crossover" sFv fragments in which the VFI and VL regions of the two antibodies are present on different polypeptide chains.
- a bispecific antibody may comprise one antigen binding site that recognizes an epitope on one protein (e.g., 0X40, 4-1 BB, PD-1 or PD- L1 ) and further comprise a second, different antigen-binding site that recognizes a different epitope on a second protein (e.g., 0X40, 4-1 BB, PD-1 or PD-L1 ).
- binding means specific binding.
- immunoglobulin Ig
- the basic 4-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains.
- IgM antibody consists of 5 of the basic heterotetramer units along with an additional polypeptide called a J chain, and contains 10 antigen binding sites, while IgA antibodies comprise from 2-5 of the basic 4-chain units which can polymerize to form polyvalent assemblages in combination with the J chain.
- the 4-chain unit is generally about 150,000 Daltons.
- Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype.
- Each H and L chain also has regularly spaced intrachain disulfide bridges.
- Each H chain has at the N-terminus, a variable domain (VH) followed by three constant domains (CH) for each of the a and g chains and four CH domains for m and e isotypes.
- Each L chain has at the N-terminus, a variable domain (VL) followed by a constant domain at its other end. The VL is aligned with the VH and the CL is aligned with the first constant domain of the heavy chain (CHI). Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
- the pairing of a VH and VL together forms a single antigen-binding site.
- full-length antibody “intact antibody” or “whole antibody” are used interchangeably to refer to an antibody in its substantially intact form, as opposed to an antibody fragment.
- whole antibodies include those with heavy and light chains including an Fc region.
- the constant domains may be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variants thereof.
- the intact antibody may have one or more effector functions.
- an "antibody fragment” comprises a portion of an intact antibody, preferably the antigen binding and/or the variable region of the intact antibody.
- antibody fragments suitable for use in this invention include, without limitation: (i) the Fab fragment, consisting of VL, VH, CL, and CH1 domains; (ii) the“Fd” fragment consisting of the VH and CH1 domains; (iii) the“Fv” fragment consisting of the VL and VFI domains of a single antibody; (iv) the“dAb” fragment, which consists of a VFI domain; (v) isolated CDR regions; (vi) F(ab')2 fragments, a bivalent fragment comprising two linked Fab fragments; (vii) single chain Fv molecules (scFv), wherein a VH domain and a VL domain are linked by a peptide linker that allows the two domains to associate to form a binding domain; (viii) bi-specific single chain Fv dimers (e.g ., U.S
- Fv, scFv, or diabody molecules may be stabilized by the incorporation of disulphide bridges linking the VH and VL domains.
- Minibodies comprising a scFv joined to a CH3 domain may also be made (Hu et al., Minibodies are minimized antibody-like proteins comprising a scFv joined to a CH3 domain, Cancer Res. 1996, 56:3055-3061 )).
- isolated antibody or“isolated antibody fragment” refers to the purification status and in such context means the named molecule is substantially free of other biological molecules such as nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth media. Generally, the term “isolated” is not intended to refer to a complete absence of such material or to an absence of water, buffers, or salts, unless they are present in amounts that substantially interfere with experimental or therapeutic use of the binding compound as described herein.
- “Monoclonal antibody” or“mAb” or“Mab,” as used herein, refers to a population of substantially homogeneous antibodies, i.e., the antibody molecules comprising the population are identical in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts.
- conventional (polyclonal) antibody preparations typically include a multitude of different antibodies having different amino acid sequences in their variable domains, particularly their CDRs, which are often specific for different epitopes.
- the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al., Continuous cultures of fused cells secreting antibody of predefined specificity, Nature 1975, 256: 495; or may be made by recombinant DNA methods ( e.g ., U.S. Patent No. 4,816,567).
- the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Making antibody fragments using phage display libraries, Nature 1991 , 352: 624-628 and Marks et al., By-passing immunization: human antibodies from V-gene libraries displayed on phage, J. Mol. Biol. 1991 , 222: 581 -597, for example. See also Presta, Selection, design, and engineering of therapeutic antibodies, J. Allergy Clin. Immunol. 2005, 1 16:731 .
- Chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in an antibody derived from a particular species (e.g., human) or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in an antibody derived from another species (e.g., mouse) or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
- a particular species e.g., human
- another species e.g., mouse
- Human antibody refers to an antibody that comprises human immunoglobulin protein sequences only.
- a human antibody may contain murine carbohydrate chains if produced in a mouse, in a mouse cell, or in a hybridoma derived from a mouse cell.
- mouse antibody or“rat antibody” refer to an antibody that comprises only mouse or rat immunoglobulin sequences, respectively.
- Humanized antibody refers to forms of antibodies that contain sequences from non-human (e.g., murine) antibodies as well as human antibodies. Such antibodies contain minimal sequence derived from non-human immunoglobulin.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
- the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- the prefix “hum,” “hu” or “h” is added to antibody clone designations when necessary to distinguish humanized antibodies from parental rodent antibodies.
- the humanized forms of rodent antibodies will generally comprise the same CDR sequences of the parental rodent antibodies, although certain amino acid substitutions may be included to increase affinity, increase stability of the humanized antibody, or for other reasons.
- variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
- variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions.
- hypervariable region refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
- antibodies comprise six HVRs; three in the VH (H1 , H2, H3), and three in the VL (L1 , L2, L3).
- H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
- HVR delineations are in use and are encompassed herein.
- the Kabat Complementarity Determining Regions are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, 1991 ). Chothia refers instead to the location of the structural loops (Chothia and Lesk, Canonical structures for the hypervariable regions of immunoglobulins, J. Mol. Biol. 1987, 196:901 -917).
- the AbM HVRs represent a compromise between the Kabat HVRs and Chothia structural loops, are used by Oxford Molecular's AbM antibody modeling software.
- the "contact" HVRs are based on an analysis of the available complex crystal structures.
- A“CDR” of a variable domain are amino acid residues within the variable region that are identified in accordance with the definitions of the Kabat, Chothia, the accumulation of both Kabat and Chothia, AbM, contact, and/or conformational definitions or any method of CDR determination well known in the art.
- Antibody CDRs may be identified as the hypervariable regions originally defined by Kabat et al. See, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, NIH, 1992.
- the positions of the CDRs may also be identified as the structural loop structures originally described by Chothia and others.
- the positions of the CDRs may be identified as the residues that make enthalpic contributions to antigen binding. See, e.g., Makabe et a!., Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528, Journal of Biological Chemistry, 2008, 283: 1 156-1 166.
- CDR boundary definitions may not strictly follow one of the above approaches but will nonetheless overlap with at least a portion of the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding.
- a CDR may refer to CDRs defined by any approach known in the art, including combinations of approaches. The methods used herein may utilize CDRs defined according to any of these approaches. For any given embodiment containing more than one CDR, the CDRs may be defined in accordance with any of Kabat, Chothia, extended, AbM, contact, and/or conformational definitions.
- variable-domain residue-numbering as in Kabat or "amino-acid- position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or FIVR of the variable domain.
- a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues ( e.g ., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy-chain FR residue 82.
- the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
- Frework or FR residues are those variable-domain residues other than the FIVR residues as herein defined.
- a "human consensus framework” or "acceptor human framework” is a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VFI framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, 5 lh Ed. Public Health Service, National Institutes of Health, 1991 .
- the subgroup may be subgroup kappa I, kappa II, kappa III or kappa IV as in Kabat et al., supra.
- the subgroup may be subgroup I, subgroup II, or subgroup III as in Kabat et al., supra.
- a human consensus framework can be derived from the above in which particular residues, such as when a human framework residue is selected based on its homology to the donor framework by aligning the donor framework sequence with a collection of various human framework sequences.
- An acceptor human framework "derived from" a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain pre-existing amino acid sequence changes. In some embodiments, the number of pre-existing amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
- amino-acid modification at a specified position, e.g., of the Fc region, refers to the substitution or deletion of the specified residue, or the insertion of at least one amino acid residue adjacent the specified residue. Insertion "adjacent" to a specified residue means insertion within one to two residues thereof. The insertion may be N- terminal or C-terminal to the specified residue.
- the preferred amino acid modification herein is a substitution.
- Constantly modified variants or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g., charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity or other desired property of the protein, such as antigen affinity and/or specificity.
- Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (e.g ., Watson et al., Molecular Biology of the Gene (4th Ed.), 1987, p. 224).
- substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity. Exemplary conservative substitutions are set forth in Table 1 below.
- an “affinity-matured” antibody is one with one or more alterations in one or more HVRs thereof that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alteration(s).
- an affinity-matured antibody has nanomolar or even picomolar affinities for the target antigen.
- Affinity-matured antibodies are produced by procedures known in the art. For example, Marks et al., By-passing immunization: Building high affinity human antibodies by chain shuffling, Bio/Technology 1992, 10:779-783, describes affinity maturation by VH- and VL-domain shuffling.
- Random mutagenesis of HVR and/or framework residues is described by, for example: Barbas et al., In vitro evolution of a neutralizing human antibody to human immunodeficiency virus type 1 to enhance affinity and broaden strain cross-reactivity, Proc Nat. Acad. Sci. 1994, 91 :3809-3813; Schier et al., Identification of functional and structural amino-acid residues by parsimonious mutagenesis, Gene 1995, 169: 147- 155; Yelton et al., Affinity maturation of the BR96 anti-carcinoma antibody by codon-based mutagenesis, J. Immunol. 1995, 155: 1994- 2004; Jackson et al., In vitro antibody maturation.
- Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions.
- the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
- the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody.
- a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
- Suitable native-sequence Fc regions for use in the antibodies of the invention include human lgG-1 , lgG-2 (lgG2A, lgG2B), lgG-3 and lgG-4.
- Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
- the preferred FcR is a native sequence human FcR.
- a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FeyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors, FcyRII receptors include FcyRI IA (an “activating receptor”) and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
- Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine- based inhibition motif (ITGM) in its cytoplasmic domain, (e.g., M. Daeron, Fc RECEPTOR BIOLOGY, Annu. Rev. Immunol. J 1997, 5 :203-234.
- ITGM immunoreceptor tyrosine-based inhibition motif
- FcR FcR
- Fc receptor or FcR also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus.
- FcRn the neonatal receptor
- Guyer et al. Immunoglobulin binding by mouse intestinal epithelial cell receptors, J. Immunol. 1976, 1 17: 587, and Tokoyama et al., How do natural killer cells find self to achieve tolerance? Immunity, 1994, 24, 249-257.
- Methods of measuring binding to FcRn are known (e.g., Ghetie and Ward, FcRn: the MHC class l-related receptor that is more than an IgG transporter, Immunol.
- Binding to FcRn in vivo and serum half-life of human FcRn high-affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which the polypeptides having a variant Fc region are administered.
- WO 2004/042072 (Presta) describes antibody variants which improved or diminished binding to FcRs.
- substantially reduced denotes a sufficiently high degree of difference between two numeric values (generally one associated with a molecule and the other associated with a reference/comparator molecule) such that one of skill in the art would consider the difference between the two values to be of statistical significance within the context of the biological characteristic measured by said values (e.g., Kd values).
- the difference between said two values is, for example, greater than about 10%, greater than about 20%, greater than about 30%, greater than about 40%, and/or greater than about 50% as a function of the value for the reference/comparator molecule.
- substantially similar denotes a sufficiently high degree of similarity between two numeric values (for example, one associated with an antibody of the invention and the other associated with a reference/comparator antibody), such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by said values (. e.g ., Kd values).
- the difference between said two values is, for example, less than about 50%, less than about 40%, less than about 30%, less than about 20%, and/or less than about 10% as a function of the reference/comparator value.
- the term “specifically binds to” or is “specific for” refers to measurable and reproducible interactions such as binding between a target and an antibody, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
- an antibody that specifically binds to a target (which can be an epitope) is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
- the extent of binding of an antibody to an unrelated target is less than about 10 percent of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA).
- an antibody that specifically binds to a target has a dissociation constant (Kd) of ⁇ 1 mM, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 nM.
- Kd dissociation constant
- an antibody specifically binds to an epitope on a protein that is conserved among the protein from different species.
- specific binding can include, but does not require exclusive binding.
- immunoadhesin designates antibody-like molecules which combine the binding specificity of a heterologous protein (an “adhesin”) with the effector functions of immunoglobulin constant domains.
- the immunoadhesins comprise a fusion of an amino acid sequence with the desired binding specificity which is other than the antigen recognition and binding site of an antibody (i.e., is “heterologous"), and an immunoglobulin constant domain sequence.
- the adhesin part of an immunoadhesin molecule typically is a contiguous amino acid sequence comprising at least the binding site of a receptor or a ligand.
- the immunoglobulin constant domain sequence in the immunoadhesin may be obtained from any immunoglobulin, such as lgG-1 , lgG-2 (including lgG2A and lgG2B), lgG-3, or lgG-4 subtypes, IgA (including IgA- 1 and IgA-2), IgE, IgD or IgM.
- the Ig fusions preferably include the substitution of a domain of a polypeptide or antibody described herein in the place of at least one variable region within an Ig molecule.
- the immunoglobulin fusion includes the hinge, CH2 and CH3, or the hinge, CHI, CH2 and CH3 regions of an lgG-1 molecule.
- Immunoadhesin combinations of Ig Fc and ECD of cell surface receptors are sometimes termed soluble receptors.
- a “fusion protein” and a “fusion polypeptide” refer to a polypeptide having two portions covalently linked together, where each of the portions is a polypeptide having a different property.
- the property may be a biological property, such as activity in vitro or in vivo.
- the property may also be simple chemical or physical property, such as binding to a target molecule, catalysis of a reaction, etc.
- the two portions may be linked directly by a single peptide bond or through a peptide linker but are in reading frame with each other.
- a "PD-1 oligopeptide,” “PD-L1 oligopeptide,” or “PD-L2 oligopeptide” is an oligopeptide that binds, preferably specifically, to a PD-1 , PD-L1 or PD-L2 negative costimulatory polypeptide, respectively, including a receptor, ligand or signaling component, respectively, as described herein.
- Such oligopeptides may be chemically synthesized using known oligopeptide synthesis methodology or may be prepared and purified using recombinant technology.
- Such oligopeptides are usually at least about 5 amino acids in length, alternatively at least about 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40,
- oligopeptides may be identified using well known techniques.
- techniques for screening oligopeptide libraries for oligopeptides that are capable of specifically binding to a polypeptide target are well known in the art (e.g., U.S. Patent Nos. 5,556,762, 5,750,373, 4,708,871 , 4,833,092, 5,223,409, 5,403,484, 5,571 ,689, 5,663, 143; PCT Publication Nos. WO 1984/0003506 and WO 1984/0003564; Geysen et al., Use of peptide synthesis to probe viral antigens for epitopes to a resolution of a single amino acid, Proc. Natl. Acad.
- an “antagonist” antibody or a “blocking” antibody is one that inhibits or reduces a biological activity of the antigen it binds.
- blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
- the anti-PD-L1 antibodies of the invention block the signaling through PD-1 so as to restore a functional response by T-cells (e.g., proliferation, cytokine production, target cell killing) from a dysfunctional state to antigen stimulation.
- agonist or“activating antibody” is one that enhances or initiates signaling by the antigen to which it binds.
- agonist antibodies cause or activate signaling without the presence of the natural ligand.
- disfunction in the context of immune dysfunction, refers to a state of reduced immune responsiveness to antigenic stimulation.
- the term includes the common elements of both exhaustion and/or anergy in which antigen recognition may occur, but the ensuing immune response is ineffective to control infection or tumor growth.
- disfunctional also includes refractory or unresponsive to antigen recognition, specifically, impaired capacity to translate antigen recognition into down-stream T-cell effector functions, such as proliferation, cytokine production and/or target cell killing.
- T cell anergy refers to the state of unresponsiveness to antigen stimulation resulting from incomplete or insufficient signals delivered through the T-cell receptor (e.g ., increase in intracellular Ca+2 in the absence of ras-activation). T cell anergy can also result upon stimulation with antigen in the absence of co- stimulation, resulting in the cell becoming refractory to subsequent activation by the antigen even in the context of co stimulation.
- the unresponsive state can often be overridden by the presence of lnterleukin-2. Anergic T-cells do not undergo clonal expansion and/or acquire effector functions.
- exhaustion refers to T cell exhaustion as a state of T cell dysfunction that arises from sustained TCR signaling that occurs during many chronic infections and cancer. It is distinguished from anergy in that it arises not through incomplete or deficient signaling, but from sustained signaling. It is defined by poor effector function, sustained expression of inhibitory receptors and a transcriptional state distinct from that of functional effector or memory T cells. Exhaustion prevents optimal control of infection and tumors. Exhaustion can result from both extrinsic negative regulatory pathways (e.g., immunoregulatory cytokines) as well as cell intrinsic negative regulatory (co stimulatory) pathways.
- extrinsic negative regulatory pathways e.g., immunoregulatory cytokines
- Enhancing T-cell function means to induce, cause or stimulate a T-cell to have a sustained or amplified biological function, or renew or reactivate exhausted or dysfunctional T-cells.
- enhancing T-cell function include: increased secretion of g-interferon from CD4+ or CD8+ T-cells, increased proliferation, increased survival, increased differentiation, increased antigen responsiveness (e.g., viral, pathogen, or tumor clearance) relative to such levels before the intervention.
- the level of enhancement is as least 50%, alternatively 60%, 70%, 80%, 90%, 100%, 120%, 150%, 200%. The manner of measuring this enhancement is known to one of ordinary skill in the art.
- Metastasis or“metastatic” is meant the spread of cancer from its primary site to other places in the body. Cancer cells can break away from a primary tumor, penetrate into lymphatic and blood vessels, circulate through the bloodstream, and grow in a distant focus (metastasize) in normal tissues elsewhere in the body. Metastasis can be local or distant. Metastasis is a sequential process, contingent on tumor cells breaking off from the primary tumor, traveling through the bloodstream, and stopping at a distant site. At the new site, the cells establish a blood supply and can grow to form a life-threatening mass. Both stimulatory and inhibitory molecular pathways within the tumor cell regulate this behavior, and interactions between the tumor cell and host cells in the distant site are also significant.
- cancer refers to or describe the physiological condition in subjects that is typically characterized by unregulated cell growth.
- cancer includes but is not limited to a primary cancer that originates at a specific site in the body, a metastatic cancer that has spread from the place in which it started to other parts of the body, a recurrence from the original primary cancer after remission, and a second primary cancer that is a new primary cancer in a person with a history of previous cancer of a different type from the latter one.
- cancer examples include, but are not limited to, brain cancer, head/neck cancer (including squamous cell carcinoma of the head and neck (SCCHN)), prostate cancer, ovarian cancer, bladder cancer (including urothelial carcinoma, also known as transitional cell carcinoma (TCC)), lung cancer (including squamous cell carcinoma, small cell lung cancer (SCLC), and non small cell lung cancer (NSCLC)), breast cancer, bone cancer, colorectal cancer, kidney cancer, liver cancer (including hepatocellular carcinoma (HCC)), stomach cancer, pancreatic cancer, esophageal cancer , cervical cancer, sarcoma, skin cancer (including melanoma and Merkel cell carcinoma (MCC)), multiple myeloma, mesothelioma, malignant rhabdoid tumors, diffuse intrinsic pontine glioma (DIPG), carcinoma, lymphoma, diffuse large B-cell lymphoma (DLBCL), primary mediastinal B-cell lymphoma (PMBCL),
- “in combination with” or “in conjunction with” refers to administration of one treatment modality in addition to at least one other treatment modality. As such,“in combination with” or “in conjunction with” refers to administration of one treatment modality before, during, or after administration of at least one other treatment modality to the individual.
- An “objective response” refers to a measurable response, including complete response (CR) or partial response (PR).
- objective response rate refers to the sum of complete response (CR) rate and partial response (PR) rate.
- Complete response means the disappearance of all signs of cancer (e.g., disappearance of all target lesions) in response to treatment. This does not always mean the cancer has been cured.
- partial response refers to a decrease in the size of one or more tumors or lesions, or in the extent of cancer in the body, in response to treatment.
- PR refers to at least a 30% decrease in the sum of the longest diameters (SLD) of target lesions, taking as reference the baseline SLD.
- progressive disease or “PD” refers to at least a 20% increase in the SLD of target lesions, taking as reference the smallest SLD recorded since the treatment started or the presence of one or more new lesions.
- progression free survival refers to the length of time during and after treatment during which the disease being treated (e.g., cancer) does not get worse. Progression-free survival may include the amount of time patients have experienced a complete response or a partial response, as well as the amount of time patients have experienced stable disease.
- ORR all response rate
- all survival refers to the percentage of individuals in a group who are likely to be alive after a particular duration of time.
- sustained response refers to the sustained effect on reducing tumor growth after cessation of a treatment.
- the tumor size may be the same size or smaller as compared to the size at the beginning of the medicament administration phase.
- the sustained response has a duration of at least the same as the treatment duration, at least 1 5x, 2x, 2.5x, or 3x length of the treatment duration, or longer.
- “Duration of Response” for purposes of the present invention means the time from documentation of tumor model growth inhibition due to drug treatment to the time of acquisition of a restored growth rate similar to pretreatment growth rate.
- the anti-cancer effect of the method of treating cancer including “objective response,” “complete response,” “partial response,” “progressive disease,”“stable disease,”“progression free survival,”“duration of response,” as used herein, are as defined and assessed by the investigators using RECIST v1 .1 (Eisenhauer et al., New response evaluation criteria in solid tumors: revised RECIST guideline, Eur J of Cancer 2009; 45(2):228-47) in patients with locally advanced or metastatic solid tumors other than metastatic CRPC, and RECIST v1 .1 and PCWG3 (Scher et al., Trial Design and Objectives for Castration-Resistant Prostate Cancer: Updated Recommendations From the Prostate Cancer Clinical Trials Working Group 3, J Clin Oncol 2016; 34(12): 1402-18) in patients with metastatic CRPC.
- RECIST v1 .1 Eisenhauer et al., 2009and Scher et ai, 2016 are herein incorporated
- patient refers to any subject for which therapy is desired or that is participating in a clinical trial, epidemiological study or used as a control, including humans and non-human animals, including veterinary subjects such as cattle, horses, dogs and cats.
- the subject is a human and may be referred to as a patient.
- Those skilled in the medical art are readily able to identify individual patients who are afflicted with cancer.
- the combination or co-administration of two or more agents can be useful for treating individuals suffering from cancer who have primary or acquired resistance to ongoing therapies.
- the combination therapy provided herein may be useful for improving the efficacy and/or reducing the side effects of cancer therapies for individuals who do respond to such therapies.
- the term“combination therapy” refers to the administration of each agent of the combination therapy of the invention, either alone or in a medicament, either simultaneously, separately or sequentially, as mixed or individual dosages.
- the term “simultaneously,” “simultaneous administration,” “administered simultaneously,”“concurrently,” or “concurrent administration,” means that the agents are administered at the same point in time or immediately following one another, but that the agents can be administered in any order. For example, in the latter case, the two or more agents are administered at times sufficiently close that the results observed are indistinguishable from those achieved when the agents are administered at the same point in time.
- the term simultaneous includes the administration of each agent of the combination therapy of the invention in the same medicament.
- the agents of the present invention can be administered completely separately or in the form of one or more separate compositions.
- the agents may be given separately at different times during the course of therapy (in a chronologically staggered manner, especially a sequence-specific manner) in such time intervals that the combination therapy is effective in treating cancer.
- the term“sequential,”“sequentially,”“administered sequentially,” or “sequential administration” refers to the administration of each agent of the combination therapy of the invention, either alone or in a medicament, one after the other, wherein each agent can be administered in any order. Sequential administration may be particularly useful when the therapeutic agents in the combination therapy are in different dosage forms, for example, one agent is a tablet and another agent is a sterile liquid, and/or the agents are administered according to different dosing schedules, for example, one agent is administered daily, and the second agent is administered less frequently such as weekly.
- “in combination with,” “in conjunction with” or “combined administration” refers to administration of one agent in addition to at least one other agent.
- “in combination with,” “in conjunction with” or“combined administration” refers to administration of one agent before, during, or after administration of at least one other agent to the individual.
- the administration of two or more agents are intended to include treatment regimens in which the agents are not necessarily administered by the same route of administration or at the same time.
- A“combination” or“pharmaceutical combination” refers to a combination of any two or more agents as described herein, e.g., any CDK inhibitor described herein with any PD-1 axis binding antagonist as described herein, optionally with any 0X40 agonist as described herein; any 4-1 BB agonist as described herein; or any 0X40 agonist and any 4-1 BB agonist as described herein. These two or more agents may (but do not necessarily) belong to different classes of agents.
- a combination as described herein e.g., a CDK inhibitor in combination with a PD-1 axis binding antagonist
- a combination as described herein, e.g., a CDK inhibitor in combination with a PD-1 axis binding antagonist is administered in a single dose.
- a combination as described herein, e.g., a CDK inhibitor in combination with a PD-1 axis binding antagonist is administered in multiple doses.
- an amount of a combination as described herein may be administered periodically at regular intervals (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times every 1 , 2, 3, 4, 5, or 6 days, or every 1 , 2, 3, 4, 5, 6, 7, 8, or 9 weeks, or every 1 , 2, 3, 4, 5, 6, 7, 8, 9 months or longer).
- regular intervals e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times every 1 , 2, 3, 4, 5, or 6 days, or every 1 , 2, 3, 4, 5, 6, 7, 8, or 9 weeks, or every 1 , 2, 3, 4, 5, 6, 7, 8, 9 months or longer.
- a combination as described herein e.g., a CDK inhibitor in combination with a PD-1 axis binding antagonist, is administered at a predetermined interval ⁇ e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times every 1 , 2, 3, 4, 5, or 6 days, or every 1 , 2, 3, 4, 5, 6, 7, 8, or 9 weeks, or every 1 , 2, 3, 4, 5, 6, 7, 8, 9 months or longer).
- a predetermined interval ⁇ e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times every 1 , 2, 3, 4, 5, or 6 days, or every 1 , 2, 3, 4, 5, 6, 7, 8, or 9 weeks, or every 1 , 2, 3, 4, 5, 6, 7, 8, 9 months or longer).
- the present invention relates to combinations of two or more agents for simultaneous, separate or sequential administration, in particular for the treatment or prevention of cancer.
- the individual agents of the combination of the invention can be administered separately at different times in any order during the course of therapy or concurrently in divided or single combination forms.
- composition administration means that the agents are administered at the same point in time or immediately following one another.
- the two agents are administered at times sufficiently close that the results observed are indistinguishable from those achieved when the agents are administered at the same point in time.
- the agents of the present invention can be administered completely separately or in the form of one or more separate compositions.
- the agents may be given separately at different times during the course of therapy (in a chronologically staggered manner, especially a sequence-specific manner) in such time intervals that the combination therapy is effective in treating cancer.
- packaged pharmaceutical products may contain one or more dosage forms that contain the combination of agents, and one or more dosage forms that contain one of the combination of agents, but not the other agent(s) of the combination.
- the term“single formulation,” as used herein, refers to a single carrier or vehicle formulated to deliver effective amounts of both therapeutic agents to a subject.
- the single vehicle is designed to deliver an effective amount of each of the agents, along with any pharmaceutically acceptable carriers or excipients.
- the vehicle is a tablet, capsule, pill, or a patch.
- the vehicle is a solution or a suspension.
- unit dose is used herein to mean simultaneous administration of both agents together, in one dosage form, to the subject being treated.
- the unit dose is a single formulation.
- the unit dose includes one or more vehicles such that each vehicle includes an effective amount of at least one of the agents along with pharmaceutically acceptable carriers and excipients.
- the unit dose is one or more tablets, capsules, pills, or patches administered to the subject at the same time.
- An“oral dosage form” includes a unit dosage form prescribed or intended for oral administration.
- breast cancer includes locally advanced (non-metastatic) disease and metastatic disease.
- treat or“treating” a cancer, as used herein means to administer a combination therapy according to the present invention to a subject having cancer, or diagnosed with cancer, to achieve at least one positive therapeutic effect, such as, for example, reduced number of cancer cells, reduced tumor size, reduced rate of cancer cell infiltration into peripheral organize, or reduced rate of tumor metastases or tumor growth, reversing, stopping, controlling, slowing, interrupting, arresting, alleviating, and/or inhibiting the progression or severity of a sign, symptom, disorder, condition, or disease, but does not necessarily involve a total elimination of all disease-related signs, symptoms, conditions, or disorders.
- a positive therapeutic effect such as, for example, reduced number of cancer cells, reduced tumor size, reduced rate of cancer cell infiltration into peripheral organize, or reduced rate of tumor metastases or tumor growth, reversing, stopping, controlling, slowing, interrupting, arresting, alleviating, and/or inhibiting the progression or severity of a sign, symptom, disorder, condition, or disease, but does not necessarily involve a total elimination
- the term“treat” or“treating” also denotes, to arrest, delay the onset (i.e., the period prior to clinical manifestation of a disease or symptom of a disease) and/or reduce the risk of developing or worsening a symptom of a disease.
- treatment refers to the act of treating as “treating” is defined immediately above.
- the term“treating” also includes adjuvant and neo-adjuvant treatment of a subject.
- beneficial or desired clinical results include, but are not limited to, one or more of the following: reducing the proliferation of (or destroying) neoplastic or cancerous cell; inhibiting metastasis or neoplastic cells; shrinking or decreasing the size of tumor; remission of the cancer; decreasing at least one symptom resulting from the cancer; increasing the quality of life of those suffering from the cancer; decreasing the dose of other medications required to treat the cancer; delaying the progression the cancer; curing the cancer; overcoming one or more resistance mechanisms of the cancer; and/or prolonging survival of patients with cancer.
- the treatment achieved by a combination of the invention is any of the partial response (PR), complete response (CR), overall response (OR), progression free survival (PFS), disease free survival (DFS) and overall survival (OS).
- PR partial response
- CR complete response
- OR overall response
- PFS progression free survival
- DFS disease free survival
- OS overall survival
- PFS also referred to as“Time to Tumor Progression” indicates the length of time during and after treatment that the cancer does not grow and includes the amount of time patients have experienced a CR or PR, as well as the amount of time patients have experienced stable disease (SD).
- DFS refers to the length of time during and after treatment that the patient remains free of disease.
- OS refers to a prolongation in life expectancy as compared to naive or untreated subjects or patients.
- response to a combination of the invention is any of PR, CR, OR, OS, PFS, or DFS that is assessed using Response Evaluation Criteria in Solid Tumors (RECIST) 1 .1 response criteria.
- the treatment regimen for a combination of the invention that is effective to treat a cancer patient may vary according to factors such as the disease state, age, weight of the patient, and the ability of the therapy to elicit an anti-cancer response in the subject.
- any of the aspects of the invention may not be effective in achieving a positive therapeutic effect in every subject, it should do so in a statistically significant number of subjects as determined by any statistical test known in the art such as the Student’s t-test, the chi2-test the U-test according to Mann and Whitney, the Kruskal- Wallis test (FI-test), Jonckheere-Terpstrat-testy and the Wilcon on-test.
- any statistical test known in the art such as the Student’s t-test, the chi2-test the U-test according to Mann and Whitney, the Kruskal- Wallis test (FI-test), Jonckheere-Terpstrat-testy and the Wilcon on-test.
- administer refers to contacting, implanting, absorbing, ingesting, injecting, inhaling, or introducing of an exogenous pharmaceutical, therapeutic or diagnostic agent, compound, particle, and/or composition, to the animal, human, experimental subject, cell, tissue, organ or biological fluid.
- Treatment of a cell encompasses contact of an agent to the cell, as well as contact of an agent to a fluid, where the fluid is in contact with the cell.
- treatment also encompasses in vitro and ex vivo treatment, e.g., of a cell, by a reagent, diagnostic, binding compound, or by another cell.
- diagnosis is used herein to refer to the identification or classification of a molecular or pathological state, disease or condition (e.g., cancer).
- diagnosis may refer to identification of a particular type of cancer.
- Diagnosis may also refer to the classification of a particular subtype of cancer, e.g., by histopathological criteria, or by molecular features (e.g., a subtype characterized by expression of one or a combination of biomarkers (e.g., particular genes or proteins encoded by said genes)).
- a method of aiding diagnosis of a disease or condition can comprise measuring certain biomarkers in a biological sample from an individual.
- sample refers to a composition that is obtained or derived from a subject and/or individual of interest that contains a cellular and/or other molecular entity that is to be characterized and/or identified, for example based on physical, biochemical, chemical and/or physiological characteristics.
- disease sample and variations thereof refers to any sample obtained from a subject of interest that would be expected or is known to contain the cellular and/or molecular entity that is to be characterized.
- Samples include, but are not limited to, primary or cultured cells or cell lines, cell supernatants, cell lysates, platelets, serum, plasma, vitreous fluid, lymph fluid, synovial fluid, follicular fluid, seminal fluid, amniotic fluid, milk, whole blood, blood-derived cells, urine, cerebro-spinal fluid, saliva, sputum, tears, perspiration, mucus, tumor lysates, and tissue culture medium, tissue extracts such as homogenized tissue, tumor tissue, cellular extracts, and combinations thereof.
- tissue sample or “cell sample” is meant a collection of similar cells obtained from a tissue of a subject or individual.
- the source of the tissue or cell sample may be solid tissue as from a fresh, frozen and/or preserved organ, tissue sample, biopsy, and/or aspirate; blood or any blood constituents such as plasma; bodily fluids such as cerebral spinal fluid, amniotic fluid, peritoneal fluid, or interstitial fluid; cells from any time in gestation or development of the subject.
- the tissue sample may also be primary or cultured cells or cell lines.
- the tissue or cell sample is obtained from a disease tissue/organ.
- the tissue sample may contain compounds which are not naturally intermixed with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, or the like.
- a “reference sample,” “reference cell,” “reference tissue,” “control sample,” “control cell,” or “control tissue,” as used herein, refers to a sample, cell, tissue, standard, or level that is used for comparison purposes.
- a reference sample, reference cell, reference tissue, control sample, control cell, or control tissue is obtained from a healthy and/or non-diseased part of the body (e.g., tissue or cells) of the same subject or individual.
- healthy and/or non-diseased cells or tissue adjacent to the diseased cells or tissue e.g., cells or tissue adjacent to a tumor.
- a reference sample is obtained from an untreated tissue and/or cell of the body of the same subject or individual.
- a reference sample, reference cell, reference tissue, control sample, control cell, or control tissue is obtained from a healthy and/or non-diseased part of the body (e.g., tissues or cells) of an individual who is not the subject or individual.
- a reference sample, reference cell, reference tissue, control sample, control cell, or control tissue is obtained from an untreated tissue and/or cell of the body of an individual who is not the subject or individual.
- “pharmaceutical composition” refers to a preparation which is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. Such formulations are sterile.“Pharmaceutically acceptable” carriers or excipients (vehicles, additives) are those which can reasonably be administered to a subject to provide an effective dose of the active ingredient employed.
- Suitable formulations include, for example, tablets, capsules, press coat formulations, and other easily administered formulations
- a "package insert” refers to instructions customarily included in commercial packages of medicaments that contain information about the indications customarily included in commercial packages of medicaments that contain information about the indications, usage, dosage, administration, contraindications, other medicaments to be combined with the packaged product, and/or warnings concerning the use of such medicaments, etc.
- an“effective dosage,”“effective amount,” “therapeutically effective amount,” or “therapeutically effective dosage” of a drug, agent, component, composition, compound, substance, targeted agent, targeted therapeutic agent, therapeutic antibody, therapeutic agent, medicament or pharmaceutical composition is an amount to affect any one or more beneficial or desired, including biochemical, histological and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presenting during development of the disease.
- a therapeutically effective amount refers to that amount of a drug, agent, component, composition, compound, substance, targeted agent, targeted therapeutic agent, therapeutic antibody, therapeutic agent, medicament or pharmaceutical composition being administered which will relieve to some extent one or more of the symptoms of the disorder being treated such as decreasing one or more symptoms resulting from the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, enhancing effect of another medication such as via targeting, delaying the progression of the disease, and/or prolonging survival.
- a therapeutically effective amount refers to that amount of a drug, agent, component, composition, compound, substance, targeted agent, targeted therapeutic agent, therapeutic antibody, therapeutic agent, medicament or pharmaceutical composition which is effective to achieve one or more of the following results following the administration of one or more therapies: (1 ) reducing the size of the tumor, (2) reducing the number of cancer cells, (3) inhibiting (/. e.
- an amount of a CDK inhibitor is combined with an amount of a PD-1 axis binding antagonist, and optionally amounts of an 0X40 agonist and/or an amount of a 4-1 BB agonist, wherein the amounts together are effective in the treatment of cancer.
- an effective amount can be administered in one or more administrations.
- an effective amount is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly.
- an effective amount of a drug, compound or pharmaceutical composition may or may not be achieved in conjunction with another drug, agent, component, composition, compound, substance, targeted agent, targeted therapeutic agent, therapeutic antibody, therapeutic agent, medicament or pharmaceutical composition.
- an effective amount can be administered in one or more administrations.
- an effective amount of drug, compound, and/or pharmaceutical composition is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly.
- an effective amount of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition.
- an“effective amount” may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
- a therapeutic amount may also refer to a dosage of a drug that has been approved for use by a regulatory agency.
- a "subtherapeutic amount,” as used herein, refers to a dosage of a drug that is significantly lower than the approved dosage.
- treatment regimen “dosing protocol” and“dosing regimen” are used interchangeably to refer to the dose and timing of administration of each therapeutic agent in a combination of the invention.
- ameliorating refers to any observable beneficial effect of the treatment. Treatment need not be absolute to be beneficial to the subject. For example, ameliorating means a lessening or improvement of one or more symptoms of a disease, disorder or condition as compared to not administering a therapeutic agent of a method or regimen of the invention. Ameliorating also includes shortening or reduction in duration of a symptom.
- biosimilar refers to a biological product that is highly similar to an FDA- approved biological product (reference product) and has no clinically meaningful differences in terms of pharmacokinetics, safety and efficacy from the reference product.
- bioequivalent refers to a biological product that is pharmaceutically 5 equivalent and has a similar bioavailability to an FDA-approved biological product (reference product).
- bioequivalence is defined as "the absence of a significant difference in the rate and extent to which the active ingredient or active moiety in pharmaceutical equivalents or pharmaceutical alternatives becomes available at the site of drug action when administered at the same molar dose under similar conditions 10 in an appropriately designed study" (United States Food and Drug Administration, "Guidance for Industry: Bioavailability and Bioequicalence Studies for Orally Administered Drug Products - General Considerations," 2003, Center for Drug Evaluation and Research).
- biobetter refers a biological product that is in the same class as an FDA approved biological product (reference product) but is not identical and is improved in terms 15 of safety, efficacy, stability, etc. over the reference product.
- Tumor as it applies to a subject diagnosed with, or suspected of having, a cancer refers to a malignant or potentially malignant neoplasm or tissue mass of any size and includes primary tumors and secondary neoplasms.
- a solid tumor is an abnormal growth or mass of tissue that usually does not contain cysts or liquid areas. Examples of solid tumors are sarcomas, carcinomas, and lymphomas.
- Leukemia cancers of the blood
- Leukemia burden also referred to as a“tumor load’, refers to the total amount of tumor material distributed throughout the body.
- Tumor burden refers to the total number of cancer cells or the total size of tumor(s), throughout the body, including lymph nodes and bone marrow. Tumor burden can be determined by a variety of methods known in the art, such as, e.g., using calipers, or while in the body using imaging techniques, e.g., ultrasound, bone scan, computed tomography (CT), or magnetic resonance imaging (MRI) scans.
- imaging techniques e.g., ultrasound, bone scan, computed tomography (CT), or magnetic resonance imaging (MRI) scans.
- tumor size refers to the total size of the tumor which can be measured as the length and width of a tumor. Tumor size may be determined by a variety of methods known in the art, such as, e.g., by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., bone scan, ultrasound, CR or MRI scans.
- imaging techniques e.g., bone scan, ultrasound, CR or MRI scans.
- additive is used to mean that the result of the combination of two or more agents is no greater than the sum of each agent individually.
- the combination of agents described herein displays a synergistic effect.
- the term“synergy” or“synergistic” are used to mean that the result of the combination of two or more agents is greater than the sum of each agent individually. This improvement in the disease, condition or disorder being treated is a“synergistic” effect.
- A“synergistic amount” is an amount of the combination of the two or more agents that results in a synergistic effect, as “synergistic” is defined herein.
- A“synergistic combination” refers to a combination of agents which produces a synergistic effect in vivo, or alternatively in vitro as measured according to the methods described herein.
- the optimum range for the effect and absolute dose ranges of each agent for the effect may be definitively measured by administration of the agents over different dose ranges, and/or dose ratios to subjects in need of treatment.
- the observation of synergy in in vitro models or in vivo models can be predictive of the effect in humans and other species and in vitro models or in vivo models exist, as described herein, to measure a synergistic effect.
- the results of such studies can also be used to predict effective dose and plasma concentration ratio ranges and the absolute doses and plasma concentrations required in humans and other species such as by the application of pharmacokinetic and / or pharmacodynamics methods.
- A“nonstandard clinical dosing regimen,” as used herein, refers to a regimen for administering a substance, agent, compound or composition, which is different to the amount, dose or schedule typically used for that substance, agent, compound or composition in a clinical setting.
- A“non-standard clinical dosing regimen,” includes a “non-standard clinical dose” or a“nonstandard dosing schedule”.
- A“low dose amount regimen,” as used herein, refers to a dosing regimen where one or more of the substances, agents, compounds or compositions in the regimen are dosed at a lower amount or dose than typically used in a clinical setting for that agent, for example when that agent is dosed as a singleton therapy.
- pharmaceutically acceptable salt refers to pharmaceutically acceptable organic or inorganic salts of a compound of the invention. Some embodiments also relate to the pharmaceutically acceptable acid addition salts of the compounds described herein. Suitable acid addition salts are formed from acids which form non-toxic salts.
- Non-limiting examples of suitable acid addition salts include, but are not limited to, the acetate, acid citrate, adipate, aspartate, benzoate, besylate, bicarbonate/carbonate, bisulphate/sulphate, bitartrate, borate, camsylate, citrate, cyclamate, edisylate, esylate, ethanesulfonate, formate, fumarate, gluceptate, gluconate, glucuronate, hexafluorophosphate, hibenzate, hydrochloride/chloride, hydrobromide/bromide, hydroiodide/iodide, isethionate, lactate, malate, maleate, malonate, methanesulfonate, methylsulphate, naphthylate, 2-napsylate, nicotinate, nitrate, orotate, oxalate,
- Suitable base addition salts are formed from bases which form non-toxic salts.
- suitable base salts include the aluminum, arginine, benzathine, calcium, choline, diethylamine, diolamine, glycine, lysine, magnesium, meglumine, olamine, potassium, sodium, tromethamine and zinc salts.
- the compounds described herein that are basic in nature are capable of forming a wide variety of salts with various inorganic and organic acids.
- the acids that may be used to prepare pharmaceutically acceptable acid addition salts of such basic compounds described herein are those that form non-toxic acid addition salts, e.g., salts containing pharmacologically acceptable anions, such as the hydrochloride, hydrobromide, hydroiodide, nitrate, sulfate, bisulfate, phosphate, acid phosphate, isonicotinate, acetate, lactate, salicylate, citrate, acid citrate, tartrate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfon
- the chemical bases that may be used as reagents to prepare pharmaceutically acceptable base salts of those compounds described herein that are acidic in nature are those that form non-toxic base salts with such compounds.
- Such non-toxic base salts include but are not limited to those derived from such pharmacologically acceptable cations such as alkali metal cations (e.g., potassium and sodium) and alkaline earth metal cations (e.g., calcium and magnesium), ammonium or water-soluble amine addition salts such as N-methylglucamine-(meglumine), and the lower alkanolammonium and other base salts of pharmaceutically acceptable organic amines.
- Hemisalts of acids and bases may also be formed, for example, hemisulphate and hemicalcium salts.
- Carriers include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or subject being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
- physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
- buffers such as phosphate, citrate, and other organic acids
- antioxidants including ascorbic acid
- proteins such as serum albumin,
- solvate is used herein to describe a molecular complex comprising a compound described herein and one or more pharmaceutically acceptable solvent molecules, for example, water and ethanol.
- the compounds described herein may also exist in unsolvated and solvated forms. Accordingly, some embodiments relate to the hydrates and solvates of the compounds described herein.
- tautomeric isomerism (‘tautomerism’) can occur. This can take the form of proton tautomerism in compounds described herein containing, for example, an imino, keto, or oxime group, or so-called valence tautomerism in compounds which contain an aromatic moiety. A single compound may exhibit more than one type of isomerism.
- the compounds of the embodiments described herein include all stereoisomers (e.g., cis and trans isomers) and all optical isomers of compounds described herein (e.g., R and S enantiomers), as well as racemic, diastereomeric and other mixtures of such isomers. While all stereoisomers are encompassed within the scope of our claims, one skilled in the art will recognize that particular stereoisomers may be preferred.
- the compounds described herein can exist in several tautomeric forms, including the enol and imine form, and the keto and enamine form and geometric isomers and mixtures thereof. All such tautomeric forms are included within the scope of the present embodiments. Tautomers exist as mixtures of a tautomeric set in solution. In solid form, usually one tautomer predominates. Even though one tautomer may be described, the present embodiments include all tautomers of the present compounds.
- Stereoisomers include all stereoisomers, geometric isomers and tautomeric forms of the compounds described herein, including compounds exhibiting more than one type of isomerism, and mixtures of one or more thereof.
- acid addition or base salts wherein the counterion is optically active for example, d-lactate or l-lysine, or racemic, for example, dl-tartrate or dl-arginine.
- the present embodiments also include atropisomers of the compounds described herein.
- Atropisomers refer to compounds that can be separated into rotationally restricted isomers.
- Cis/trans isomers may be separated by conventional techniques well known to those skilled in the art, for example, chromatography and fractional crystallization.
- the racemate (or a racemic precursor) may be reacted with a suitable optically active compound, for example, an alcohol, or, in the case where a compound described herein contains an acidic or basic moiety, a base or acid such as 1 - phenylethylamine or tartaric acid.
- a suitable optically active compound for example, an alcohol, or, in the case where a compound described herein contains an acidic or basic moiety, a base or acid such as 1 - phenylethylamine or tartaric acid.
- the resulting diastereomeric mixture may be separated by chromatography and/or fractional crystallization and one or both of the diastereoisomers converted to the corresponding pure enantiomer(s) by means well known to a skilled person.
- Embodiments of the present invention comprise a CDK inhibitor.
- CDKs and related serine/threonine kinases are important cellular enzymes that perform essential functions in regulating cell division and proliferation.
- the CDK inhibitor is an inhibitor of CDK4/6 (CDK4/6 inhibitor or CDK4/6i) or an inhibitor of CDK2/4/6 (CDK2/4/6 inhibitor or CDK2/4/6i).
- the CDK2/4/6 inhibitor is 6-(difluoromethyl)-8-((1 R,2R)- 2-hydroxy-2-methylcyclopentyl)-2-(1 -(methylsulfonyl)piperidin-4-ylamino)pyrido[2,3- d]pyrimidin-7(8H)-one (PF-06873600), or a pharmaceutically acceptable salt thereof.
- the CDK4/6 inhibitor is palbociclib, or a pharmaceutically acceptable salt thereof.
- Palbociclib refers to 6-acetyl-8-cyclopentyl-5-methyl-2-(5- piperazin-1 -yl-pyridin-2-ylamino)-8/-/-pyrido[2,3-d]pyrimidin-7-one, or a pharmaceutically acceptable salt thereof.
- Embodiments of the present invention comprise a PD-1 axis binding antagonist.
- PD-1 axis binding antagonist refers to a molecule that inhibits the interaction of a PD-1 axis binding partner (e.g., PD- 1 , PD-L1 , PD-L2) with either one or more of its binding partners, for example so as to overcome or partially overcome T-cell dysfunction resulting from signaling on the PD-1 signaling axis— with a result being to restore, partially restore or enhance T-cell function (e.g., proliferation, cytokine production, target cell killing, survival).
- a PD- 1 axis binding antagonist includes one or more of (i) a PD-1 binding antagonist, (ii) a PD- L1 binding antagonist, and/or (iii) a PD-L2 antagonist.
- PD-1 binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-1 with one or more of its binding partners, such as PD-L1 , PD-L2.
- the PD-1 binding antagonist is a molecule that inhibits the binding of PD-1 to its binding partners.
- the PD-1 binding antagonist inhibits the binding of PD-1 to PD-L1 and/or PD-L2.
- PD-1 binding antagonists include anti-PD-1 antibodies, antigen binding fragments thereof, immunoadhesins, fusion proteins, oligopeptides and other molecules that decrease, block, inhibit, abrogate or interfere with signal transduction resulting from the interaction of PD-1 with PD-L1 and/or PD-L2.
- a PD-1 binding antagonist reduces the negative co stimulatory signal mediated by or through cell surface proteins expressed on T lymphocytes mediated signaling through PD-1 so as to render a dysfunctional T-cell less non-dysfunctional.
- the PD-1 binding antagonist is an anti-PD-1 antibody (aPD-1 ).
- a PD-1 binding antagonist is nivolumab.
- a PD-1 binding antagonist is pembrolizumab.
- a PD-1 binding antagonist is pidilizumab.
- the PD-1 binding antagonist useful for this invention is selected from the group consisting of MDX-1 106 (nivolumab), MK-3475 (pembrolizumab), CT-01 1 (pidilizumab), MEDI-0680 (AMP-514), REGN-2810 (cemiplimab), mAb7 (RN888), mAb15, AMP-224 (B7-DCIg), and AGEN-2034w spartalizumab.
- Exemplary PD-1 binding antagonists include those described in U.S. Patent Application Publication 20130280265, U.S. Patent Application Publication 20130237580, U.S. Patent Application Publication 20130230514, U.S. Patent Application Publication 20130109843, U.S. Patent Application Publication 20130108651 , U.S. Patent Application Publication 20130017199, U.S. Patent Application Publication 20120251537, U.S. Patent Application Publication 201 10271358, European Patent EP2170959B1 , in PCT Publication No. WO 201 1/066342, PCT Publication No. WO 2015/035606, PCT
- exemplary PD-1 binding antagonists are described in Curran et al., PD-1 and CTLA-4 combination blockade expands infiltrating T cells and reduces regulatory T and myeloid cells within B16 melanoma tumors, PNAS, 2010, 107, 4275; Topalian et al., Safety, activity, and immune correlates of anti-PD-1 antibody in cancer, New Engl. J. Med.
- the term“PD-L1 binding antagonist,” as used herein, refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-L1 with either one or more of its binding partners, such as PD-1 , B7-1 .
- the PD-1 axis binding antagonist comprises a PD-L1 binding antagonist.
- the PD-L1 binding antagonist inhibits the binding of PD-L1 to its binding partners.
- the PD-L1 binding antagonist inhibits the binding of PD-L1 to PD-1 .
- the PD-L1 binding antagonist inhibits the binding of PD-L1 to PD-1 and/or B7-1.
- the PD-L1 binding antagonist inhibits the binding of PD-L1 to both PD-1 and B7-1 .
- the PD-L1 binding antagonists include anti-PD-L1 antibodies, antigen binding fragments thereof, immunoadhesins, fusion proteins, oligopeptides and other molecules that decrease, block, inhibit, abrogate or interfere with signal transduction resulting from the interaction of PD-L1 with one or more of its binding partners, such as PD-1 , and/or B7-1 .
- a PD-L1 binding antagonist reduces the negative co-stimulatory signal mediated by or through cell surface proteins expressed on T lymphocytes mediated signaling through PD-L1 so as render a dysfunctional T-cell less non-dysfunctional.
- a PD-L1 binding antagonist is an anti-PD-L1 antibody (aPD-L1 ).
- the PD-L1 antibody is a biosimilar, biobetter, or bioequivalent thereof.
- the anti-PD-L1 antibody is BMS-936559 (MDX-1 105), AMP-714, atezolizumab (MPDL3280A), durvalumab (MEDI4736), avelumab, or an antibody comprising a VH region produced by the expression vector with ATCC Accession No. PTA-121 183 and having the VL region produced by the expression vector with ATCC Accession No. PTA-121 182, or a combination thereof.
- the PD-L1 binding antagonist is selected from the group consisting of YW243.55.S70, BMS-936559 (MDX-1 105), AMP-714, atezolizumab (MPDL3280A), durvalumab (MEDI4736), avelumab, and an antibody comprising a VH region produced by the expression vector with ATCC Accession No. PTA-121 183 and having the VL region produced by the expression vector with ATCC Accession No. PTA- 121 182.
- Some exemplary PD-L1 binding antagonists include those described in U.S. Patent Application Publication 20090055944, U.S. Patent Application Publication 20100203056, U.S. Patent Application Publication 20120039906, U.S. Patent Application Publication 20130045202, U.S. Patent Application Publication 20130309250, U.S. Patent Application Publication US20130034559, U.S. Patent Application Publication US20150282460, U.S. Patent Application Publication 20160108123, PCT Publication No. WO 201 1/066389, PCT Publication No. WO 2016/000619, PCT Publication No. WO 2016/094273, PCT Publication No. WO 2016/061 142, PCT Publication No.
- PD-L2 binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-L2 with either one or more of its binding partners, such as PD-1 .
- a PD-L2 binding antagonist is a molecule that inhibits the binding of PD-L2 to its binding partners.
- the PD-L2 binding antagonist inhibits binding of PD-L2 to PD-1 .
- the PD-L2 antagonists include anti-PD- L2 antibodies, antigen binding fragments thereof, immunoadhesins, fusion proteins, oligopeptides and other molecules that decrease, block, inhibit, abrogate or interfere with signal transduction resulting from the interaction of PD-L2 with either one or more of its binding partners, such as PD-1 .
- a PD-L2 binding antagonist reduces the negative co-stimulatory signal mediated by or through cell surface proteins expressed on T lymphocytes mediated signaling through PD-L2 so as render a dysfunctional T-cell less non-dysfunctional.
- a PD-L2 binding antagonist is a PD-L2 immunoadhesin.
- the PD-1 axis binding antagonist (e.g., PD-1 binding antagonist, PD-L1 binding antagonist, or PD-L2 binding antagonist) is a small molecule antagonist.
- the PD-1 axis binding antagonist (e.g., PD-L1 binding antagonist) is a chemical compound disclosed in PCT Publication No. WO 2015/033299 or PCT Publication No. WO 2015/033301 or a pharmaceutically acceptable salt thereof, for example, a chemical compound selected from Compound 1 to 25 in Table 2, or a pharmaceutically acceptable salt thereof.
- the PD-1 axis binding antagonist (e.g., PD-L1 binding antagonist) is Compound Number 12 in Table 2, i.e., (((S)-3-amino-1 -(3-((S)-1 - amino-2-hydroxyethyl)-1 ,2,4-oxadiazol-5-yl)-3-oxopropyl)carbamoyl)-L-allothreonine of formula:
- the PD-1 axis binding antagonist e.g ., PD-L1 binding antagonist
- the PD-1 axis binding antagonist is 2-(3-(3-amino-1-(3-(1-amino-2-hydroxyethyl)-1 ,2,4-oxadiazol-5-yl)-3- oxopropyl)ureido)-3-hydroxybutanoic acid:
- Table 3 below provides a list of the amino acid sequences of exemplary PD-1 axis binding antagonists for use in the treatment method, medicaments and uses of the present invention.
- CDRs are underlined for mAb7 and mAb15.
- the mAB7 is also known as RN888 or PF-6801591.
- mAb7 (aka RN888) and mAb15 are disclosed in PCT Publication No. WO 2016/092419, the disclosure of which is hereby incorporated by reference in its entirety.
- Table 3 below provides a list of the amino acid sequences of exemplary PD-1 axis binding antagonists for use in the treatment method, medicaments and uses of the present invention.
- CDRs are underlined for mAb7 and mAb15.
- the mAB7 is also known as RN888 or PF-6801591.
- mAb7 (aka RN888) and mAb15 are disclosed in PCT Publication No. WO 2016/092419, the disclosure of which is
- an anti-human PD-L1 mAb refers to a monoclonal antibody that specifically binds to mature human PD-L1.
- a mature human PD-L1 molecule consists of amino acids 19-290 of the following sequence MRIFAVFIFMTYWHLLNAFTVTVPKDLYWEYGSNMTIECKFPVEKQLDLAALIVYWEM EDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISY GGADYKRITVKVNAPYNKINQRILWDPVTSEHELTCQAEGYPKAEVIWFSSDHQVLS GKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPN ERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET (SEQ ID NO: 33).
- Table 4 below provides exemplary anti-PD-L1 antibody sequences for use in the treatment method, medicaments and uses of the present invention.
- the PD-1 axis binding antagonist is avelumab and will be administered intravenously at a dose of about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19 or 20 mg/kg at intervals of about 14 days ( ⁇ 2 days) or about 21 days ( ⁇ 2 days) or about 30 days ( ⁇ 2 days) throughout the course of treatment.
- avelumab is administered as a flat dose of about 80, 150, 160, 200, 240, 250, 300, 320, 350, 400, 450, 480, 500, 550, 560, 600, 640, 650, 700, 720, 750, 800, 850, 880, 900, 950, 960, 1000, 1040, 1050, 1 100, 1 120, 1 150, 1200, 1250, 1280, 1300, 1350, 1360, 1400, 1440, 1500, 1520, 1550 or 1600 mg, preferably 800 mg, 1200 mg or 1600 mg at intervals of about 14 days ( ⁇ 2 days) or about 21 days ( ⁇ 2 days) or about 30 days ( ⁇ 2 days) throughout the course of treatment.
- a subject will be administered an intravenous (IV) infusion of a medicament comprising any of the PD-1 axis binding antagonists described herein.
- the subject will be administered a subcutaneous (SC) infusion of a medicament comprising any of the PD-1 axis binding antagonist described herein.
- the PD-1 axis binding antagonist is RN888 and will be administered subcutaneously at a dose of about 1 , 2, 3, 4, 5, 6, 7 or 8 mg/kg at intervals of about 14 days ( ⁇ 2 days) or about 21 days ( ⁇ 2 days) or about 30 days ( ⁇ 2 days) throughout the course of treatment.
- RN888 is administer as a flat dose of about 80, 150, 160, 200, 240, 250, 300, 320, 350, 400, preferably 300mg at intervals of about 14 days ( ⁇ 2 days) or about 21 days ( ⁇ 2 days) or about 30 days ( ⁇ 2 days).
- RN888 is administered subcutaneously in an amount of 300 mg Q4W.
- PD-1 antagonist means any chemical compound or biological molecule that blocks binding of PD-L1 expressed on a cancer cell to PD-1 expressed on an immune cell (T cell, B cell or NKT cell) and preferably also blocks binding of PD-L2 expressed on a cancer cell to the immune-cell expressed PD-1 .
- Alternative names or synonyms for PD-1 and its ligands include: PDCD1 , PD1 , CD279 and SLEB2 for PD-1 ; PDCD1 L1 , PDL1 , B7H1 , B7-4, CD274 and B7-H for PD-L1 ; and PDCD1 L2, PDL2, B7-DC, Btdc and CD273 for PD-L2.
- the PD-1 antagonist may block binding of human PD-L1 to human PD-1 , and block binding of both human PD-L1 and PD-L2 to human PD-1.
- Exemplary human PD-1 amino acid sequences can be found in NCBI Locus No.: NP_005009.
- Exemplary human PD-L1 and PD-L2 amino acid sequences can be found in NCBI Locus No.: NP_054862 and NP_079515, respectively.
- PD-1 antagonists useful in any of the treatment methods, medicaments and uses of the present invention include a monoclonal antibody (mAb), or antigen binding fragment thereof, which specifically binds to PD-1 or PD-L1 , and preferably specifically binds to human PD-1 or human PD-L1.
- the mAb may be a human antibody, a humanized antibody or a chimeric antibody, and may include a human constant region.
- the human constant region is selected from the group consisting of lgG1 , lgG2, lgG3 and lgG4 constant regions, and in some embodiments, the human constant region is an lgG1 or lgG4 constant region.
- the antigen binding fragment is selected from the group consisting of Fab, Fab'-SH, F(ab')2, scFv and Fv fragments.
- Specific anti-human PD-1 mAbs useful as the PD-1 antagonist in the treatment method, medicaments and uses of the present invention include: nivolumab (MDX 1 106), pembrolizumab (MK-3475), pidilizumab (CT-01 1 ), cemiplimab (REGN2810), tislelizumab (BGB-A317), spartalizumab (PDR001 ), RN888, mAb15, MEDI-0680 (AMP-514), BGB-108, or AGEN-2034, or a combination thereof.
- Table 5 below provides exemplary anti-PD-1 antibody sequences for use in the treatment method, medicaments and uses of the present invention.
- Certain embodiments of the present invention comprise an 0X40 agonist.
- the term“0X40 agonist” or“0X40 binding agonist,” as used herein, means, any chemical compound or biological molecule, as defined herein, which upon binding to 0X40, (1 ) stimulates or activates 0X40, (2) enhances, increases, promotes, induces, or prolongs an activity, function, or presence of 0X40, or (3) enhances, increases, promotes, or induces the expression of 0X40.
- 0X40 agonists useful in the any of the treatment method, medicaments and uses of the present invention include a monoclonal antibody (mAb), or antigen binding fragment thereof, which specifically binds to 0X40.
- the 0X40 agonists increase an OX40-mediated response.
- medicaments and uses of the present invention markedly enhance cytotoxic T-cell responses, resulting in antitumor activity in several models.
- An 0X40 agonist includes, for example, an 0X40 agonist antibody (e.g., an anti human 0X40 agonist antibody), an OX40L agonist fragment, an 0X40 oligomeric receptor, and an 0X40 immunoadhesin.
- an 0X40 agonist antibody e.g., an anti human 0X40 agonist antibody
- an OX40L agonist fragment e.g., an anti human 0X40 agonist antibody
- OX40L agonist fragment e.g., an anti human 0X40 agonist antibody
- OX40L agonist fragment e.g., an anti human 0X40 agonist antibody
- OX40L agonist fragment e.g., an anti human 0X40 agonist antibody
- an OX40L agonist fragment e.g., an OX40L agonist fragment
- an 0X40 oligomeric receptor e.g., an anti human 0X40 agonist antibody
- 0X40 antibody means an antibody, as defined herein, capable of binding to 0X40 receptor (e.g., human 0X40 receptor).
- 0X40 receptor e.g., human 0X40 receptor.
- the terms“0X40” and“0X40 receptor” are used interchangeably in the present application, and refer to any form of 0X40 receptor, as well as variants, isoforms, and species homologs thereof that retain at least a part of the activity of 0X40 receptor. Accordingly, a binding molecule, as defined and disclosed herein, may also bind 0X40 from species other than human.
- a binding molecule may be completely specific for the human 0X40 and may not exhibit species or other types of cross reactivity.
- 0X40 includes all mammalian species of native sequence 0X40, e.g., human, canine, feline, equine and bovine.
- One exemplary human 0X40 is a 277 amino acid protein (UniProt Accession No. P43489).
- An 0X40 agonist antibody means, any antibody, as defined herein, which upon binding to 0X40, (1 ) stimulates or activates 0X40, (2) enhances, increases, promotes, induces, or prolongs an activity, function, or presence of 0X40, or (3) enhances, increases, promotes, or induces the expression of 0X40.
- 0X40 agonists useful in the any of the treatment method, medicaments and uses of the present invention include a monoclonal antibody (mAb) which specifically binds to 0X40 (e.g., anti-OX40 agonist antibody).
- mAb monoclonal antibody
- the 0X40 agonist antibody increases CD4+ effector T cell proliferation and/or increases cytokine production by the CD4+ effector T cell as compared to proliferation and/or cytokine production prior to treatment with the 0X40 agonist antibody.
- the cytokine is IFN-y.
- the 0X40 agonist antibody increases memory T cell proliferation and/or increasing cytokine production by the memory cell.
- the cytokine is IFN-y.
- the 0X40 agonist antibody inhibits Treg suppression of effector T cell function.
- effector T cell function is effector T cell proliferation and/or cytokine production.
- the effector T cell is a CD4+ effector T cell.
- the 0X40 agonist antibody increases 0X40 signal transduction in a target cell that expresses 0X40. In some embodiments, 0X40 signal transduction is detected by monitoring NFkB downstream signaling.
- the anti-human 0X40 agonist antibody is a depleting anti human 0X40 antibody (e.g., depletes cells that express human 0X40).
- the human 0X40 expressing cells are CD4+ effector T cells.
- the human 0X40 expressing cells are Treg cells.
- depleting is by ADCC and/or phagocytosis.
- the antibody mediates ADCC by binding FcyR expressed by a human effector cell and activating the human effector cell function.
- the antibody mediates phagocytosis by binding FcyR expressed by a human effector cell and activating the human effector cell function.
- Exemplary human effector cells include, e.g., macrophage, natural killer (NK) cells, monocytes, neutrophils.
- the human effector cell is macrophage.
- the anti-human 0X40 agonist antibody has a functional Fc region.
- effector function of a functional Fc region is ADCC.
- effector function of a functional Fc region is phagocytosis.
- effector function of a functional Fc region is ADCC and phagocytosis.
- the Fc region is human lgG-1 .
- the Fc region is human lgG-4.
- the anti-human 0X40 agonist antibody is a human or humanized antibody.
- an anti-OX40 antibody useful in the treatment, method, medicaments and uses disclosed herein is a fully human agonist monoclonal antibody comprising a heavy chain variable region and a light chain variable region comprising the amino acid sequences shown in SEQ ID NO: 54 and SEQ ID NO: 55, respectively.
- the anti-OX40 antibody is a fully human lgG-2 or lgG-1 antibody.
- Table 6 below provides exemplary anti-OX40 monoclonal antibody sequences for use in the treatment method, medicaments and uses of the present invention.
- 4-1 BB Agonists comprise a 4-1 BB binding agonist.
- 4-1 BB agonists useful in any of the treatment method, medicaments and uses of the present invention include a monoclonal antibody (mAb), or antigen binding fragment thereof, which specifically binds to 4-1 BB.
- mAb monoclonal antibody
- 4-1 BB alternatives names or synonyms for 4-1 BB include CD137 and TNFRSF9.
- the 4-1 BB agonists increase a 4-1 BB-mediated response.
- 41 BB agonists markedly enhance cytotoxic T-cell responses, resulting in antitumor activity in several models.
- 4-1 BB antibody means an antibody, as defined herein, capable of binding to 4-1 BB receptor (e.g., human 4-1 BB receptor).
- binding molecule may also bind 4-1 BB from species other than human. In other cases, a binding molecule may be completely specific for the human 4-1 BB and may not exhibit species or other types of cross reactivity. Unless indicated differently, such as by specific reference to human 4-1 BB.
- 4- 1 BB includes all mammalian species of native sequence of 4-1 BB, e.g., human, canine, feline, equine and bovine.
- 4-1 BB is a 255 amino acid protein (Accession No. NM_001561 ; NP_001552).
- 4-1 BB comprises a signal sequence (amino acid residues 1 -17), followed by an extracellular domain (169 amino acids), a transmembrane region (27 amino acids), and an intracellular domain (42 amino acids) (Cheuk ATC et al., 2004 Cancer Gene Therapy 1 1 : 215-226).
- the receptor is expressed on the cell surface in monomer and dimer forms and likely trimerizes with 4-1 BB ligand to signal.
- Human 4-1 BB comprises a signal sequence (amino acid residues 1 -17), followed by an extracellular domain (169 amino acids), a transmembrane region (27 amino acids), and an intracellular domain (42 amino acids) (Cheuk ATC et al., Cancer Gene Therapy 2004, 11 : 215-226).
- the receptor is expressed on the cell surface in monomer and dimer forms and likely trimerizes with 4-1 BB ligand to signal.
- an anti-4-1 BB antibody useful in the treatment, method, medicaments and uses disclosed herein is a fully humanized lgG-2 agonist monoclonal antibody comprising a heavy chain variable region and a light chain variable region comprising the amino acid sequences shown in SEQ ID NO: 64 and SEQ ID NO: 65, respectively.
- Table 7 below provides exemplary anti-4-1 BB monoclonal antibody sequences for use in the treatment method, medicaments and uses of the present invention.
- Monoclonal, polyclonal, and humanized antibodies can be prepared (e.g., Sheperd and Dean (eds.) Monoclonal Antibodies, 2000; Kontermann and Dubel (eds.) Antibody Engineering, 2001 ; Harlow and Lane, Antibodies A Laboratory Manual, 1988, pp. 139-243; Carpenter, et al., Non-Fc receptor-binding humanized anti-CD3 antibodies induce apoptosis of activated human T cells, J. Immunol. 2000, 165:6205; He, et al., Humanization and pharmacokinetics of a monoclonal antibody with specificity for both E- and P-selectin,J. Immunol.
- mice An alternative to humanization is to use human antibody libraries displayed on phage or human antibody libraries in transgenic mice (Vaughan et al., Human antibodies with sub-nanomolar affinities isolated from a large non-immunized phage display library, Nature Biotechnol. 1996, 14:309-314; Barbas , Synthetic human antibodies, Nature Medicine 1995, 1 :837-839; Mendez et al., Functional transplant of megabase human immunoglobulin loci recapitulates human antibody response in mice, Nature Genetics 1997, 15:146-156; Hoogenboom and Chames, Natural and designer binding sites made by phage display technology, Immunol.
- Animals can be immunized with cells bearing the antigen of interest. Splenocytes can then be isolated from the immunized animals, and the splenocytes can be fused with a myeloma cell line to produce a hybridoma (e.g ., Meyaard, L, et.
- a hybridoma e.g ., Meyaard, L, et.
- Antibodies can be conjugated, e.g., to small drug molecules, enzymes, liposomes, polyethylene glycol (PEG). Antibodies are useful for therapeutic, diagnostic, kit or other purposes, and include antibodies coupled, e.g., to dyes, radioisotopes, enzymes, or metals, e.g., colloidal gold (e.g., Le Doussal et al., Enhanced in vivo targeting of an asymmetric bivalent hapten to double-antigen-positive mouse B cells with monoclonal antibody conjugate cocktails, J. Immunol.
- colloidal gold e.g., Le Doussal et al.
- Fluorescent reagents suitable for modifying nucleic acids including nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g., as diagnostic reagents, are available (Molecular Probes, Catalogue, 2003; Sigma-Aldrich, Catalogue, 2003.
- the invention further provides therapeutic methods and uses comprising administering to the subject the combinations as described herein, optionally in further combination with other therapeutic or palliative agents.
- the invention provides a method for treating cancer comprising administering to a subject in need thereof an amount of a cyclin dependent kinase (CDK) inhibitor in combination with an amount of a PD-1 axis binding antagonist, wherein the amounts together are effective in treating cancer, and wherein the CDK inhibitor is an inhibitor of CDK4 and CDK6 (CDK4/6 inhibitor), or an inhibitor of CDK2, CDK4 and CDK6 (CDK2/4/6 inhibitor).
- CDK cyclin dependent kinase
- the invention is related to a method for treating cancer, further comprising administering to the subject an amount of: a. an 0X40 agonist; b. a 4- 1 BB agonist; or c. an 0X40 agonist and a 4-1 BB agonist; wherein the amounts together are effective in treating cancer.
- the 0X40 agonist is an anti-OX40 antibody.
- the 4-1 BB agonist is an anti-4-BB antibody.
- the treatment results in sustained response in the individual after cessation of the treatment.
- the methods of this invention may find use in treating conditions where enhanced immunogenicity is desired such as increasing tumor immunogenicity for the treatment of cancer. As such, a variety of cancers may be treated, or their progression may be delayed.
- the individual has cancer that is resistant (has been demonstrated to be resistant) to one or more PD-1 axis binding antagonists.
- resistance to PD-1 axis binding antagonist includes recurrence of cancer or refractory cancer. Recurrence may refer to the reappearance of cancer, in the original site or a new site, after treatment.
- resistance to PD-1 axis binding antagonist includes progression of the cancer during treatment with the PD-1 axis binding antagonist.
- resistance to PD-1 axis binding antagonist includes cancer that does not response to treatment. The cancer may be resistant at the beginning of treatment or it may become resistant during treatment. In some embodiments, the cancer is at early stage or at late stage.
- the PD-1 axis binding antagonist comprises a PD-1 binding antagonist, a PD-L1 binding antagonist, or a PD-L2 binding antagonist. In some such embodiments, the PD-1 axis binding antagonist comprises a PD-1 binding antagonist. In further embodiments of each of the foregoing, the PD-1 binding antagonist inhibits the binding of PD-1 to its ligand binding partners. In specific embodiments, the PD-1 binding antagonist inhibits the binding of PD-1 to PD-LI. In another embodiment, the PD-1 binding antagonist inhibits the binding of PD-1 to PD-L2. In a further embodiment, the PD-1 binding antagonist inhibits the binding of PD-1 to both PD-L1 and PD-L2.
- the PD-1 binding antagonist is AMP-224.
- the invention provides the PD-1 binding antagonist is an anti-PD-1 antibody.
- the anti-PD-1 antibody is a biosimilar, biobetter, or bioequivalent thereof.
- the anti-PD-1 antibody is nivolumab (MDX 1 106), pembrolizumab (MK-3475), pidilizumab (CT-01 1 ), cemiplimab (REGN2810), tislelizumab (BGB-A317), spartalizumab (PDR001 ), RN888, mAb15, MEDI-0680 (AMP-514), BGB-108, or AGEN-2034, or a combination thereof.
- the PD-1 axis binding antagonist comprises a PD-L1 binding antagonist.
- the PD-L1 binding antagonist inhibits the binding of PD-L1 to PD-1 .
- the PD-L1 binding antagonist inhibits the binding of PD-L1 to B7-1 .
- the PD-L1 binding antagonist inhibits the binding of PD-L1 to both PD-1 and B7-1 .
- the PD-L1 binding antagonist is an anti-PD-L1 antibody.
- the anti-PD-L1 antibody is a biosimilar, biobetter, or bioequivalent thereof.
- the anti-PD-L1 antibody is BMS-936559 (MDX-1 105), AMP-714, atezolizumab (MPDL3280A), durvalumab (MEDI4736), avelumab, or an antibody comprising a VH region produced by the expression vector with ATCC Accession No. PTA-121 183 and having the VL region produced by the expression vector with ATCC Accession No. PTA-121 182, or a combination thereof.
- the 0X40 agonist is an anti-OX40 antibody, an OX40L agonist fragment, an 0X40 oligomeric receptor, a trimeric OX40L-Fc protein or an 0X40 immunoadhesin, or a combination thereof.
- the 0X40 agonist antibody binds human 0X40.
- the anti-OX40 antibody is any one of the anti-human 0X40 antibodies disclosed herein.
- the 0X40 agonist is an anti-OX40 antibody.
- the anti-OX40 antibody is a biosimilar, biobetter, or bioequivalent thereof.
- the anti-OX40 antibody is MEDI6469, MEDI0562, MEDI6383, MOXR0916, or GSK3174998, or a combination thereof.
- the anti-OX40 antibody is a full-length human lgG-1 antibody.
- the 0X40 agonist is an OX40L agonist fragment comprising one or more extracellular domains of OX40L.
- the 4-1 BB agonist is an anti-4-1 BB antibody.
- the anti-4-1 BB antibody is a biosimilar, biobetter, or bioequivalent thereof.
- the 4-1 BB agonist is utomilumab (PF-05082566), 1 D8, 3Elor, 4B4, H4-1 BB-M127, BBK2, 145501 , antibody produced by cell line deposited as ATCC No.
- the antibody against PD-L1 , PD-1 , 0X40, and/or 4-1 BB may incorporated into a multi-specific antibody (e.g., a bispecific antibody).
- a bispecific antibody comprises a first antibody variable domain and a second antibody variable domain, wherein the first antibody variable domain is capable of recruiting the activity of a human immune effector cell by specifically binding to an effector antigen located on the human immune effector cell, and wherein the second antibody variable domain is capable of specifically binding to a target antigen as provided herein.
- the antibody has an lgG1 , lgG2, lgG3, or lgG4 isotype.
- the antibody comprises an immunologically inert Fc region.
- the antibody is a human antibody or humanized antibody.
- the bispecific antibody provided herein binds to two different target antigens on the same target cell (e.g., two different antigens on the same tumor cell). Such antibodies may be advantageous, for example, for having increased specificity for a target cell of interest (e.g ., for a tumor cell that expresses two particular tumor associated antigens of interest).
- a bispecific antibody provided herein comprises a first antibody variable domain and a second antibody variable domain, wherein the first antibody variable domain is capable of specifically binding to a first target antigen as provided herein and the second antibody variable domain is capable of specifically binding to a second target antigen as provided herein.
- the first target antigen is PD-L1 and the second target antigen is CD47.
- mAbs that bind to human PD-L1 and that may be used in bispecific anti-PD-L1 / anti-CD47 antibodies include antibodies described in WO 2013/079174, WO 2015/061668, WO 2010/08941 1 , WO 2007/005874, WO 2010/036959, WO 2014/100079, WO 2013/019906, WO 2010/077634, and U.S. Patent Nos. 8,552, 154, 8779,108, and 8,383,796.
- Examples of mAbs that bind to CD47 and that may be used in bispecific anti-PD-L1 / anti-CD47 antibodies include the anti-CD47 antibodies Hu5F9-G4 (Forty Seven Inc.), CC-90002 (Celgene), SRF231 , and B6H12.
- bispecific antibodies are known in the art (e.g., c).
- c Methods for making bispecific antibodies.
- the recombinant production of bispecific antibodies was based on the coexpression of two immunoglobulin heavy chain-light chain pairs, with the two heavy chains having different specificities (Millstein and Cuello, Hybrid hybridomas and their use in immunohistochemistry, Nature 1983, 305, 537-539).
- the CDK inhibitor is a CDK4/6 inhibitor.
- the CDK4/6 inhibitor is palbociclib, or a pharmaceutically acceptable salt thereof.
- the CDK inhibitor is a CDK2/4/6 inhibitor.
- the CDK2/4/6 inhibitor is 6-(difluoromethyl)-8-((1 R,2R)-2-hydroxy-2- methylcyclopentyl)-2-(1 -(methylsulfonyl)piperidin-4-ylamino)pyrido[2,3-d]pyrimidin- 7(8FI)-one, or a pharmaceutically acceptable salt thereof.
- the invention provides a method for treating a cancer in a subject comprising administering to the subject a combination therapy of the invention.
- the invention provides a method for treating a cancer comprising administering to a subject in need thereof an amount of a cyclin dependent kinase (CDK) inhibitor and an amount of a PD-1 axis binding antagonist, wherein the amounts together are effective in treating cancer, and wherein the CDK inhibitor is an inhibitor of CDK4 and CDK6 (CDK4/6 inhibitor), or an inhibitor of CDK2, CDK4 and CDK6 (CDK2/4/6 inhibitor).
- the subject is a human.
- the method involves the use of an inhibitor of CDK4 and CDK6 (CDK4/6 inhibitor), or an inhibitor of CDK2, CDK4 and CDK6 (CDK2/4/6 inhibitor) in combination with an anti-PD-L1 antibody.
- CDK4/6 inhibitor an inhibitor of CDK4 and CDK6
- CDK2/4/6 inhibitor an inhibitor of CDK2, CDK4 and CDK6
- the method involves the use of an inhibitor of CDK4 and CDK6 (CDK4/6 inhibitor), or an inhibitor of CDK2, CDK4 and CDK6 (CDK2/4/6 inhibitor) in combination with an anti-PD-L1 antibody and an anti-OX40 antibody.
- CDK4/6 inhibitor an inhibitor of CDK4 and CDK6
- CDK2/4/6 inhibitor an inhibitor of CDK2, CDK4 and CDK6
- the method involves the use of an inhibitor of CDK4 and CDK6 (CDK4/6 inhibitor), or an inhibitor of CDK2, CDK4 and CDK6 (CDK2/4/6 inhibitor) in combination with an anti-PD-L1 antibody and an anti-4-1 BB antibody.
- CDK4/6 inhibitor an inhibitor of CDK4 and CDK6
- CDK2/4/6 inhibitor an inhibitor of CDK2, CDK4 and CDK6
- the method involves the use of an inhibitor of CDK4 and CDK6 (CDK4/6 inhibitor), or an inhibitor of CDK2, CDK4 and CDK6 (CDK2/4/6 inhibitor) in combination with an anti-PD-L1 antibody, an anti-OX40 antibody and an anti-4-1 BB antibody.
- CDK4/6 inhibitor an inhibitor of CDK4 and CDK6
- CDK2/4/6 inhibitor an inhibitor of CDK2, CDK4 and CDK6
- the method involves the use of palbociclib, or a pharmaceutically acceptable salt thereof, in combination with avelumab.
- the method involves the use of 6-(difluoromethyl)-8- ((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 -(methylsulfonyl)piperidin-4- ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof, in combination with avelumab.
- the method involves the use of palbociclib, or a pharmaceutically acceptable salt thereof, in combination with avelumab and an anti- 0X40 antibody.
- the method involves the use of 6-(difluoromethyl)-8- ((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 -(methylsulfonyl)piperidin-4- ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof, in combination with avelumab and an anti-OX40 antibody.
- the method involves the use of palbociclib, or a pharmaceutically acceptable salt thereof, in combination with avelumab and utomilumab.
- the method involves the use of 6-(difluoromethyl)-8- ((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 -(methylsulfonyl)piperidin-4- ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof in combination with avelumab and utomilumab.
- the method involves the use of palbociclib, or a pharmaceutically acceptable salt thereof, in combination with avelumab, anti-OX40 antibody and utomilumab.
- the method involves the use of 6-(difluoromethyl)-8- ((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 -(methylsulfonyl)piperidin-4- ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof, in combination with avelumab, anti-OX40 antibody and utomilumab.
- the 0X40 agonist in the combination therapy comprises an anti-OX40 antibody comprising: a heavy chain variable region (VH) comprising a heavy chain complementarity determining region one (CDRH1 ), a heavy chain complementarity determining region two (CDRH2), a heavy chain complementarity determining region three (CDRH3), comprising the amino acid sequence shown in SEQ ID NO: 48, SEQ ID NO: 49 and SEQ ID NO: 50; and a light chain variable region (VL) comprising a light chain complementarity determining region one (CDRL1 ), a light chain complementarity determining region two (CDRL2), and a light chain complementarity determining region three (CDRL3), comprising the amino acid sequence shown in SEQ ID NO: 51 ; SEQ ID NO: 52 and SEQ ID NO: 53.
- VH heavy chain variable region
- CDRL1 light chain complementarity determining region one
- CDRL2 light chain complementarity determining region two
- CDRL3 light chain complementarity
- the anti-OX40 antibody comprises the CDRH1 comprising the amino acid sequence shown in SEQ ID NO: 48, the CDRH2 comprising the amino acid sequence shown in SEQ ID NO: 49, and the CDRH3 comprising the amino acid sequence shown in SEQ ID NO: 50; and/or the CDRL1 comprising the amino acid sequence shown in SEQ ID NO: 51 , the CDRL2 comprising the amino acid sequence shown in SEQ ID NO: 52, and the CDRL3 comprising the amino acid sequence shown in SEQ ID NO: 53.
- the anti-OX40 antibody comprises a VH and a VL, wherein the VH and the VL comprise SEQ ID NO: 54 and SEQ ID NO: 55, respectively.
- the 4-1 BB agonist in the combination therapy comprises an anti-4-1 BB monoclonal antibody comprising: a VH comprising a CDRH1 , a CDRH2, a CDRH3, comprising the amino acid sequence shown in SEQ ID NO: 58, SEQ ID NO: 59 and SEQ ID NO: 60; and a VL comprising a CDRL1 , a CDRL2, and a CDRL3, comprising the amino acid sequence shown in SEQ ID NO: 61 ; SEQ ID NO: 62 and SEQ ID NO: 63.
- the anti-4-1 BB antibody comprises the CDRH1 comprising the amino acid sequence shown in SEQ ID NO: 58, the CDRH2 comprising the amino acid sequence shown in SEQ ID NO: 59, and the CDRH3 comprising the amino acid sequence shown in SEQ ID NO: 60; and/or the CDRL1 comprising the amino acid sequence shown in SEQ ID NO: 61 , the CDRL2 comprising the amino acid sequence shown in SEQ ID NO: 62, and the CDRL3 comprising the amino acid sequence shown in SEQ ID NO: 63.
- the 4-1 BB agonist in the combination therapy comprises an anti-4-1 BB monoclonal antibody comprising a VH and a VL comprising the amino acid sequences shown in SEQ ID NO: 64 and SEQ ID NO: 65, respectively.
- the cancer is a solid tumor. In yet another embodiment, the cancer is a hematologic cancer.
- the invention is related to a method for treating cancer, wherein the cancer is selected from the group consisting of brain cancer, head/neck cancer (including squamous cell carcinoma of the head and neck (SCCHN)), prostate cancer, ovarian cancer, bladder cancer (including urothelial carcinoma, also known as transitional cell carcinoma (TCC)), lung cancer (including squamous cell carcinoma, small cell lung cancer (SCLC), and non-small cell lung cancer (NSCLC)), breast cancer, bone cancer, colorectal cancer, kidney cancer, liver cancer (including hepatocellular carcinoma (HOC)), stomach cancer, pancreatic cancer, esophageal cancer, cervical cancer, sarcoma, skin cancer (including melanoma and Merkel cell carcinoma (MCC)), multiple myeloma, mesothelioma, malignant rhabdoid tumors, neuroblastoma, diffuse intrinsic pontine glioma (DIPG), carcinoma, lymphoma, diffuse large B-cell lympho
- TCC transition
- the methods may further comprise an additional therapy.
- the additional therapy may be radiation therapy, surgery (e.g., lumpectomy and a mastectomy), chemotherapy, gene therapy, DNA therapy, viral therapy, RNA therapy, immunotherapy, bone marrow transplantation, nanotherapy, monoclonal antibody therapy, phototherapy, or a combination of the foregoing.
- the additional therapy may be in the form of adjuvant or neoadjuvant therapy.
- the additional therapy is the administration of small molecule enzymatic inhibitor or anti-metastatic agent.
- the additional therapy is the administration of side effect limiting agents (e.g., agents intended to lessen the occurrence and/or severity of side effects of treatment, such as anti-nausea agents, etc.).
- the additional therapy is radiation therapy.
- the additional therapy is surgery.
- the additional therapy is a combination of radiation therapy and surgery.
- the CDK inhibitor, the PD-1 axis binding antagonist, 0X40 agonist and/or 4-1 BB agonist may be administered by the same route of administration or by different routes of administration.
- An effective amount of the CDK inhibitor and PD-1 axis binding antagonist, 0X40 agonist and/or 4-1 BB agonist may be administered for prevention or treatment of disease.
- the appropriate dosage of the CDK inhibitor and PD-1 axis binding antagonist, 0X40 agonist and/or 4-1 BB agonist may be determined based on the type of disease to be treated, the type of the CDK inhibitor, PD-1 axis binding antagonist, 0X40 agonist and/or 4-1 BB agonist, the severity and course of the disease, the clinical condition of the subject, the subject's clinical history and response to the treatment, and the discretion of the attending physician.
- the treatment further comprises administering a chemotherapeutic agent for treating or delaying progression of cancer in a subject.
- the subject has been treated with a chemotherapeutic agent before the combination treatment with the CDK inhibitor, PD-1 axis binding antagonist, the 0X40 binding agonist and/or the 4-1 BB agonist.
- the subject treated with the combination of the CDK inhibitor, PD-1 axis binding antagonist, the 0X40 binding agonist and/or the 4-1 BB agonist is refractory to a chemotherapeutic agent treatment.
- Some embodiments of the methods, uses, compositions, and kits described throughout the application further comprise administering a chemotherapeutic agent for treating or delaying progression of cancer.
- the combination therapy of the invention comprises administration of a CDK inhibitor in combination with a PD-1 axis binding antagonist, and optionally additionally in combination with an 0X40 agonist (e.g ., anti- human 0X40 antibody) and/or a 4-1 BB agonist (anti human 4-1 BB antibody).
- an 0X40 agonist e.g ., anti- human 0X40 antibody
- a 4-1 BB agonist anti human 4-1 BB antibody
- each of the CDK inhibitor, PD-1 axis binding antagonist, 0X40 agonist and/or 4- 1 BB agonist may be administered in any suitable manner known in the art.
- the CDK inhibitor and the PD-1 axis binding antagonist are administered simultaneously or sequentially in either order.
- the CDK inhibitor, the PD-1 axis binding antagonist, and the 0X40 agonist are administered simultaneously or sequentially in any order.
- the CDK inhibitor, the PD-1 axis binding antagonist, the 0X40 agonist and the 4-1 BB agonist are administered simultaneously or sequentially in any order.
- the CDK inhibitor, the PD-1 axis binding antagonist and the 4-1 BB agonist are administered simultaneously or sequentially in any order.
- the CDK inhibitor, the PD-1 axis binding antagonist, the 0X40 agonist and the 4-1 BB agonist are administered simultaneously or sequentially in any order.
- the PD-1 axis binding antagonist is: a PD-1 binding antagonist; a PD-L1 binding antagonist; or a PD-1 binding antagonist and a PD-L1 binding antagonist.
- the PD-1 binding antagonist and the PD-L1 binding antagonist are in the same composition; b. the PD-1 binding antagonist and the 0X40 agonist are in the same composition; c. the PD-1 binding antagonist and the 4-1 BB agonist are in the same composition; d. the PD-L1 binding antagonist and the 0X40 agonist are in the same composition; e. the PD-L1 binding antagonist and the 4-1 BB agonist are in the same composition; f. the 0X40 agonist and the 4-1 BB agonist are in the same composition; g. the PD-1 binding antagonist, the PD- L1 binding antagonist and the 0X40 agonist are in the same composition; h.
- the PD-1 binding antagonist, the PD-L1 binding antagonist and the 4-1 BB agonist are in the same composition; i. the PD-1 binding antagonist, the 0X40 agonist and the 4-1 BB agonist are in the same composition; j. the PD-L1 binding antagonist, the 0X40 agonist and the 4- 1 BB agonist are in the same composition; or k. the PD-1 binding antagonist, the PD-L1 binding antagonist, the 0X40 agonist and the 4-1 BB agonist are in the same composition.
- Administration of the compounds of the invention may be affected by any method that enables delivery of the compounds to the site of action. These methods include oral routes, intraduodenal routes, parenteral injection (including intravenous, subcutaneous, intramuscular, intravascular or infusion), topical, and rectal administration.
- the methods of administration of the agents and combinations herein may include oral, intravenous, intramuscular subcutaneous, topical, transdermal, intraperitoneal, intraorbital, by implantation, by inhalation, intrathecal, intraventricular, or intranasal administration.
- Dosage regimens may be adjusted to provide the optimum desired response. For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the chemotherapeutic agent and the particular therapeutic or prophylactic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
- the dose and dosing regimen is adjusted in accordance with methods well- known in the therapeutic arts. That is, the maximum tolerable dose can be readily established, and the effective amount providing a detectable therapeutic benefit to a patient may also be determined, as can the temporal requirements for administering each agent to provide a detectable therapeutic benefit to the patient. Accordingly, while certain dose and administration regimens are exemplified herein, these examples in no way limit the dose and administration regimen that may be provided to a patient in practicing the present invention.
- the agents may be administered at their approved dosages. Treatment is continued as long as clinical benefit is observed or until unacceptable toxicity or disease progression occurs. Nevertheless, in certain embodiments, the combination therapies of the present invention may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
- the dosages of the agents administered are significantly lower than the approved dosage, e.g., a subtherapeutic dosage of the CDK2/4/6 inhibitor is administered in combination with a subtherapeutic dosage of a PD-1 axis binding antagonist, an 0X40 agonist and/or a 4-1 BB agonist.
- a lower dosage of the agent may be desirable than when the agent alone is administered to a subject, a synergistic therapeutic effect may be achieved through the use of combination therapy which, in turn, permits use of a lower dose of the agent to achieve the desired therapeutic effect.
- the dosages may be lower and may also be applied less frequently, which may diminish the incidence or severity of side-effects. This is in accordance with the desires and requirements of the subjects to be treated.
- It is one objective of this invention to provide a pharmaceutical composition comprising an amount, which may be jointly therapeutically effective at treating cancer.
- two or more compounds may be administered together, one after the other or separately in one combined unit dosage form or in two separate unit dosage forms.
- the unit dosage form may also be a fixed combination. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated and may include single or multiple doses. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition. For example, doses may be adjusted based on pharmacokinetic or pharmacodynamic parameters, which may include clinical effects such as toxic effects and/or laboratory values. Thus, the present invention encompasses intra-patient dose- escalation as determined by the skilled artisan. Determining appropriate dosages and regimens for administration of the chemotherapeutic agent are well-known in the relevant art and would be understood to be encompassed by the skilled artisan once provided the teachings disclosed herein.
- the amount of the agent of the invention administered will be dependent on the subject being treated, the severity of the disorder or condition, the rate of administration, the disposition of the compound and the discretion of the prescribing physician.
- An effective amount of the CDK inhibitor, PD-1 axis binding antagonist, 0X40 agonist and/or 4-BB agonist may be administered for prevention or treatment of disease.
- the appropriate dosage of the CDK inhibitor, PD-1 axis binding antagonist, 0X40 agonist and/or 4-BB agonist (e.g ., anti-human 0X40 agonist antibody) may be determined based on the type of disease to be treated, the type of the CDK inhibitor, PD-1 axis binding antagonist, the 0X40 agonist and/or 4-BB agonist, the severity and course of the disease, the clinical condition of the subject, the subject's clinical history and response to the treatment, and the discretion of the attending physician.
- combination treatment with CDK inhibitor, PD-1 axis binding antagonist ⁇ e.g., anti- PD-1 antibody or anti-PD-L1 antibody
- 0X40 agonist ⁇ e.g., anti-human 0X40 agonist antibody
- 4-BB agonist ⁇ e.g., anti-human 4-1 BB agonist antibody
- an efficacious dose of the CDK inhibitor, PD-1 axis binding antagonist, 0X40 agonist and/or 4-BB agonist in the combination is reduced relative to efficacious dose of the each of the CDK inhibitor, PD-1 axis binding antagonist, 0X40 agonist and/or 4-1 BB agonist as a single agent.
- Dosage units for a PD-1 axis binding antagonist may be expressed as a flat dose, i.e., 100 mg, 200 mg, 300 mg, or as a patient-specific dose, i.e., mg/kg (mg therapeutic agent/kg of body weight) or mg/m 2 (quantity in milligrams per square meter of body surface area).
- a flat dose i.e., 100 mg, 200 mg, 300 mg
- a patient-specific dose i.e., mg/kg (mg therapeutic agent/kg of body weight) or mg/m 2 (quantity in milligrams per square meter of body surface area).
- the therapeutically effective amount of the antibody administered to human will be in the range of about 0.01 to about 50 g/kg of patient body weight whether by one or more administrations.
- the antibody used is about 0.01 to about 45 g/kg, about 0.01 to about 40 g/kg, about 0.01 to about 35 g/kg, about 0.01 to about 30 g/kg, about 0.01 to about 25 g/kg, about 0.01 to about 20 mg/kg, about 0.01 to about 1 5 mg/kg, about 0.01 to about 1 0 g/kg, about 0.01 to about 5 mg/kg, or about 0.01 to about 1 g/kg administered daily, for example.
- the antibody is administered at 1 5 g/kg.
- an anti-PD- L1 antibody described herein is administered to a human at a dose of about 1 00 g, about 200 g, about 300 g, about 400 g, about 500 g, about 600 g, about 700 mg, about 800 g, about 900 g, about 1 000 g, about 1 1 00 g, about 1200 g, about 1300 g or about 1400 g on day 1 of 21 -day cycles.
- the dose may be administered as a single dose or as multiple doses (e.g., 2 or 3 doses), such as infusions.
- the dose of the antibody administered in a combination treatment may be reduced as compared to a single treatment. The progress of this therapy is easily monitored by conventional techniques.
- an antibody, antibody fragment or fusion soluble receptor as the PD-1 axis binding antagonist in the combination therapy may comprise administering the antibody at a dose of about 0.5, 1 , 2, 3, 5 or 10 mg/kg at intervals of about 7 days ( ⁇ 2 days) or 14 days ( ⁇ 2 days) or about 21 days ( ⁇ 2 days) or about 30 days ( ⁇ 2 days) throughout the course of treatment.
- the dosing regimen will comprise administering the antibody a dose of from about 0.005 mg/kg to about 10 mg/kg, with intrapatient dose escalation.
- the interval between doses will be progressively shortened, e.g., about 30 days ( ⁇ 2 days) between the first and second dose, about 14 days ( ⁇ 2 days) between the second and third doses.
- the dosing interval will be about 14 days ( ⁇ 2 days), for doses subsequent to the second dose.
- the dosing interval will be about 7 days ( ⁇ 2 days), for doses subsequent to the second dose.
- a subject will be administered an intravenous (IV) infusion of a medicament comprising any of the PD-1 axis binding antagonists described herein.
- IV intravenous
- the PD-1 axis binding antagonist in the combination therapy is nivolumab, pembrolizumab or avelumab (MSB0010718C), which is administered intravenously or in a liquid dosage form at a dose selected from the group consisting of any one of : 1 mg/kg Q2W, 2 mg/kg Q2W, 3 mg/kg Q2W, 5 mg/kg Q2W, 10 mg Q2W, 1 mg/kg Q3W, 2 mg/kg Q3W, 3 mg/kg Q3W, 5 mg/kg Q3W, and 10 mg Q3W.
- pembrolizumab is administered at a dose of 2 mg/kg (up to 200 mg) every 3 weeks.
- avelumab is administered at a dose of 10 mg/kg as an intravenous infusion over 60 minutes every 2 weeks.
- the optimal dose for a PD-1 axis binding antagonist in combination with a CDK inhibitor may be identified by dose escalation of one or both of these agents.
- the CDK inhibitor may be administered orally (PO), either once daily (QD) or twice daily (BID), with or without food on a continuous or intermittent schedule starting on Cycle 1 Day 1 , except in the case of CDK inhibitor lead-in.
- a PD-1 axis binding antagonist such as avelumab may be administered as a 30-minute to 1 -hr intravenous (IV) infusion every 2 weeks (Q2W), every 3 weeks (Q3W) or in case of dose reduction, every 4 weeks (Q4W), starting on Cycle 1 Day 1 , except in the case of CDK inhibitor lead-in.
- the CDK inhibitor may be given prior to or after administration of the PD-1 axis binding antagonist.
- an CDK inhibitor can be administered at 1 mg, 2 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 75 mg, 100 mg, 125 mg, 150 mg, 200 mg, or 250 mg on a BID or QD schedule, which may be administered continuously or on an intermittent dosing schedule, such as 3 weeks on: 1 week off (3:1 ) or 2 weeks on: 1 week off (2: 1 ) schedule, and the PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg, or 5 mg/kg or 10 mg/kg, at a dosing interval of Q2W, Q3W or alternately Q4W.
- a BID or QD schedule which may be administered continuously or on an intermittent dosing schedule, such as 3 weeks on: 1 week off (3:1 ) or 2 weeks on: 1 week off (2: 1 ) schedule
- the PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg, or 5 mg/kg or
- the CDK inhibitor is administered at 25 mg, 50 mg, 75 mg, 100 mg or 125 mg BID or QD for a 3-week lead-in period and then the PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg Q3W or 200 mg Q3W after the lead-in period.
- the CDK inhibitor is administered at 25 mg, 50 mg, 75 mg, 100 mg or 125 mg BID or QD and the PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg Q4W.
- the CDK inhibitor is administered at 25 mg, 50 mg, 75 mg, 100 or 125 mg BID or QD and PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg Q3W.
- the CDK inhibitor is administered at 25 mg, 50 mg, 75 mg, 100 mg or 125 mg BID or QD and the PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg Q4W.
- the CDK inhibitor is administered at 25 mg, 50 mg, 75 mg, 100 mg or 125 mg BID or QD and RN888 is administered at a starting dose of 2 mg/kg Q3W.
- the CDK inhibitor is administered at 25 mg, 50 mg, 75 mg, 100 mg or 125 mg BID or QD and the PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg Q4W.
- the CDK inhibitor is administered at 1 mg, 2 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg or 50 mg BID or QD for a 3-week_lead-in period and then the PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg Q3W or 200 mg Q3W after the lead-in period.
- the CDK inhibitor is administered at 1 mg, 2 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg or 50 mg BID or QD and the PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg Q4W.
- the CDK inhibitor is administered at 1 mg, 2 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg or 50 mg BID or QD and PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg Q3W.
- the CDK inhibitor is administered at 1 mg, 2 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg or 50 mg BID or QD and the PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg Q4W.
- the CDK inhibitor is administered at 1 mg, 2 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg or 50 mg BID or QD and RN888 is administered at a starting dose of 2 mg/kg Q3W.
- the CDK inhibitor is administered at 1 mg, 2 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg or 50 mg BID or QD and the PD-1 axis binding antagonist is administered at a starting dose of 2 mg/kg Q4W.
- the CDK inhibitor is palbociclib, or a pharmaceutically acceptable salt thereof.
- the CDK inhibitor is PF-06873600, or a pharmaceutically acceptable salt thereof.
- avelumab is administered at a dose of 10 mg/kg as an intravenous infusion over 60 minutes every 2 weeks in combination with the agents as described herein, until disease progression or unacceptable toxicity.
- pembrolizumab is administered at a dose of 200 mg administered as an intravenous infusion over 30 minutes every 3 weeks until disease progression or unacceptable toxicity, or up to 24 months in patients without disease progression.
- the subject is treated with a 3-week lead-in period of single agent CDK inhibitor directly preceding the combination administration of the CDK inhibitor and PD-1 axis binding antagonist.
- the patient is treated with a 3-week lead-in period of single-agent CDK inhibitor directly preceding the combination administration of the CDK inhibitor and a PD-1 axis binding antagonist, an 0X40 agonist and/or a 4-1 BB agonist.
- a treatment cycle begins with the first day of combination treatment and last for 3 weeks.
- the combination therapy is preferably administered for at least 18 weeks (6 cycles of treatment), more preferably at least 24 weeks (8 cycles of treatment), and even more preferably at least 2 weeks after the patient achieves a CR.
- the 0X40 agonist is administered about every one, two, three, four, five, or six weeks at: a) a fixed dose per subject selected from the group consisting of about 0.1 , 0.5, 1 , 2, 4, 5, 6, 8, 1 0, 20, 30, 40, 50, 60, 70, 80, 90, 1 00, 1 50, 200, 300, 400, 500, 600, 700, 800, 900, or 1 000 mg, or b) a dose selected from the group consisting of about 0.01 mg/kg, 0.03 mg/kg, 0.1 mg/kg, 0.3 mg/kg, 1 mg/kg, 1 .5 mg/ kg, 3 mg/kg, 5 mg/kg, 1 0 mg/ kg, 1 5 mg/kg, 20 mg/kg and 25 mg/kg, and the 4-1 BB agonist is administered about every one, two, three, four, five, or six weeks at: a) a fixed dose per subject selected from the group consisting of about 0.1 , 0.5, 1 , 2, 4,
- the anti-4-1 BB monoclonal antibody is administered at a dose selected from the group consisting of 1 mg/kg Q2W, 2 mg/kg Q2W, 3 mg/kg Q2W, 5 mg/kg Q2W, 10 mg Q2W, 1 mg/kg Q3W, 2 mg/kg Q3W, 3 mg/kg Q3W, 5 mg/kg Q3W, and 10 mg Q3W.
- the anti-4-1 BB monoclonal antibody is administered as a liquid medicament, and the selected dose of the medicament is administered by IV infusion over a time period of about 60 minutes.
- the anti-4-1 BB monoclonal antibody is administered at a starting dose of about 0.6 mg/kg Q4W and avelumab is administered at a starting dose of 10 mg/kg Q2W, and if the starting dose combination is not tolerated by the subject, then the dose of avelumab is reduced to 5 mg/kg Q2W and/or the dose of the anti-4-1 BB monoclonal antibody is reduced to 0.3 mg/kg Q4W.
- An effective dosage of a CDK inhibitor, or a pharmaceutically acceptable salt thereof is in the range of from about 0.001 to about 100 mg per kg body weight per day, preferably about 1 to about 35 mg/kg/day, in single or divided doses. For example, for a 70 kg human, this would amount to about 0.01 to about 7 g/day, preferably about 0.02 to about 2.5 g/day. In some instances, dosage levels below the lower limit of the aforesaid range may be more than adequate, while in other cases still larger doses may be employed without causing any harmful side effect, provided that such larger doses are first divided into several small doses for administration throughout the day.
- the dose of CDK inhibitor is increased up to a maximum dose of 250 mg BID if the subject tolerates the combination treatment at a lower total dose of CDK inhibitor.
- the CDK inhibitor, or a pharmaceutically acceptable salt thereof is administered at a daily dosage of from about 5 mg to about 250 mg per day, preferably from about 10 mg to about 125 mg per day. In some embodiments, the CDK inhibitor, or a pharmaceutically acceptable salt thereof, is administered at a daily dosage of about 5 mg per day, about 10 mg per day, about 15 mg per day, about 20 mg per day, about 25 mg per day, about 30 mg per day, about 35 mg per day, about 40 mg per day, about 45 mg per day, about 50 mg per day, about 75 mg per day, about 100 mg per day, about 125 mg per day, about 150 mg per day, about 200 mg per day, or about 250 mg per day.
- This dose may optionally be sub-divided into small doses, for example a dosage of 150 mg per day could be dosed as 75 mg dose twice per day.
- Dosage units for a CDK inhibitor e.g ., PF-06873600 or palbociclib
- PF-06873600 or palbociclib may be expressed as a flat dose, i.e., 1 mg, 2 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 75 mg, 100 mg, 125 mg, etc. or as a subject-specific dose, i.e., mg/kg (mg therapeutic agent/kg of body weight) or mg/m 2 (quantity in milligrams per square meter of body surface area).
- Some embodiments may comprise administering the CDK inhibitor in a dose of about: 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 55 mg, 60 mg, 65 mg, 70 mg, 75 mg, 80 mg, 85 mg, 90 mg, 95 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 225 mg, 250 mg, or more than 250 mg, wherein the amounts can be administered once a day (q.d. ), twice a day (b.i.d), three times a day (t.i.d.), four times a day (q.i.d.), or on some other dosing schedule.
- A“continuous dosing schedule,” as used herein, is an administration or dosing regimen without dose interruptions, e.g., without days off treatment. Repetition of 21 - or 28-day treatment cycles without dose interruptions between the treatment cycles is an example of a continuous dosing schedule.
- the compounds of the combination of the present invention can be administered in a continuous dosing schedule.
- the CDK inhibitor is administered on an intermittent dosing schedule, such as a 3: 1 or 2: 1 schedule.
- the CDK inhibitor is a CDK4/6 inhibitor or a pharmaceutically acceptable salt thereof.
- the CDK4/6 inhibitor is palbociclib, or a pharmaceutically acceptable salt thereof.
- the CDK inhibitor is a CDK2/4/6 inhibitor or a pharmaceutically acceptable salt thereof.
- the CDK2/4/6 inhibitor is 6-(difluoromethyl)-8-((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 - (methylsulfonyl)-piperidin-4-ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof.
- palbociclib, or a pharmaceutically acceptable salt thereof is administered at a daily dosage of about 5 mg to about 125 mg once daily, about 5 mg to about 100 mg once daily, 5 mg to about 75 mg once daily, or about 5 mg to about 50 mg once daily.
- palbociclib, or a pharmaceutically acceptable salt thereof is administered at a daily dosage of about 125 mg once a day.
- palbociclib, or a pharmaceutically acceptable salt thereof is administered at a non-standard clinical dose.
- a non-standard clinical dose is a low-dose amount of palbociclib, or a pharmaceutically acceptable salt thereof.
- palbociclib is administered at a dose of about 100 mg once daily, about 75 mg once daily, or about 50 mg once daily.
- palbociclib, or a pharmaceutically acceptable salt thereof is administered at a dose of about 100 mg once daily.
- palbociclib, or a pharmaceutically acceptable salt thereof is administered at a dose of about 75 mg once daily.
- palbociclib, or a pharmaceutically acceptable salt thereof is administered at a dose of about 50 mg once daily.
- Dosage amounts provided herein refer to the dose of the free base form of palbociclib, or are calculated as the free base equivalent of an administered palbociclib salt form.
- a dosage or amount of palbociclib refers to the free base equivalent.
- This dosage regimen may be adjusted to provide the optimal therapeutic response. For example, the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- PF-06873600, or a pharmaceutically acceptable salt thereof is administered at a daily dosage of about 5 mg to about 125 mg daily, about 5 mg to about 100 mg daily, about 5 mg to about 75 mg daily, or about 5 mg to about 50 mg daily.
- PF-06873600, or a pharmaceutically acceptable salt thereof is administered at a daily dosage of about 10 mg, about 15 mg, about 25 mg, about 30 mg, about 50 mg, about 75 mg, about 100 mg or about 125 mg daily.
- PF- 06873600, or a pharmaceutically acceptable salt thereof is administered at a non standard clinical dose.
- a non-standard clinical dose is a low-dose amount of PF-06873600, or a pharmaceutically acceptable salt thereof.
- PF-06873600, or a pharmaceutically acceptable salt thereof is administered at a dose of about 100 mg daily, about 75 mg daily, about 50 mg daily, about 30 mg daily, about 25 mg daily, about 15 mg daily, or about 10 mg daily.
- PF-06873600, or a pharmaceutically acceptable salt thereof is administered at a dose of about 50 mg daily.
- PF-06873600, or a pharmaceutically acceptable salt thereof is administered at a dose of about 30 mg daily.
- PF-06873600 is administered at a dose of about 25 mg daily.
- Dosage amounts provided herein refer to the dose of the free base form of PF-06873600, or a pharmaceutically acceptable salt thereof, calculated as the free base equivalent of an administered PF-06873600 salt form.
- a dosage or amount of PF- 06873600 such as 100 mg, 75 mg, 50 mg, 30 mg, 25 mg, 15 mg or 10 mg, refers to the free base equivalent.
- This dosage regimen may be adjusted to provide the optimal therapeutic response. For example, the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- Administration of the combination of the invention includes administration of the individual agents of the combination in a single formulation or unit dosage form.
- Administration of the combination of the invention further includes administration of the individual agents of the combination concurrently or separately and in any order.
- the individual agents of the combination may be administered separately or as a fixed combination.
- the individual agents of the combination may be administered sequentially by any suitable route.
- the method of treating cancer according to the invention may comprise (i) administration of the first agent (a) in free or pharmaceutically acceptable salt form and (ii) administration of an agent (b) in free or pharmaceutically acceptable salt form, simultaneously or sequentially in any order, wherein the amounts together are effective in treating cancer, preferably in synergistically effective amounts, e.g., in daily or intermittently dosages corresponding to the amounts described herein.
- the individual agents of the combination of the invention may be administered separately at different times during the course of therapy or concurrently in divided or single combination forms.
- the term administering also encompasses the use of a pro-drug of a combination agent that convert in vivo to the combination agent as such.
- the present invention is therefore to be understood as embracing all such regimens of simultaneous or alternating treatment and the term“administering” is to be interpreted accordingly.
- the compounds of the combination of the present invention can be administered intermittently, concurrently or sequentially. In an embodiment, the compounds of the combination of the present invention can be administered in a concurrent dosing regimen.
- A“continuous dosing schedule,” as used herein, is an administration or dosing regimen without dose interruptions, e.g., without days off treatment. Repetition of 21 or 28 day treatment cycles without dose interruptions between the treatment cycles is an example of a continuous dosing schedule.
- the compounds of the combination of the present invention can be administered in a continuous dosing schedule. In an embodiment, the compounds of the combination of the present invention can be administered concurrently in a continuous dosing schedule.
- the invention provides a combination which is synergistic.
- the invention provides a synergistic combination comprising: a. (i) palbociclib, or a pharmaceutically acceptable salt thereof; and (ii) a PD-1 binding antagonist; for use in the treatment of cancer in a subject, wherein component (i) and component (ii) are synergistic; b.
- the invention provides a synergistic combination comprising: a. (i) palbociclib, or a pharmaceutically acceptable salt thereof; and (ii) a PD- L1 binding antagonist; for use in the treatment of cancer in a subject, wherein component (i) and component (ii) are synergistic; b. (i) palbociclib, or a pharmaceutically acceptable salt thereof; (ii) a PD-L1 binding antagonist; and (iii) an 0X40 agonist; for use in the treatment of cancer in a subject, wherein component (i) and component (ii); component
- component (ii) and component (iii) are synergistic; c. (i) palbociclib, or a pharmaceutically acceptable salt thereof; (ii) a PD-L1 binding antagonist; and (iii) a 4-1 BB agonist; for use in the treatment of cancer in a subject; wherein component (i) and component (ii); component
- component (ii) and component (iii) are synergistic; d. (i) palbociclib, or a pharmaceutically acceptable salt thereof; (ii) a PD-L1 binding antagonist; (iii) an 0X40 agonist; and (iv) a 4-1 BB agonist; for use in the treatment of cancer in a subject, wherein component (i) and component (ii); component (i) and component (iii); component (i) and component (iv); component (ii) and component (iii); component (iii); component (ii) and component (iv); component (iii) and component (iv); component (i) component (ii) and component (iii); component (i) component (iii); component (i) component (ii) and component (iv); component (ii), component (iii) and component (iv); component (ii), component (iii) and component (iv); or component (i), component (ii), component (ii
- the invention provides a synergistic combination comprising: a. (i) 6-(difluoromethyl)-8-((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 - (methylsulfonyl)piperidin-4-ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof; and (ii) a PD-1 binding antagonist; for use in the treatment of cancer in a subject, wherein component (i) and component (ii) are synergistic; b.
- component (ii) a PD-1 binding antagonist; and (iii) a 4-1 BB agonist; for use in the treatment of cancer in a subject, wherein component (i) and component (ii); component (i) and component
- component (iii); component (ii) and component (iii); or component (i), component (ii) and component (iii) are synergistic; d.
- a 4-1 BB agonist for use in the treatment of cancer in a subject, wherein component (i) and component (ii); component (i) and component (iii); component (i) and component (iv); component (ii) and component (ii); component (iv); component (iii) and component (iv); component (iii) and component (iv); component (i), component (i), component (
- the invention is related to synergistic combination comprising: a. (i) 6-(difluoromethyl)-8-((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 - (methylsulfonyl)piperidin-4-ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof; and (ii) a PD-L1 binding antagonist; for use in the treatment of cancer in a subject, wherein component (i) and component (ii) are synergistic; b.
- the present invention provides a combination comprising: a. palbociclib, or a pharmaceutically acceptable salt thereof, and a PD-1 binding antagonist; b. palbociclib, or a pharmaceutically acceptable salt thereof, a PD-1 binding antagonist, and an 0X40 agonist; c. palbociclib, or a pharmaceutically acceptable salt thereof, a PD- 1 binding antagonist, and a 4-1 BB agonist; or d. palbociclib, or a pharmaceutically acceptable salt thereof, a PD-1 binding antagonist, an 0X40 agonist and a 4-1 BB agonist, for use in the treatment of cancer in a subject.
- the present invention provides a combination comprising: a. palbociclib, or a pharmaceutically acceptable salt thereof, and a PD-L1 binding antagonist; b. palbociclib, or a pharmaceutically acceptable salt thereof, a PD-L1 binding antagonist, and a 4-1 BB agonist; c. palbociclib, or a pharmaceutically acceptable salt thereof, a PD-L1 binding antagonist, and an 0X40 agonist; d. palbociclib, or a pharmaceutically acceptable salt thereof, a PD-L1 binding antagonist, a 4-1 BB agonist; or e. palbociclib, or a pharmaceutically acceptable salt thereof, a PD-1 binding antagonist, a PD-L1 binding antagonist, an 0X40 agonist and a 4-1 BB agonist, for use in the treatment of cancer in a subject.
- the present invention provides a combination comprising: a. 6-(difluoromethyl)-8-((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 -
- the present invention provides a combination comprising: a. 6-(difluoromethyl)-8-((1 R,2R)-2-hydroxy-2-methylcyclopentyl)-2-(1 -(methylsulfonyl)- piperidin-4-ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof, and a PD-L1 binding antagonist; b.
- the invention provides a combination wherein the PD-1 binding antagonist is an anti-PD-1 antibody; the PD-L1 binding antagonist is an anti-PD-L1 antibody; the 0X40 agonist is an anti-OX40 antibody; and/or the 4-1 BB agonist is an anti-4-1 BB antibody.
- the subject is intended to include animals.
- subjects include mammals, e.g., humans, cows, sheep, cats, dogs, horses, primates, rabbits, and rodents (e.g., mice and rats), and transgenic non-human animals.
- the subject is a human, e.g., a human suffering from, at risk of suffering from, or potentially capable of suffering from cancer.
- the cancer is a solid tumor. In some embodiments, the cancer is a hematologic cancer. In some embodiments of the each of the foregoing, the cancer is selected from the group consisting of brain cancer, head/neck cancer (including squamous cell carcinoma of the head and neck (SCCHN)), prostate cancer, ovarian cancer, bladder cancer (including urothelial carcinoma, also known as transitional cell carcinoma (TCC)), lung cancer (including squamous cell carcinoma, small cell lung cancer (SCLC), and non-small cell lung cancer (NSCLC)), breast cancer, bone cancer, colorectal cancer, kidney cancer, liver cancer (including hepatocellular carcinoma (HCC)), stomach cancer, pancreatic cancer, esophageal cancer , cervical cancer, sarcoma, skin cancer (including melanoma and Merkel cell carcinoma (MCC)), multiple myeloma, mesothelioma, malignant rhabdoid tumors, neuroblastom
- MCC Merkel cell carcinoma
- the invention provides a kit comprising: a. (i) a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising a PD-1 binding antagonist and a pharmaceutically acceptable carrier; b. (i) a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising a PD-1 binding antagonist and a pharmaceutically acceptable carrier; (iii) a pharmaceutical composition comprising an 0X40 agonist and a pharmaceutically acceptable carrier; c.
- a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising a PD-1 binding antagonist and a pharmaceutically acceptable carrier; (iii) a pharmaceutical composition comprising a 4-1 BB agonist and a pharmaceutically acceptable carrier; or d.
- a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising PD-1 binding antagonist and a pharmaceutically acceptable carrier; (iii) a pharmaceutical composition comprising an 0X40 agonist and a pharmaceutically acceptable carrier; (iv) a pharmaceutical composition comprising a 4- 1 BB agonist and a pharmaceutically acceptable carrier; and instructions for dosing of the pharmaceutical compositions for the treatment of cancer.
- the PD-1 binding antagonist is an anti-PD-1 antibody; the 0X40 agonist is an anti-OX40 antibody; and/or the 4-1 BB agonist is an anti-4-1 BB antibody.
- a kit comprising: a. (i) a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising a PD-L1 binding antagonist and a pharmaceutically acceptable carrier; b. (i) a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier; (ii) a pharmaceutical composition comprising a PD-L1 binding antagonist and a pharmaceutically acceptable carrier; (iii) a pharmaceutical composition comprising an 0X40 agonist and a pharmaceutically acceptable carrier; c.
- a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising a PD-L1 binding antagonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising a 4-1 BB agonist and a pharmaceutically acceptable carrier;
- d a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising PD-L1 binding antagonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising an 0X40 agonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising a 4- 1 BB agonist and a pharmaceutically acceptable carrier; or e.
- a pharmaceutical composition comprising a CDK inhibitor and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising a PD-1 binding antagonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising PD- L1 binding antagonist and a pharmaceutically acceptable carrier;
- a pharmaceutical composition comprising an 0X40 agonist and a pharmaceutically acceptable carrier; and
- a pharmaceutical composition comprising a 4-1 BB agonist and a pharmaceutically acceptable carrier.
- the kit further comprises package insert comprising instructions for using the CDK inhibitor in conjunction with PD-1 axis binding antagonist (e.g ., anti-PD-1 or anti-PD-L1 antibody), the 0X40 agonist (e.g., anti-human 0X40 agonist antibody) and/or 4-BB agonist ⁇ e.g., anti-human 4-1 BB agonist antibody) treat or delay progression of cancer in an individual or to enhance immune function of a subject having cancer.
- PD-1 axis binding antagonist e.g ., anti-PD-1 or anti-PD-L1 antibody
- the 0X40 agonist e.g., anti-human 0X40 agonist antibody
- 4-BB agonist e.g., anti-human 4-1 BB agonist antibody
- any of the CDK inhibitors, PD-1 axis binding antagonists, 0X40 agonist and/or 4-1 BB agonists described herein may be included in the kits.
- the CDK inhibitor is a CDK4/6 inhibitor.
- the CDK4/6 inhibitor is palbociclib, or a pharmaceutically acceptable salt thereof.
- the CDK inhibitor is a CDK2/4/6 inhibitor.
- the CD2/4/6 inhibitor is 6-(difluoromethyl)-8-((1 R,2R)-2- hydroxy-2-methylcyclopentyl)-2-(1 -(methylsulfonyl)piperidin-4-ylamino)pyrido[2,3- d]pyrimidin-7(8H)-one, or a pharmaceutically acceptable salt thereof.
- the PD-L1 binding antagonist is an anti-PD-L1 antibody.
- the 0X40 agonist is an anti-OX40 antibody; and/or the 4-1 BB agonist is an anti-4-1 BB antibody.
- the PD-1 axis binding antagonist, the 0X40 binding agonist (. e.g ., anti-human 0X40 agonist antibody), and/or the 4-1 BB agonist are in the same container or separate containers.
- Suitable containers include, for example, bottles, vials, bags and syringes.
- the container may be formed from a variety of materials such as glass, plastic (such as polyvinyl chloride or polyolefin), or metal alloy (such as stainless steel or hastelloy).
- the container holds the formulation and the label on, or associated with, the container may indicate directions for use.
- the kit may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
- the kit further includes one or more of another agent (e.g., a chemotherapeutic agent, and anti-neoplastic agent).
- Suitable containers for the one or more agent include, for example, bottles, vials, bags and syringes.
- Example 1 CDK4/6 Inhibitor, Palbociclib Synergizes with PD-L1 Based Immune Checkpoint Blockade in the MC38 Syngeneic Mouse Tumor Model
- MC38 cells were obtained from American Type Culture Collection (ATCC) and cultured in Roswell Park Memorial Institute (RPMI1640) supplemented with 10% fetal bovine serum (FBS). All cells were maintained in a humidified incubator at 37°C with 5% carbon dioxide (CO2).
- Female C57/BL6 mice were obtained from Jackson Laboratories at 8 weeks of age. To generate the syngeneic model, 0.5 million MC38 tumor cells were subcutaneously implanted into the right flank of female C57/BL6 mice. Tumor bearing mice were randomized into four treatment groups based on average tumor sizes of approximately 70 mm 3 per group, on Day 9 post tumor cell implantation.
- Study groups included vehicle, 15 mg/kg palbociclib twice daily by oral gavage, combination of 10mg/kg avelumab (anti-PD-L1 antibody, PF-06834635) administered by intraperitoneal (IP) injection, 5mg/kg anti-OX40 antibody (PF-07201252) administered by IP injection and 10mg/kg with anti-4-1 BB antibody (PF-07218859) administered at 3mg/kg by IP injection, and combination of 15 mg/kg palbociclib twice daily by oral gavage with 10mg/kg avelumab (anti-PD-L1 antibody, PF-06834635) administered by intraperitoneal (IP) injection, 5 mg/kg anti-OX40 antibody (PF-07201252) administered by IP injection and 10mg/kg with anti-4-1 BB antibody (PF-07218859) administered at 3mg/kg by IP injection.
- tumor growth results show that treatment with the CDK4/6 inhibitor palbociclib monotherapy did not significantly inhibit tumor growth in the MC38 xenograft tumor model.
- palbociclib treatment in combination with avelumab + anti-OX40 antibody + anti-4-1 BB antibody showed a trend to a combinatorial effect, with increase in tumor growth inhibition.
- PF-06873600 was evaluated in the MC38 syngeneic mouse tumor model in combination with antibodies targeting PD-L1 , 4-1 BB and 0X40 to assess efficacy on primary tumor growth and survival.
- MC38 cells were obtained from American Type Culture Collection (ATCC) and cultured in Roswell Park Memorial Institute (RPMI1640) supplemented with 10% fetal bovine serum (FBS). All cells were maintained in a humidified incubator at 37°C with 5% carbon dioxide (CO2).
- Female C57/BL6 mice were obtained from Jackson Laboratories at 8 weeks of age. To generate the syngeneic model, 0.5 million MC38 tumor cells were subcutaneously implanted into the right flank of female C57/BL6 mice. Tumor bearing mice were randomized into nine treatment groups based on average tumor sizes of approximately 70 mm 3 per group, on Day 9 post tumor cell implantation.
- Palbociclib will be evaluated in the MC38 syngeneic mouse tumor model in combination with antibodies targeting 4-1 BB and 0X40 to assess efficacy on primary tumor growth and survival.
- MC38 cells will be obtained from American Type Culture Collection (ATCC) and cultured in Roswell Park Memorial Institute (RPMI1640) supplemented with 10% fetal bovine serum (FBS). All cells will be maintained in a humidified incubator at 37°C with 5% carbon dioxide (CO2).
- Female C57/BL6 mice will be obtained from Jackson Laboratories at 8 weeks of age.
- 0.5 million MC38 tumor cells will be subcutaneously implanted into the right flank of female C57/BL6 mice. Tumor bearing mice will be randomized into six treatment groups based on average tumor sizes of approximately 70 mm 3 per group, on Day 9 post tumor cell implantation.
- Palbociclib will be evaluated in the MC38 syngeneic mouse tumor model in combination with antibodies targeting PD-L1 , 4-1 BB and 0X40 to assess efficacy on primary tumor growth and survival.
- MC38 cells will be obtained from American Type Culture Collection (ATCC) and cultured in Roswell Park Memorial Institute (RPMI1640) supplemented with 10% fetal bovine serum (FBS). All cells will be maintained in a humidified incubator at 37°C with 5% carbon dioxide (CO2).
- Female C57/BL6 mice will be obtained from Jackson Laboratories at 8 weeks of age.
- 0.5 million MC38 tumor cells will be subcutaneously implanted into the right flank of female C57/BL6 mice. Tumor bearing mice will be randomized into eight treatment groups based on average tumor sizes of approximately 70 mm 3 per group, on Day 9 post tumor cell implantation.
- Study groups will include vehicle, 3015 mg/kg palbociclib twice daily by oral gavage, avelumab (anti-PD-L1 antibody, PF-06834635) administered by intraperitoneal (IP) injection, 10mg/kg, combination of avelumab administered at 10mg/kg with anti-OX40 antibody (PF-07201252) administered at 5mg/kg by IP injection, combination of anti-PD- L1 administered at 10mg/kg with anti-4-1 BB antibody (PF-07218859) administered at 3mg/kg by IP injection, combination of anti-PD-L1 antibody as described above with palbociclib administered at 15mg/kg twice daily by oral gavage, combination of anti-PD- L1 antibody and anti-OX40 antibody as described above with palbociclib administered at 15mg/kg twice daily by oral gavage, and combination of anti-PD-L1 antibody with anti-4- 1 BB antibody as described above with palbociclib administered at 15mg/kg twice daily by oral gavage.
- All antibodies will be administered as three doses every three days after the study initiation. All antibody formulations are phosphate buffered saline based while palbociclib is administered in a 0.5% methocel/Tween suspension.
- the treatment groups and dose regimen information are summarized in Table 13.
- Palbociclib will be evaluated in the MC38 syngeneic mouse tumor model in combination with antibodies targeting PD-1 , 4-1 BB and 0X40 to assess efficacy on primary tumor growth and survival.
- MC38 cells obtained from American Type Culture Collection (ATCC) are cultured in Roswell Park Memorial Institute (RPMI1640) supplemented with 10% fetal bovine serum (FBS). All cells are maintained in a humidified incubator at 37°C with 5% carbon dioxide (CO2).
- RPMI1640 Roswell Park Memorial Institute
- FBS fetal bovine serum
- Female C57/BL6 mice will be obtained from Jackson Laboratories at 8 weeks of age.
- 0.5 million MC38 tumor cells are subcutaneously implanted into the right flank of female C57/BL6 mice. Tumor bearing mice will be randomized into seven treatment groups based on average tumor sizes of approximately 70 mm 3 per group, on Day 9 post tumor cell implantation.
- Study groups will include vehicle, 10 mg/kg palbociclib (CDK 4/6 inhibitor) twice daily by oral gavage in combination with anti-PD-1 antibody (PF-06937004) administered at 10mg/kg IP injection every three days for three doses, 10 mg/kg palbociclib (CDK 4/6 inhibitor) twice daily by oral gavage in combination with anti-PD-1 antibody (PF-06937004) administered at 10 mg/kg IP injection and anti-4-1 BB antibody (PF-07218859) administered at 3mg/kg by IP injection every three days for three doses, 10 mg/kg palbociclib (CDK 4/6 inhibitor) twice daily by oral gavage in combination with anti-PD-1 antibody (PF-06937004) administered at 10mg/kg IP injection and anti-OX40 antibody (PF-07201252) administered at 5mg/kg by IP injection every three days for three doses and 10 mg/kg palbociclib (CDK 4/6 inhibitor) twice daily by oral gavage in combination with anti-PD-1 antibody (PF- 06937004) administered at 10mg
- PF-06873600 will be evaluated in the MC38 syngeneic mouse tumor model in combination with antibodies targeting PD-1 , 4-1 BB and 0X40 to assess efficacy on primary tumor growth and survival.
- MC38 cells obtained from American Type Culture Collection (ATCC) are cultured in Roswell Park Memorial Institute (RPMI1640) supplemented with 10% fetal bovine serum (FBS). All cells are maintained in a humidified incubator at 37°C with 5% carbon dioxide (CO2).
- RPMI1640 Roswell Park Memorial Institute
- FBS fetal bovine serum
- Female C57/BL6 mice will be obtained from Jackson Laboratories at 8 weeks of age.
- 0.5 million MC38 tumor cells are subcutaneously implanted into the right flank of female C57/BL6 mice. Tumor bearing mice will be randomized into seven treatment groups based on average tumor sizes of approximately 70 mm 3 per group, on Day 9 post tumor cell implantation.
- Study groups will include vehicle, 30 mg/kg PF-06873600 (CDK 2/4/6 inhibitor) twice daily by oral gavage in combination with anti-PD-1 antibody (PF-06937004) administered at 10mg/kg IP injection every three days for three doses, 30 mg/kg PF-06873600 (CDK 2/4/6 inhibitor) twice daily by oral gavage in combination with anti-PD-1 antibody (PF- 06937004) administered at 10mg/kg IP injection and anti-4-1 BB antibody (PF-07218859) administered at 3mg/kg by IP injection every three days for three doses, 30 mg/kg PF- 06873600 (CDK 2/4/6 inhibitor) twice daily by oral gavage in combination with anti-PD-1 antibody (PF-06937004) administered at 10mg/kg IP injection and anti-OX40 antibody (PF-07201252) administered at 5mg/kg by IP injection every three days for three doses and 30 mg/kg PF-06873600 (CDK 2/4/6 inhibitor) twice daily by oral gavage in combination with
- Example 7 CDK2/4/6 Inhibitor (PF-068736000) Synergizes with PD-1 Based Immune Checkpoint Blockade in the 4T1 Syngeneic Mouse Tumor Model
- PF-06873600 was evaluated in the 4T1 syngeneic mouse tumor model in combination with antibodies targeting PD-L1 , 4-1 BB and 0X40 to assess efficacy on primary tumor growth and survival.
- 4T1 cells were obtained from American Type Culture Collection (ATCC) and cultured in Roswell Park Memorial Institute (RPMI1640) supplemented with 10% fetal bovine serum (FBS). All cells were maintained in a humidified incubator at 37°C with 5% carbon dioxide (CO2).
- Female C57/BL6 mice were obtained from Jackson Laboratories at 8 weeks of age. To generate the syngeneic model, 30,000 4T1 tumor cells were subcutaneously implanted into the right flank of female C57/BL6 mice. Tumor bearing mice were randomized into four treatment groups based on average tumor sizes of approximately 70 mm 3 per group.
- Study groups included vehicle, 30 mg/kg PF-06873600 (CDK 2/4/6 inhibitor) twice daily by oral gavage, combination of 10mg/kg anti-PD-1 antibody (PF-06937004) with 5mg/kg anti-OX40 antibody (PF-07201252) and with 3mg/kg anti-4-1 BB antibody (PF-07218859) all administered by IP injection, and the combination of PF-06873600, anti-PD-1 antibody, anti-OX40 antibody and anti-41 -BB antibody dosed as described in the cohorts above. All antibodies were administered as three doses; one every three days after the study initiation. All antibody formulations are phosphate buffered saline based while PF-06873600 was administered in a 0.5% methocel/Tween suspension.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Mycology (AREA)
- General Chemical & Material Sciences (AREA)
- Microbiology (AREA)
- Endocrinology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3141531A CA3141531A1 (en) | 2019-05-24 | 2020-05-20 | Combination therapies using cdk inhibitors |
| AU2020281535A AU2020281535A1 (en) | 2019-05-24 | 2020-05-20 | Combination therapies using CDK inhibitors |
| EP20729001.6A EP3976090A1 (en) | 2019-05-24 | 2020-05-20 | Combination therapies using cdk inhibitors |
| US17/613,557 US20220241412A1 (en) | 2019-05-24 | 2020-05-20 | Combination therapies using cdk inhibitors |
| CN202080038504.6A CN113874036A (zh) | 2019-05-24 | 2020-05-20 | 使用cdk抑制剂的联合治疗 |
| JP2021569567A JP2022534889A (ja) | 2019-05-24 | 2020-05-20 | Cdk阻害剤を使用した組合せ療法 |
| IL288306A IL288306A (en) | 2019-05-24 | 2021-11-22 | Combined treatments using cdk inhibitors |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962852523P | 2019-05-24 | 2019-05-24 | |
| US62/852,523 | 2019-05-24 | ||
| US202063009433P | 2020-04-13 | 2020-04-13 | |
| US63/009,433 | 2020-04-13 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020239558A1 true WO2020239558A1 (en) | 2020-12-03 |
Family
ID=70918406
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2020/064024 Ceased WO2020239558A1 (en) | 2019-05-24 | 2020-05-20 | Combination therapies using cdk inhibitors |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20220241412A1 (https=) |
| EP (1) | EP3976090A1 (https=) |
| JP (1) | JP2022534889A (https=) |
| CN (1) | CN113874036A (https=) |
| AU (1) | AU2020281535A1 (https=) |
| CA (1) | CA3141531A1 (https=) |
| IL (1) | IL288306A (https=) |
| WO (1) | WO2020239558A1 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022263632A1 (en) * | 2021-06-18 | 2022-12-22 | Alligator Bioscience Ab | Novel combination therapies and uses thereof |
| WO2023281413A1 (en) * | 2021-07-09 | 2023-01-12 | Pfizer Inc. | Methods and dosing regimens comprising pf-06873600 for the treatment of cancer |
| WO2026024674A1 (en) | 2024-07-22 | 2026-01-29 | Genesis Therapeutics, Inc. | Methods of treating skp2-associated cancers |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20250053841A (ko) * | 2022-08-30 | 2025-04-22 | 도레이 카부시키가이샤 | 암의 치료 및/또는 예방을 위한 의약품 |
Citations (88)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1984003564A1 (en) | 1983-03-08 | 1984-09-13 | Commw Serum Lab Commission | Method of determining antigenically active amino acid sequences |
| WO1984003506A1 (en) | 1983-03-08 | 1984-09-13 | Commw Serum Lab Commission | Antigenically active amino acid sequences |
| US4708871A (en) | 1983-03-08 | 1987-11-24 | Commonwealth Serum Laboratories Commission | Antigenically active amino acid sequences |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4833092A (en) | 1985-04-22 | 1989-05-23 | Commonwealth Serum Laboratories Commission | Method for determining mimotopes |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| WO1993011161A1 (en) | 1991-11-25 | 1993-06-10 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5428130A (en) | 1989-02-23 | 1995-06-27 | Genentech, Inc. | Hybrid immunoglobulins |
| US5556762A (en) | 1990-11-21 | 1996-09-17 | Houghten Pharmaceutical Inc. | Scanning synthetic peptide combinatorial libraries: oligopeptide mixture sets having a one predetermined residue at a single, predetermined position, methods of making and using the same |
| US5571689A (en) | 1988-06-16 | 1996-11-05 | Washington University | Method of N-acylating peptide and proteins with diheteroatom substituted analogs of myristic acid |
| US5663143A (en) | 1988-09-02 | 1997-09-02 | Dyax Corp. | Engineered human-derived kunitz domains that inhibit human neutrophil elastase |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| WO1999042585A1 (en) | 1998-02-24 | 1999-08-26 | Sisters Of Providence In Oregon | Compositions containing an ox-40 receptor binding agent or a nucleic acid encoding the same and methods for enhancing antigen-specific immune response |
| US6329511B1 (en) | 1998-12-01 | 2001-12-11 | Protein Design Labs, Inc. | Humanized antibodies to γ-interferon |
| WO2003062236A1 (en) | 2002-01-22 | 2003-07-31 | Warner-Lambert Company Llc | 2-(PYRIDIN-2-YLAMINO)-PYRIDO[2,3d]PYRIMIDIN-7-ONES |
| WO2004004771A1 (ja) | 2002-07-03 | 2004-01-15 | Ono Pharmaceutical Co., Ltd. | 免疫賦活組成物 |
| WO2004042072A2 (en) | 2002-11-01 | 2004-05-21 | The Regents Of The University Of Colorado, A Body Corporate | Quantitative analysis of protein isoforms using matrix-assisted laser desorption/ionization time of flight mass spectrometry |
| WO2004056875A1 (en) | 2002-12-23 | 2004-07-08 | Wyeth | Antibodies against pd-1 and uses therefor |
| WO2004072286A1 (ja) | 2003-01-23 | 2004-08-26 | Ono Pharmaceutical Co., Ltd. | ヒトpd−1に対し特異性を有する物質 |
| WO2004092219A2 (en) | 2003-04-10 | 2004-10-28 | Protein Design Labs, Inc | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2005005426A1 (en) | 2003-07-11 | 2005-01-20 | Warner-Lambert Company Llc | Isethionate salt of a selective cdk4 inhibitor |
| US20050214860A1 (en) | 1999-01-29 | 2005-09-29 | Zhenping Zhu | Antibodies specific to KDR and uses thereof |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| WO2008032157A2 (en) | 2006-09-08 | 2008-03-20 | Pfizer Products Inc. | Synthesis of 2-(pyridin-2-ylamino)-pyrido[2,3-d]pyrimidin-7-ones |
| WO2010036959A2 (en) | 2008-09-26 | 2010-04-01 | Dana-Farber Cancer Institute | Human anti-pd-1, pd-l1, and pd-l2 antibodies and uses therefor |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| WO2010089411A2 (en) | 2009-02-09 | 2010-08-12 | Universite De La Mediterranee | Pd-1 antibodies and pd-l1 antibodies and uses thereof |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| US7960515B2 (en) | 2007-12-14 | 2011-06-14 | Bristol-Myers Squibb Company | Binding molecules to the human OX40 receptor |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| US8168757B2 (en) | 2008-03-12 | 2012-05-01 | Merck Sharp & Dohme Corp. | PD-1 binding proteins |
| US20120251537A1 (en) | 2006-12-27 | 2012-10-04 | Emory University | Compositions and methods for the treatment of infections and tumors |
| US8337850B2 (en) | 2010-09-09 | 2012-12-25 | Pfizer Inc. | 4-1BB binding molecules |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| WO2013019906A1 (en) | 2011-08-01 | 2013-02-07 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and mek inhibitors |
| WO2013028231A1 (en) | 2011-08-23 | 2013-02-28 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013119202A1 (en) | 2012-02-06 | 2013-08-15 | Providence Health & Services - Oregon | Cancer treatment and monitoring methods using ox40 agonists |
| US20130230514A1 (en) | 2008-08-25 | 2013-09-05 | Amplimmune, Inc. | Compositions of pd-1 antagonists and methods of use |
| US20130237580A1 (en) | 2012-03-07 | 2013-09-12 | Aurigene Discovery Technologies Limited | Peptidomimetic compounds as immunomodulators |
| US20130280265A1 (en) | 2011-09-20 | 2013-10-24 | Vical Incorporated | Synergistic anti-tumor efficacy using alloantigen combination immunotherapy |
| US20130309250A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| WO2014100079A1 (en) | 2012-12-21 | 2014-06-26 | Merck Sharp & Dohme Corp. | Antibodies that bind to human programmed death ligand 1 (pd-l1) |
| WO2014128588A1 (en) | 2013-02-21 | 2014-08-28 | Pfizer Inc. | Solid forms of a selective cdk4/6 inhibitor |
| WO2015033301A1 (en) | 2013-09-06 | 2015-03-12 | Aurigene Discovery Technologies Limited | 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives as immunomodulators |
| WO2015033299A1 (en) | 2013-09-06 | 2015-03-12 | Aurigene Discovery Technologies Limited | 1,2,4-oxadiazole derivatives as immunomodulators |
| WO2015035606A1 (en) | 2013-09-13 | 2015-03-19 | Beigene, Ltd. | Anti-pd1 antibodies and their use as therapeutics and diagnostics |
| WO2015061668A1 (en) | 2013-10-25 | 2015-04-30 | Dana-Farber Cancer Institute, Inc. | Anti-pd-l1 monoclonal antibodies and fragments thereof |
| WO2015085847A1 (zh) | 2013-12-12 | 2015-06-18 | 上海恒瑞医药有限公司 | Pd-1抗体、其抗原结合片段及其医药用途 |
| US20150190506A1 (en) | 2013-12-17 | 2015-07-09 | Genentech, Inc. | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists |
| WO2015112800A1 (en) | 2014-01-23 | 2015-07-30 | Regeneron Pharmaceuticals, Inc. | Human antibodies to pd-1 |
| WO2015112900A1 (en) | 2014-01-24 | 2015-07-30 | Dana-Farber Cancer Institue, Inc. | Antibody molecules to pd-1 and uses thereof |
| US20150282460A1 (en) | 2014-04-04 | 2015-10-08 | Crown Bioscience Inc. (Taicang) | Animal model with human immune system |
| WO2016000619A1 (en) | 2014-07-03 | 2016-01-07 | Beigene, Ltd. | Anti-pd-l1 antibodies and their use as therapeutics and diagnostics |
| US20160108123A1 (en) | 2014-10-14 | 2016-04-21 | Novartis Ag | Antibody molecules to pd-l1 and uses thereof |
| WO2016092419A1 (en) | 2014-12-09 | 2016-06-16 | Rinat Neuroscience Corp. | Anti-pd-1 antibodies and methods of use thereof |
| WO2016094273A1 (en) | 2014-12-08 | 2016-06-16 | Dana-Farber Cancer Institute, Inc. | Methods for upregulating immune responses using combinations of anti-rgmb and anti-pd-1 agents |
| WO2016149201A2 (en) | 2015-03-13 | 2016-09-22 | Cytomx Therapeutics, Inc. | Anti-pdl1 antibodies, activatable anti-pdl1 antibodies, and methods of use thereof |
| WO2016149350A1 (en) | 2015-03-17 | 2016-09-22 | Mayo Foundation For Medical Education And Research | Methods and materials for assessing and treating cancer |
| WO2016179576A1 (en) | 2015-05-07 | 2016-11-10 | Bioxcel Corporation | Novel immunomodulatory therapeutic strategies targeting tumors in cancer |
| WO2017019846A1 (en) | 2015-07-30 | 2017-02-02 | Macrogenics, Inc. | Pd-1-binding molecules and methods use thereof |
| WO2017017623A1 (en) | 2015-07-29 | 2017-02-02 | Novartis Ag | Combined use of anti pd-1 and anti m-csf antibodies in the treatment of cancer |
| WO2017020801A1 (zh) | 2015-07-31 | 2017-02-09 | 苏州康宁杰瑞生物科技有限公司 | 针对程序性死亡配体(pd-l1)的单域抗体及其衍生蛋白 |
| WO2017024465A1 (en) | 2015-08-10 | 2017-02-16 | Innovent Biologics (Suzhou) Co., Ltd. | Pd-1 antibodies |
| WO2017054646A1 (zh) | 2015-09-28 | 2017-04-06 | 江苏恒瑞医药股份有限公司 | 一种抗pd-1抗体制剂及其在医药上的应用 |
| WO2017071625A1 (zh) | 2015-10-30 | 2017-05-04 | 中山康方生物医药有限公司 | 一种抗pd-1单克隆抗体、其药物组合物及其用途 |
| WO2017084495A1 (zh) | 2015-11-17 | 2017-05-26 | 江苏恒瑞医药股份有限公司 | Pd-l1抗体、其抗原结合片段及其医药用途 |
| WO2017103147A1 (en) | 2015-12-18 | 2017-06-22 | Institut Gustave Roussy | Method for assessing the response to pd-1/pdl-1 targeting drugs |
| WO2017112741A1 (en) | 2015-12-22 | 2017-06-29 | Novartis Ag | Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy |
| WO2017132827A1 (en) | 2016-02-02 | 2017-08-10 | Innovent Biologics (Suzhou) Co., Ltd. | Pd-1 antibodies |
| WO2017161976A1 (en) | 2016-03-23 | 2017-09-28 | Mabspace Biosciences (Suzhou) Co., Ltd | Novel anti-pd-l1 antibodies |
| WO2017205213A1 (en) | 2016-05-23 | 2017-11-30 | Eli Lilly And Company | Combination therapy of abemaciclib and immune checkpoint modulators for use in the treatment of cancer |
| WO2017214092A1 (en) | 2016-06-07 | 2017-12-14 | Macrogenics, Inc. | Combination therapy |
| WO2018005682A2 (en) | 2016-06-29 | 2018-01-04 | Checkpoint Therapeutics, Inc. | Pd-l1-specific antibodies and methods of using the same |
| WO2018013017A1 (ru) | 2016-07-13 | 2018-01-18 | Закрытое Акционерное Общество "Биокад" | Анти-pd-1-антитела, способ их получения и способ применения |
| WO2018033815A1 (en) | 2016-08-15 | 2018-02-22 | Pfizer Inc. | Pyridopyrimdinone cdk2/4/6 inhibitors |
| WO2018053106A1 (en) | 2016-09-14 | 2018-03-22 | Abbvie Biotherapeutics Inc. | Anti-pd-1(cd279) antibodies |
| WO2018053709A1 (en) | 2016-09-21 | 2018-03-29 | Wuxi Biologics (Shanghai) Co., Ltd. | The novel monoclonal antibodies to programmed death 1 (pd-1) |
| WO2018055503A1 (en) | 2016-09-20 | 2018-03-29 | Novartis Ag | Combination comprising a pd-1 antagonist and an fgfr4 inhibitor |
| WO2018068336A1 (en) | 2016-10-15 | 2018-04-19 | Innovent Biologics (Suzhou) Co., Ltd | Pd-1 antibodies |
| WO2018072743A1 (zh) | 2016-10-21 | 2018-04-26 | 苏州盛迪亚生物医药有限公司 | Pd-1抗体与ido抑制剂联合在制备抗肿瘤的药物中的用途 |
| WO2018085469A2 (en) | 2016-11-01 | 2018-05-11 | Anaptysbio, Inc. | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
| WO2018106529A1 (en) | 2016-12-08 | 2018-06-14 | Eli Lilly And Company | Anti-tim-3 antibodies for combination with anti-pd-l1 antibodies |
| WO2018111890A1 (en) | 2016-12-12 | 2018-06-21 | Genentech, Inc. | Methods of treating cancer using anti-pd-l1 antibodies and antiandrogens |
| WO2019099838A1 (en) * | 2017-11-16 | 2019-05-23 | Novartis Ag | Combination therapies |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20170060042A (ko) * | 2014-09-13 | 2017-05-31 | 노파르티스 아게 | Alk 억제제의 조합 요법 |
| US10945994B2 (en) * | 2015-05-14 | 2021-03-16 | Pfizer Inc. | Combinations comprising a pyrrolidine-2,5-dione IDO1 inhibitor and an anti-body |
-
2020
- 2020-05-20 WO PCT/EP2020/064024 patent/WO2020239558A1/en not_active Ceased
- 2020-05-20 JP JP2021569567A patent/JP2022534889A/ja active Pending
- 2020-05-20 CN CN202080038504.6A patent/CN113874036A/zh active Pending
- 2020-05-20 CA CA3141531A patent/CA3141531A1/en active Pending
- 2020-05-20 EP EP20729001.6A patent/EP3976090A1/en not_active Withdrawn
- 2020-05-20 US US17/613,557 patent/US20220241412A1/en not_active Abandoned
- 2020-05-20 AU AU2020281535A patent/AU2020281535A1/en not_active Abandoned
-
2021
- 2021-11-22 IL IL288306A patent/IL288306A/en unknown
Patent Citations (112)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1984003564A1 (en) | 1983-03-08 | 1984-09-13 | Commw Serum Lab Commission | Method of determining antigenically active amino acid sequences |
| WO1984003506A1 (en) | 1983-03-08 | 1984-09-13 | Commw Serum Lab Commission | Antigenically active amino acid sequences |
| US4708871A (en) | 1983-03-08 | 1987-11-24 | Commonwealth Serum Laboratories Commission | Antigenically active amino acid sequences |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4833092A (en) | 1985-04-22 | 1989-05-23 | Commonwealth Serum Laboratories Commission | Method for determining mimotopes |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5571689A (en) | 1988-06-16 | 1996-11-05 | Washington University | Method of N-acylating peptide and proteins with diheteroatom substituted analogs of myristic acid |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5663143A (en) | 1988-09-02 | 1997-09-02 | Dyax Corp. | Engineered human-derived kunitz domains that inhibit human neutrophil elastase |
| US5428130A (en) | 1989-02-23 | 1995-06-27 | Genentech, Inc. | Hybrid immunoglobulins |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| US5556762A (en) | 1990-11-21 | 1996-09-17 | Houghten Pharmaceutical Inc. | Scanning synthetic peptide combinatorial libraries: oligopeptide mixture sets having a one predetermined residue at a single, predetermined position, methods of making and using the same |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| WO1993011161A1 (en) | 1991-11-25 | 1993-06-10 | Enzon, Inc. | Multivalent antigen-binding proteins |
| WO1999042585A1 (en) | 1998-02-24 | 1999-08-26 | Sisters Of Providence In Oregon | Compositions containing an ox-40 receptor binding agent or a nucleic acid encoding the same and methods for enhancing antigen-specific immune response |
| US6329511B1 (en) | 1998-12-01 | 2001-12-11 | Protein Design Labs, Inc. | Humanized antibodies to γ-interferon |
| US20050214860A1 (en) | 1999-01-29 | 2005-09-29 | Zhenping Zhu | Antibodies specific to KDR and uses thereof |
| US7456168B2 (en) | 2002-01-22 | 2008-11-25 | Warner-Lambert Company | 2-(pyridin-2-ylamino)-pyrido[2,3, d]pyrimidin-7-ones |
| WO2003062236A1 (en) | 2002-01-22 | 2003-07-31 | Warner-Lambert Company Llc | 2-(PYRIDIN-2-YLAMINO)-PYRIDO[2,3d]PYRIMIDIN-7-ONES |
| US7208489B2 (en) | 2002-01-22 | 2007-04-24 | Warner-Lambert Company | 2-(pyridin-2-ylamino)-pyrido [2,3-d]pyrimidin-7-ones |
| US6936612B2 (en) | 2002-01-22 | 2005-08-30 | Warner-Lambert Company | 2-(Pyridin-2-ylamino)-pyrido[2,3-d]pyrimidin-7-ones |
| WO2004004771A1 (ja) | 2002-07-03 | 2004-01-15 | Ono Pharmaceutical Co., Ltd. | 免疫賦活組成物 |
| WO2004042072A2 (en) | 2002-11-01 | 2004-05-21 | The Regents Of The University Of Colorado, A Body Corporate | Quantitative analysis of protein isoforms using matrix-assisted laser desorption/ionization time of flight mass spectrometry |
| WO2004056875A1 (en) | 2002-12-23 | 2004-07-08 | Wyeth | Antibodies against pd-1 and uses therefor |
| US7521051B2 (en) | 2002-12-23 | 2009-04-21 | Medimmune Limited | Methods of upmodulating adaptive immune response using anti-PD-1 antibodies |
| US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
| WO2004072286A1 (ja) | 2003-01-23 | 2004-08-26 | Ono Pharmaceutical Co., Ltd. | ヒトpd−1に対し特異性を有する物質 |
| WO2004092219A2 (en) | 2003-04-10 | 2004-10-28 | Protein Design Labs, Inc | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| US7345171B2 (en) | 2003-07-11 | 2008-03-18 | Warner-Lambert Company Llc | Isethionate salt of a selective CKD4 inhibitor |
| WO2005005426A1 (en) | 2003-07-11 | 2005-01-20 | Warner-Lambert Company Llc | Isethionate salt of a selective cdk4 inhibitor |
| US7863278B2 (en) | 2003-07-11 | 2011-01-04 | Warner-Lambert CompanyLLC | Isethionate salt of a selective CDK4 inhibitor |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| US8383796B2 (en) | 2005-07-01 | 2013-02-26 | Medarex, Inc. | Nucleic acids encoding monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| US20090055944A1 (en) | 2005-07-01 | 2009-02-26 | Medarex, Inc. | Human monoclonal antibodies to be programmed death ligand 1 (pd-l1) |
| WO2008032157A2 (en) | 2006-09-08 | 2008-03-20 | Pfizer Products Inc. | Synthesis of 2-(pyridin-2-ylamino)-pyrido[2,3-d]pyrimidin-7-ones |
| US7781583B2 (en) | 2006-09-08 | 2010-08-24 | Pfizer Inc | Synthesis of 2-(pyridin-2-ylamino)-pyrido[2,3-d] pryimidin-7-ones |
| US20120251537A1 (en) | 2006-12-27 | 2012-10-04 | Emory University | Compositions and methods for the treatment of infections and tumors |
| US20130109843A1 (en) | 2007-06-18 | 2013-05-02 | Mds Oss B.V. | Antibodies to human programmed death receptor pd-1 |
| US20130108651A1 (en) | 2007-06-18 | 2013-05-02 | Msd Oss B.V. | Antibodies to human programmed death receptor pd-1 |
| EP2170959B1 (en) | 2007-06-18 | 2013-10-02 | Merck Sharp & Dohme B.V. | Antibodies to human programmed death receptor pd-1 |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| US7960515B2 (en) | 2007-12-14 | 2011-06-14 | Bristol-Myers Squibb Company | Binding molecules to the human OX40 receptor |
| US8168757B2 (en) | 2008-03-12 | 2012-05-01 | Merck Sharp & Dohme Corp. | PD-1 binding proteins |
| US20130230514A1 (en) | 2008-08-25 | 2013-09-05 | Amplimmune, Inc. | Compositions of pd-1 antagonists and methods of use |
| US20110271358A1 (en) | 2008-09-26 | 2011-11-03 | Dana-Farber Cancer Institute, Inc. | Human anti-pd-1, pd-l1, and pd-l2 antibodies and uses therefor |
| WO2010036959A2 (en) | 2008-09-26 | 2010-04-01 | Dana-Farber Cancer Institute | Human anti-pd-1, pd-l1, and pd-l2 antibodies and uses therefor |
| US8552154B2 (en) | 2008-09-26 | 2013-10-08 | Emory University | Anti-PD-L1 antibodies and uses therefor |
| US20100203056A1 (en) | 2008-12-09 | 2010-08-12 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US20130045202A1 (en) | 2008-12-09 | 2013-02-21 | Genentech, Inc. | Anti-pd-l1 antibodies and articles of manufacture |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US20120039906A1 (en) | 2009-02-09 | 2012-02-16 | INSER (Institut National de la Recherche Medicale) | PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof |
| WO2010089411A2 (en) | 2009-02-09 | 2010-08-12 | Universite De La Mediterranee | Pd-1 antibodies and pd-l1 antibodies and uses thereof |
| US20130017199A1 (en) | 2009-11-24 | 2013-01-17 | AMPLIMMUNE ,Inc. a corporation | Simultaneous inhibition of pd-l1/pd-l2 |
| US20130034559A1 (en) | 2009-11-24 | 2013-02-07 | Medlmmune Limited | Targeted Binding Agents Against B7-H1 |
| US8779108B2 (en) | 2009-11-24 | 2014-07-15 | Medimmune, Limited | Targeted binding agents against B7-H1 |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| US20130078240A1 (en) | 2010-09-09 | 2013-03-28 | Pfizer Inc | 4-1bb binding molecules |
| US8337850B2 (en) | 2010-09-09 | 2012-12-25 | Pfizer Inc. | 4-1BB binding molecules |
| WO2013019906A1 (en) | 2011-08-01 | 2013-02-07 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and mek inhibitors |
| WO2013028231A1 (en) | 2011-08-23 | 2013-02-28 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
| US20130280265A1 (en) | 2011-09-20 | 2013-10-24 | Vical Incorporated | Synergistic anti-tumor efficacy using alloantigen combination immunotherapy |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013119202A1 (en) | 2012-02-06 | 2013-08-15 | Providence Health & Services - Oregon | Cancer treatment and monitoring methods using ox40 agonists |
| US20130237580A1 (en) | 2012-03-07 | 2013-09-12 | Aurigene Discovery Technologies Limited | Peptidomimetic compounds as immunomodulators |
| US20130309250A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| WO2014100079A1 (en) | 2012-12-21 | 2014-06-26 | Merck Sharp & Dohme Corp. | Antibodies that bind to human programmed death ligand 1 (pd-l1) |
| WO2014128588A1 (en) | 2013-02-21 | 2014-08-28 | Pfizer Inc. | Solid forms of a selective cdk4/6 inhibitor |
| WO2015033301A1 (en) | 2013-09-06 | 2015-03-12 | Aurigene Discovery Technologies Limited | 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives as immunomodulators |
| WO2015033299A1 (en) | 2013-09-06 | 2015-03-12 | Aurigene Discovery Technologies Limited | 1,2,4-oxadiazole derivatives as immunomodulators |
| WO2015035606A1 (en) | 2013-09-13 | 2015-03-19 | Beigene, Ltd. | Anti-pd1 antibodies and their use as therapeutics and diagnostics |
| WO2015061668A1 (en) | 2013-10-25 | 2015-04-30 | Dana-Farber Cancer Institute, Inc. | Anti-pd-l1 monoclonal antibodies and fragments thereof |
| WO2015085847A1 (zh) | 2013-12-12 | 2015-06-18 | 上海恒瑞医药有限公司 | Pd-1抗体、其抗原结合片段及其医药用途 |
| US20150190506A1 (en) | 2013-12-17 | 2015-07-09 | Genentech, Inc. | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists |
| WO2015112800A1 (en) | 2014-01-23 | 2015-07-30 | Regeneron Pharmaceuticals, Inc. | Human antibodies to pd-1 |
| WO2015112900A1 (en) | 2014-01-24 | 2015-07-30 | Dana-Farber Cancer Institue, Inc. | Antibody molecules to pd-1 and uses thereof |
| US20150282460A1 (en) | 2014-04-04 | 2015-10-08 | Crown Bioscience Inc. (Taicang) | Animal model with human immune system |
| WO2016000619A1 (en) | 2014-07-03 | 2016-01-07 | Beigene, Ltd. | Anti-pd-l1 antibodies and their use as therapeutics and diagnostics |
| US20160108123A1 (en) | 2014-10-14 | 2016-04-21 | Novartis Ag | Antibody molecules to pd-l1 and uses thereof |
| WO2016061142A1 (en) | 2014-10-14 | 2016-04-21 | Novartis Ag | Antibody molecules to pd-l1 and uses thereof |
| WO2016094273A1 (en) | 2014-12-08 | 2016-06-16 | Dana-Farber Cancer Institute, Inc. | Methods for upregulating immune responses using combinations of anti-rgmb and anti-pd-1 agents |
| WO2016092419A1 (en) | 2014-12-09 | 2016-06-16 | Rinat Neuroscience Corp. | Anti-pd-1 antibodies and methods of use thereof |
| WO2016149201A2 (en) | 2015-03-13 | 2016-09-22 | Cytomx Therapeutics, Inc. | Anti-pdl1 antibodies, activatable anti-pdl1 antibodies, and methods of use thereof |
| WO2016149350A1 (en) | 2015-03-17 | 2016-09-22 | Mayo Foundation For Medical Education And Research | Methods and materials for assessing and treating cancer |
| WO2016179576A1 (en) | 2015-05-07 | 2016-11-10 | Bioxcel Corporation | Novel immunomodulatory therapeutic strategies targeting tumors in cancer |
| WO2017017623A1 (en) | 2015-07-29 | 2017-02-02 | Novartis Ag | Combined use of anti pd-1 and anti m-csf antibodies in the treatment of cancer |
| WO2017019846A1 (en) | 2015-07-30 | 2017-02-02 | Macrogenics, Inc. | Pd-1-binding molecules and methods use thereof |
| WO2017020801A1 (zh) | 2015-07-31 | 2017-02-09 | 苏州康宁杰瑞生物科技有限公司 | 针对程序性死亡配体(pd-l1)的单域抗体及其衍生蛋白 |
| WO2017024465A1 (en) | 2015-08-10 | 2017-02-16 | Innovent Biologics (Suzhou) Co., Ltd. | Pd-1 antibodies |
| WO2017054646A1 (zh) | 2015-09-28 | 2017-04-06 | 江苏恒瑞医药股份有限公司 | 一种抗pd-1抗体制剂及其在医药上的应用 |
| WO2017071625A1 (zh) | 2015-10-30 | 2017-05-04 | 中山康方生物医药有限公司 | 一种抗pd-1单克隆抗体、其药物组合物及其用途 |
| WO2017084495A1 (zh) | 2015-11-17 | 2017-05-26 | 江苏恒瑞医药股份有限公司 | Pd-l1抗体、其抗原结合片段及其医药用途 |
| WO2017103147A1 (en) | 2015-12-18 | 2017-06-22 | Institut Gustave Roussy | Method for assessing the response to pd-1/pdl-1 targeting drugs |
| WO2017112741A1 (en) | 2015-12-22 | 2017-06-29 | Novartis Ag | Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy |
| WO2017132827A1 (en) | 2016-02-02 | 2017-08-10 | Innovent Biologics (Suzhou) Co., Ltd. | Pd-1 antibodies |
| WO2017161976A1 (en) | 2016-03-23 | 2017-09-28 | Mabspace Biosciences (Suzhou) Co., Ltd | Novel anti-pd-l1 antibodies |
| WO2017205213A1 (en) | 2016-05-23 | 2017-11-30 | Eli Lilly And Company | Combination therapy of abemaciclib and immune checkpoint modulators for use in the treatment of cancer |
| WO2017214092A1 (en) | 2016-06-07 | 2017-12-14 | Macrogenics, Inc. | Combination therapy |
| WO2018005682A2 (en) | 2016-06-29 | 2018-01-04 | Checkpoint Therapeutics, Inc. | Pd-l1-specific antibodies and methods of using the same |
| WO2018013017A1 (ru) | 2016-07-13 | 2018-01-18 | Закрытое Акционерное Общество "Биокад" | Анти-pd-1-антитела, способ их получения и способ применения |
| WO2018033815A1 (en) | 2016-08-15 | 2018-02-22 | Pfizer Inc. | Pyridopyrimdinone cdk2/4/6 inhibitors |
| WO2018053106A1 (en) | 2016-09-14 | 2018-03-22 | Abbvie Biotherapeutics Inc. | Anti-pd-1(cd279) antibodies |
| WO2018055503A1 (en) | 2016-09-20 | 2018-03-29 | Novartis Ag | Combination comprising a pd-1 antagonist and an fgfr4 inhibitor |
| WO2018053709A1 (en) | 2016-09-21 | 2018-03-29 | Wuxi Biologics (Shanghai) Co., Ltd. | The novel monoclonal antibodies to programmed death 1 (pd-1) |
| WO2018068336A1 (en) | 2016-10-15 | 2018-04-19 | Innovent Biologics (Suzhou) Co., Ltd | Pd-1 antibodies |
| WO2018072743A1 (zh) | 2016-10-21 | 2018-04-26 | 苏州盛迪亚生物医药有限公司 | Pd-1抗体与ido抑制剂联合在制备抗肿瘤的药物中的用途 |
| WO2018085469A2 (en) | 2016-11-01 | 2018-05-11 | Anaptysbio, Inc. | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
| WO2018106529A1 (en) | 2016-12-08 | 2018-06-14 | Eli Lilly And Company | Anti-tim-3 antibodies for combination with anti-pd-l1 antibodies |
| WO2018111890A1 (en) | 2016-12-12 | 2018-06-21 | Genentech, Inc. | Methods of treating cancer using anti-pd-l1 antibodies and antiandrogens |
| WO2019099838A1 (en) * | 2017-11-16 | 2019-05-23 | Novartis Ag | Combination therapies |
Non-Patent Citations (122)
| Title |
|---|
| "Molecular Probes, Catalogue", 2003, SIGMA-ALDRICH |
| "Presta, Selection, design, and engineering of therapeutic antibodies", J. ALLERGY CLIN. IMMUNOL., vol. 116, 2005, pages 731 |
| AHMADZADEH ET AL.: "Tumor antigen-specific CD8 T cells infiltrating the tumor express high levels of PD-1 and are functionally impaired", BLOOD, vol. 114, no. 8, 2009, pages 1537, XP055648069 |
| ALEXANDER ET AL., CYCLIN E OVEREXPRESSION AS A BIOMARKER FOR COMBINATION TREATMENT STRATEGIES IN INFLAMMATORY BREAST CANCER |
| AMERSHAM: "Pharmacia Biotech", BIODIRECTORY, 2001, pages 384 - 391 |
| ASGHAR ET AL.: "The history and future of targeting cyclin-dependent kinases in cancer therapy", NAT. REV. DRUG. DISCOV., vol. 14, no. 2, 2015, pages 130 - 146, XP055655676, DOI: 10.1038/nrd4504 |
| AUSUBEL ET AL., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, vol. 1-4, 2001 |
| AU-YEUNG ET AL.: "Selective Targeting of Cyclin E1-Amplified High-Grade Serous Ovarian Cancer by Cyclin-Dependent Kinase 2 and AKT Inhibition", CLIN. CANCER RES., vol. 23, 2017, pages 1862 - 1874 |
| AYHAN ET AL.: "CCNE1 copy-number gain and overexpression identify ovarian clear cell carcinoma with a poor prognosis", MODERN PATHOLOGY, vol. 30, 2017, pages 297 - 303 |
| BACA ET AL.: "Antibody humanization using monovalent phage display", J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684, XP002308888, DOI: 10.1074/jbc.272.16.10678 |
| BARBAS ET AL.: "In vitro evolution of a neutralizing human antibody to human immunodeficiency virus type 1 to enhance affinity and broaden strain cross-reactivity", PROC NAT. ACAD. SCI., vol. 91, 1994, pages 3809 - 3813 |
| BARBAS ET AL.: "Phage Display: A Laboratory Manual", 2001 |
| BARBAS: "Synthetic human antibodies", NATURE MEDICINE, vol. 1, 1995, pages 837 - 839, XP001194649, DOI: 10.1038/nm0895-837 |
| BRAHMER ET AL.: "Safety and activity of anti-PD-L1 antibody in patients with advanced cancer", NEW ENGL. J. MED., vol. 366, 2012, pages 2455, XP002685330, DOI: 10.1056/NEJMoa1200694 |
| CALDON ET AL.: "Cyclin E2 overexpression is associated with endocrine resistance but not insensitivity to CDK2 inhibition in human breast cancer cells", MOL CANCER THER., vol. 11, 2012, pages 1488 - 99, XP055692618, DOI: 10.1158/1535-7163.MCT-11-0963 |
| CAPEL ET AL.: "Heterogeneity of human IgG Fc receptors", IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34, XP000604919, DOI: 10.1006/immu.1994.1004 |
| CARPENTER ET AL.: "Non-Fc receptor-binding humanized anti-CD3 antibodies induce apoptosis of activated human T cells", J. IMMUNOL., vol. 165, 2000, pages 6205, XP002429073 |
| CHEUK ATC ET AL., CANCER GENE THERAPY, vol. 11, 2004, pages 215 - 226 |
| CHOTHIA ET AL.: "Conformations of immunoglobulin hypervariable regions", NATURE, vol. 342, 1989, pages 877 - 883, XP002030586, DOI: 10.1038/342877a0 |
| CHOTHIALESK: "Canonical structures for the hypervariable regions of immunoglobulins", J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CLACKSON, T. ET AL.: "Making antibody fragments using phage display libraries", NATURE, vol. 352, 1991, pages 624 - 628, XP002101159, DOI: 10.1038/352624a0 |
| COLIGAN ET AL., CURRENT PROTOCOLS IN IMMUNOLOGY, vol. 4, 2001 |
| COLIGAN ET AL., CURRENT PROTOCOLS IN PROTEIN SCIENCE, vol. 2, 2000 |
| CORDON CARDO C.: "Mutations of cell cycle regulators: biological and clinical implications for human neoplasia", AM. J. PATHOL., vol. 147, 1995, pages 545560 |
| CURRAN ET AL.: "PD-1 and CTLA-4 combination blockade expands infiltrating T cells and reduces regulatory T and myeloid cells within B16 melanoma tumors", PNAS, vol. 107, 2010, pages 4275, XP055611670, DOI: 10.1073/pnas.0915174107 |
| CWIRLA, S. E. ET AL.: "Peptides on phage: a vast library of peptides for identifying ligands.", PROC. NATL. ACAD. SCI., vol. 87, 1990, pages 6378, XP000141872, DOI: 10.1073/pnas.87.16.6378 |
| DE BRUIN ET AL.: "Selection of high-affinity phage antibodies from phage display libraries", NATURE BIOTECHNOL., vol. 17, 1999, pages 397 - 399, XP002988308, DOI: 10.1038/7959 |
| DE HAAS ET AL.: "Fcy receptors of phagocytes", J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41 |
| DOLAN ET AL.: "PD-1 pathway inhibitors: changing the landscape of cancer immunotherapy", CANCER CONTROL, vol. 21, 2014, pages 3, XP055428249 |
| DONG ET AL.: "B7-H1, a third member of the B7 family, co-stimulates T-cell proliferation and interleukin-10 secretion", NAT MED, vol. 5, 1999, pages 1365 - 69, XP055204019, DOI: 10.1038/70932 |
| EISENHAUER ET AL.: "New response evaluation criteria in solid tumors: revised RECIST guideline", EUR J OF CANCER, vol. 45, no. 2, 2009, pages 228 - 47 |
| ELSAWAFSINN: "Triple Negative Breast Cancer: Clinical and Histological Correlations", BREAST CARE, vol. 6, 2011, pages 273 - 278 |
| ETEMADMOGHADAM ET AL.: "Resistance to CDK2 Inhibitors Is Associated with Selection of Polyploid Cells in CCNE1-Amplified Ovarian Cancer", CLIN CANCER RES, vol. 19, 2013, pages 5960 - 71 |
| EVERTS: "Selective intracellular delivery of dexamethasone into activated endothelial cells using an E-selectin-directed immunoconjugate", J. IMMUNOL., vol. 168, 2002, pages 883 - 889 |
| FOOTEWINTER: "Antibody framework residues affecting the conformation of the hypervariable loops", J. MOL. BIOL., vol. 224, 1992, pages 487 - 499, XP024011188, DOI: 10.1016/0022-2836(92)91010-M |
| FREEMAN ET AL.: "Engagement of the PD-1 immunoinhibitory receptor by a novel B7 family member leads to negative regulation of lymphocyte activation", J EXP MED, vol. 192, 2000, pages 1027 - 34, XP002942545, DOI: 10.1084/jem.192.7.1027 |
| GEYSEN ET AL.: "A priori delineation of a peptide which mimics a discontinuous antigenic determinant", SYNTHETIC PEPTIDES AS ANTIGENS, 1986, pages 130 - 149 |
| GEYSEN ET AL.: "Small peptides induce antibodies with a sequence and structural requirement for binding antigen comparable to antibodies raised against the native protein", PROC. NATL. ACAD. SCI., vol. 82, 1985, pages 178 - 182, XP000650408, DOI: 10.1073/pnas.82.1.178 |
| GEYSEN ET AL.: "Strategies for epitope analysis using peptide synthesis", J. IMMUNOL. METH., vol. 102, 1987, pages 259 - 274, XP023975234, DOI: 10.1016/0022-1759(87)90085-8 |
| GEYSEN ET AL.: "Use of peptide synthesis to probe viral antigens for epitopes to a resolution of a single amino acid", PROC. NATL. ACAD. SCI., vol. 81, 1984, pages 3998 - 4002, XP002621028, DOI: 10.1073/pnas.81.13.3998 |
| GHETIE ET AL.: "Increasing the serum persistence of an IgG fragment by random mutagenesis", NAT BIOTECHNOL., vol. 15, no. 7, July 1997 (1997-07-01), pages 637 - 40, XP000876642, DOI: 10.1038/nbt0797-637 |
| GHETIEWARD: "FcRn: the MHC class I-related receptor that is more than an IgG transporter", IMMUNOL. TODAY, vol. 1 8, no. 12, 1997, pages 592 - 8 |
| GIBELLINI ET AL.: "Extracellular HIV-1 Tat protein induces the rapid Ser133 phosphorylation and activation of CREB transcription factor in both Jurkat lymphoblastoid T cells and primary...", J. IMMUNOL., vol. 160, 1998, pages 3891 - 3898 |
| GUYER ET AL.: "Immunoglobulin binding by mouse intestinal epithelial cell receptors", J. IMMUNOL., vol. 1 17, 1976, pages 587 |
| HALL MPETERS G.: "Genetic alterations of cyclins, cyclin dependent kinases, and CDK inhibitors in human cancer", ADV. CANCER RES., vol. 68, 1996, pages 67108 |
| HAMERS-CASTERMAN ET AL.: "Naturally occurring antibodies devoid of light chains", NATURE, vol. 363, 1993, pages 446 - 448, XP002535892, DOI: 10.1038/363446a0 |
| HARLOWLANE, USING ANTIBODIES, 1999 |
| HARLOWLANE: "Antibodies A Laboratory Manual", 1988, pages: 139 - 243 |
| HAWKINS ET AL.: "Selection of phage antibodies by binding affinity: mimicking affinity maturation", J. MOL. BIOL., vol. 226, 1992, pages 889 - 896, XP024015348, DOI: 10.1016/0022-2836(92)90639-2 |
| HE ET AL.: "Humanization and pharmacokinetics of a monoclonal antibody with specificity for both E-and P-selectin", J. IMMUNOL., vol. 160, 1998, pages 1029, XP002959848 |
| HERRERA-ABREU ET AL.: "Early Adaptation and Acquired Resistance to CDK4/6 Inhibition in Estrogen Receptor-Positive Breast Cancer", CANCER RES., vol. 76, 2016, pages 2301 - 2313, XP055506969, DOI: 10.1158/0008-5472.CAN-15-0728 |
| HINTON ET AL.: "Engineered human IgG antibodies with longer serum half-lives in primates", J. BIOL. CHEM., vol. 279, no. 8, 2004, pages 6213 - 6, XP002482523, DOI: 10.1074/jbc.C300470200 |
| HOLLINGER ET AL.: "A small bispecific antibody construct expressed as a functional single-chain molecule with high tumor cell cytotoxicity", PROC. NATL. ACAD. SCI., vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOMCHAMES: "Natural and designer binding sites made by phage display technology", IMMUNOL. TODAY, vol. 21, 2000, pages 371 - 377 |
| HSINGBISHOP: "Requirement for nuclear factor- B activation by a distinct subset of CD40-mediated effector functions in B lymphocytes", J. IMMUNOL., vol. 162, 1999, pages 2804 - 2811 |
| HU ET AL.: "Minibodies are minimized antibody-like proteins comprising a scFv joined to a CH3 domain", CANCER RES., vol. 56, 1996, pages 3055 - 3061 |
| IWAI Y ET AL.: "Involvement of PD-L1 on tumor cells in the escape from host immune system and tumor immunotherapy by PD-L1 blockade", PROC NATL ACAD SCI USA, vol. 99, 2002, pages 12293 - 97, XP055572034, DOI: 10.1073/pnas.192461099 |
| JACKSON ET AL.: "In vitro antibody maturation. Improvement of a high affinity, neutralizing antibody against IL-1 beta", J. IMMUNOL., vol. 154, no. 7, 1995, pages 33 10 - 9, XP002355265 |
| JOHNSON DGWALKER CL.: "Cyclins and Cell Cycle Checkpoints", ANNU. REV. PHARMACOL. TOXICOL., vol. 39, 1999, pages 295312 |
| JOHNSONWU: "Antibody Engineering Methods and Protocols", METHODS IN MOLECULAR BIOLOGY, vol. 248, 2003, pages 1 - 25 |
| KAITHAMANA ET AL.: "Induction of experimental autoimmune Graves' disease in BALB/c mice", J. IMMUNOL., vol. 163, 1999, pages 5157 - 5164 |
| KANG ET AL.: "Linkage of Recognition and Replication Functions by Assembling Combinatorial Antibody Fab Libraries Along Phage Surfaces", PNAS, vol. 88, 1991, pages 4363 - 4366, XP002222017, DOI: 10.1073/pnas.88.10.4363 |
| KARP JEBRODER S.: "Molecular foundations of cancer: new targets for intervention", NAT. MED., vol. 1, 1995, pages 309320 |
| KAY ET AL.: "Phage Display of Peptides and Proteins: A Laboratory Manual", 1996 |
| KEIR ME ET AL.: "PD-1 and its ligands in tolerance and immunityAnnu.", REV. IMMUNOL., vol. 26, 2008, pages 677 |
| KEYOMARSI ET AL.: "Cyclin E and survival in patients with breast cancer", N ENGL J MED., vol. 347, 2002, pages 1566 - 75 |
| KOHLER ET AL.: "Continuous cultures of fused cells secreting antibody of predefined specificity", NATURE, vol. 256, 1975, pages 495, XP037052082, DOI: 10.1038/256495a0 |
| LE DOUSSAL ET AL.: "Enhanced in vivo targeting of an asymmetric bivalent hapten to double-antigen-positive mouse B cells with monoclonal antibody conjugate cocktails", J. IMMUNOL., vol. 146, 1991, pages 169 - 175 |
| LOWMAN, H.B. ET AL.: "Selecting high-affinity binding proteins by monovalent phage display", BIOCHEMISTRY, vol. 30, 1991, pages 10832, XP002042460, DOI: 10.1021/bi00109a004 |
| M. DAERON: "Fc RECEPTOR BIOLOGY", ANNU. REV. IMMUNOL. J, vol. 5, 1997, pages 203 - 234, XP001010547, DOI: 10.1146/annurev.immunol.15.1.203 |
| MACCALLUM ET AL.: "Antibody-antigen interactions: contact analysis and binding site topography", J. MOL. BIOL., vol. 262, 1996, pages 732 - 745, XP002242391, DOI: 10.1006/jmbi.1996.0548 |
| MAKABE: "Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 283, 2008, pages 1156 - 1166, XP055110460, DOI: 10.1074/jbc.M706190200 |
| MARKS ET AL.: "By-passing immunization: Building high affinity human antibodies by chain shuffling", BIOLTECHNOLOGY, vol. 10, 1992, pages 779 - 783, XP002917376, DOI: 10.1038/nbt0792-779 |
| MARKS ET AL.: "By-passing immunization: human antibodies from V-gene libraries displayed on phage", J. MOL. BIOL., vol. 222, 1991, pages 581 - 597, XP024010124, DOI: 10.1016/0022-2836(91)90498-U |
| MARKS, J. D. ET AL.: "By-passing immunization: human antibodies from V-gene libraries displayed on phage", J. MOL. BIOL, vol. 222, 1991, pages 581, XP024010124, DOI: 10.1016/0022-2836(91)90498-U |
| MENDEZ ET AL.: "Functional transplant of megabase human immunoglobulin loci recapitulates human antibody response in mice", NATURE GENETICS, vol. 15, 1997, pages 146 - 156, XP002067603, DOI: 10.1038/ng0297-146 |
| MENNE ET AL.: "A comparison of signal sequence prediction methods using a test set of signal peptides", BIOINFORMATICS, vol. 16, 2000, pages 741 - 742 |
| MENNE,K.M.L.: "A comparisonof signal sequence prediction methods using a test set of signal peptides", BIOINFORMATICS, vol. 16, 2000, pages 741 - 742 |
| MEYAARD, L.: "LAIR-1, a novel inhibitory receptor expressed on human mononuclear leukocytes", IMMUNITY, vol. 7, 1997, pages 283 - 290, XP002061091, DOI: 10.1016/S1074-7613(00)80530-0 |
| MILLSTEINCUELLO: "Hybrid hybridomas and their use in immunohistochemistry", NATURE, vol. 305, 1983, pages 537 - 539 |
| MORGAN DO.: "Cyclin dependent kinases: engines, clocks, and microprocessors", ANNU. REV. CELL. DEV. BIOL., vol. 13, 1997, pages 261291 |
| MURALI ET AL.: "Antibody like peptidomimetics as large scale immunodetection probes", CELL MOL BIOL, vol. 49, 2003, pages 209 - 216, XP008098779 |
| NAKAYAMA ET AL.: "Gene amplification CCNE1 is related to poor survival and potential therapeutic target in ovarian cancer", CANCER, vol. 116, 2010, pages 2621 - 34, XP002619178 |
| NICOLAOU ET AL., ANGEW. CHEM INTL. ED. ENGL., vol. 33, 1994, pages 183 - 186 |
| NOSKE ET AL.: "Detection of CCNE1/URI (19q12) amplification by in situ hybridization is common in high grade and type II endometrial cancer", ONCOTARGET, vol. 8, 2017, pages 14794 - 14805 |
| NOSKE: "Detection of CCNE1/URI (19q12) amplification by in situ hybridisation is common in high grade and type II endometrial cancer", ONCOTARGET, vol. 8, 2017, pages 14897 - 14911 |
| OKAZAKI T ET AL.: "PD-1 and PD-1 ligands: from discovery to clinical application", INTERN. IMMUN., vol. 19, no. 7, 2007, pages 813, XP002466284, DOI: 10.1093/intimm/dxm057 |
| O'LEARY ET AL.: "Treating cancer with selective CDK4/6 inhibitors", NATURE REVIEWS, vol. 13, 2016, pages 417 - 430, XP055581045, DOI: 10.1038/nrclinonc.2016.26 |
| OOI ET AL.: "Gene amplification of CCNE1, CCND1, and CDK6 in gastric cancers detected by multiplex ligation-dependent probe amplification and fluorescence in situ hybridization", HUM PATHOL., vol. 61, 2017, pages 58 - 67, XP029939833, DOI: 10.1016/j.humpath.2016.10.025 |
| OWENS ET AL., FLOW CYTOMETRY PRINCIPLES FOR CLINICAL LABORATORY PRACTICE, 1994 |
| PETTY, J. ET AL.: "Survival in human colorectal cancer correlates with expression of the T-cell costimulatory molecule OX-40 (CD134", AM. J. SURG., vol. 183, 2002, pages 512 - 518, XP055361225, DOI: 10.1016/S0002-9610(02)00831-0 |
| PRESTON ET AL.: "The leukocyte/neuron cell surface antigen OX2 binds to a ligand on macrophages", EUR. J. IMMUNOL., vol. 27, 1997, pages 1911 - 1918, XP002094135, DOI: 10.1002/eji.1830270814 |
| RAVETCHKINET: "Fc receptors", ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 92 |
| RIBAS A.WOLCHOK J.: "Cancer immunotherapy using checkpoint blockade", SCIENCE, vol. 359, 2018, pages 1350 - 1355, XP055537294, DOI: 10.1126/science.aar4060 |
| ROBERT L SUTHERLAND ET AL: "CDK inhibitors as potential breast cancer therapeutics: new evidence for enhanced efficacy in ER+ disease", BREAST CANCER RESEARCH : BCR, 1 January 2009 (2009-01-01), England, pages 112 - 112, XP055145540, Retrieved from the Internet <URL:http://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=2815549&tool=pmcentrez&rendertype=abstract> DOI: 10.1186/bcr2454 * |
| SAMBROOKFRITSCHMANIATIS: "Molecular Cloning, A Laboratory Manual; Sambrook and Russell Molecular Cloning", 1982 |
| SCALTRITI ET AL.: "Cyclin E amplification/overexpression is a mechanism of trastuzumab resistance in HER2+ breast cancer patients", PROC NATL ACAD SCI., vol. 108, 2011, pages 3761 - 6 |
| SCHER ET AL.: "Trial Design and Objectives for Castration-Resistant Prostate Cancer: Updated Recommendations From the Prostate Cancer Clinical Trials Working Group 3", J CLIN ONCOL, vol. 34, no. 12, 2016, pages 1402 - 18 |
| SCHIER ET AL.: "Identification of functional and structural amino-acid residues by parsimonious mutagenesis", GENE, vol. 169, 1995, pages 147 - 155, XP004042894, DOI: 10.1016/0378-1119(95)00821-7 |
| SCHOOFS ET AL.: "Epitopes of an influenza viral peptide recognized by antibody at single amino acid resolution", J. IMMUNOL, vol. 140, 1988, pages 611 - 616, XP000915650 |
| SHAPIRO, PRACTICAL FLOW CYTOMETRY, 2003 |
| SHARPE ET AL.: "The B7-CD28 superfamily", NAT REV, 2002 |
| SHERIFF ET AL.: "Similarity between C2 domain jaws and immunoglobulin CDRs", NATURE STRUCT. BIOL, vol. 3, 1996, pages 733 - 736 |
| SHIELDS ET AL.: "High Resolution Mapping of the Binding Site on Human IgG1 for FcyRI, FcyRII, FcyRIII, and FcRn and Design of IgG1 Variants with Improved Binding to the FcyR", J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604 |
| SMALLEY ET AL.: "Identification of a novel subgroup of melanomas with KIT/cyclin dependent kinase4 overexpression", CANCER RES, vol. 68, 2008, pages 574352 |
| SMITH, G. P.: "Surface presentation of protein epitopes using bacteriophage expression systems", CURR. OPIN. BIOTECHNOL., vol. 2, 1991, pages 668, XP023601387, DOI: 10.1016/0958-1669(91)90032-Z |
| SUNSHINE ET AL.: "Pd-1/Pd-L1 Inhibitors", CURR. OPIN. IN PHARMACOL., vol. 23, 2015, XP055304528, DOI: 10.1016/j.coph.2015.05.011 |
| TANG ET AL.: "Use of a peptide mimotope to guide the humanization of MRK-16, an anti-P-glycoprotein monoclonal antibody", J. BIOL. CHEM., vol. 274, 1999, pages 27371 - 27378 |
| THOMPSON R H: "Tumor B7-H1 is associated with poor prognosis in renal cell carcinoma patients with long-term follow-up", CANCER RES, vol. 66, no. 7, 2006, pages 3381, XP008091321, DOI: 10.1158/0008-5472.CAN-05-4303 |
| TOKOYAMA ET AL.: "How do natural killer cells find self to achieve tolerance?", IMMUNITY, vol. 24, 1994, pages 249 - 257 |
| TOPALIAN ET AL.: "Safety, activity, and immune correlates of anti-PD-1 antibody in cancer", NEW ENGL. J. MED., vol. 366, 2012, pages 2443, XP055098235, DOI: 10.1056/NEJMoa1200690 |
| VAUGHAN ET AL.: "Human antibodies with sub-nanomolar affinities isolated from a large non-immunized phage display library", NATURE BIOTECHNOL., vol. 14, 1996, pages 309 - 314, XP000196144, DOI: 10.1038/nbt0396-309 |
| VON HEIJNE: "A new method for predicting signal sequence cleavage sites", NUCLEIC ACIDS RES., vol. 14, 1986, pages 4683 - 4690 |
| VON HEIJNE: "Patterns of amino acids near signal-sequence cleavage sites", EUR. J. BIOCHEM., vol. 133, 1983, pages 17 - 21, XP008043344, DOI: 10.1111/j.1432-1033.1983.tb07424.x |
| W. A. WEBER, J. NUCL. MED., vol. 50, no. 200, pages 1 S - 1 OS |
| WEINBERG, A. ET AL.: "Assessment of activity of an adhesion molecule CD134 and CD137 in colorectal cancer patients", J. IMMUNOL., vol. 164, 2000, pages 2160 - 69 |
| WHO, DRUG INFORMATION, vol. 27, no. 2, 2013, pages 172 |
| WREN: "SIGNAL-sequence information and GeNomic", ANALYSISCOMPUT. METHODS PROGRAMS BIOMED., vol. 68, 2002, pages 177 - 181 |
| WRIGHT ET AL.: "Inhibition of chicken adipocyte differentiation by in vitro exposure to monoclonal antibodies against embryonic chicken adipocyte plasma membranes", IMMUNITY, vol. 13, 2000, pages 233 - 242 |
| WU, RECOMBINANT DNA, vol. 217 |
| XU ET AL.: "Disruption of Early Tumor Necrosis Factor Alpha Signaling Prevents Classical Activation of Dendritic Cells in Lung-Associated Lymph Nodes and Development of Protective Immunity against Cryptococcal Infection", IMMUNITY, vol. 3, 2000, pages 37 - 45 |
| YELTON ET AL.: "Affinity maturation of the BR96 anti-carcinoma antibody by codon-based mutagenesis", J. IMMUNOL., vol. 155, 1995, pages 1994 - 2004, XP002096491 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022263632A1 (en) * | 2021-06-18 | 2022-12-22 | Alligator Bioscience Ab | Novel combination therapies and uses thereof |
| WO2023281413A1 (en) * | 2021-07-09 | 2023-01-12 | Pfizer Inc. | Methods and dosing regimens comprising pf-06873600 for the treatment of cancer |
| WO2026024674A1 (en) | 2024-07-22 | 2026-01-29 | Genesis Therapeutics, Inc. | Methods of treating skp2-associated cancers |
Also Published As
| Publication number | Publication date |
|---|---|
| CN113874036A (zh) | 2021-12-31 |
| CA3141531A1 (en) | 2020-12-03 |
| AU2020281535A1 (en) | 2022-01-27 |
| IL288306A (en) | 2022-01-01 |
| JP2022534889A (ja) | 2022-08-04 |
| EP3976090A1 (en) | 2022-04-06 |
| US20220241412A1 (en) | 2022-08-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12534530B2 (en) | Combination of a PD-1 antagonist and a VEGFR inhibitor for treating cancer | |
| AU2014309199B2 (en) | Treating cancer with a combination of a PD-1 antagonist and dinaciclib | |
| US20210069326A1 (en) | Pd-l1 antagonist combination treatments | |
| US20220241412A1 (en) | Combination therapies using cdk inhibitors | |
| US20220235141A1 (en) | Combination therapies using cdk inhibitors | |
| HK40010365B (en) | Combination of a pd-1 antagonist and a vegfr inhibitor for treating cancer | |
| HK40010365A (en) | Combination of a pd-1 antagonist and a vegfr inhibitor for treating cancer | |
| NZ737018B2 (en) | Pd-l1 antagonist combination treatments |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20729001 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2021569567 Country of ref document: JP Kind code of ref document: A Ref document number: 3141531 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020729001 Country of ref document: EP Effective date: 20220103 |
|
| ENP | Entry into the national phase |
Ref document number: 2020281535 Country of ref document: AU Date of ref document: 20200520 Kind code of ref document: A |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2020729001 Country of ref document: EP |