WO2020185917A1 - Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers - Google Patents

Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers Download PDF

Info

Publication number
WO2020185917A1
WO2020185917A1 PCT/US2020/022130 US2020022130W WO2020185917A1 WO 2020185917 A1 WO2020185917 A1 WO 2020185917A1 US 2020022130 W US2020022130 W US 2020022130W WO 2020185917 A1 WO2020185917 A1 WO 2020185917A1
Authority
WO
WIPO (PCT)
Prior art keywords
cell
cells
fluorescein
car
cancer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/022130
Other languages
English (en)
French (fr)
Inventor
Michael C. JENSON
James MATTHAEI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Seattle Childrens Hospital
Original Assignee
Seattle Childrens Hospital
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Seattle Childrens Hospital filed Critical Seattle Childrens Hospital
Priority to EP20770256.4A priority Critical patent/EP3937975A4/en
Priority to US17/438,231 priority patent/US20220125841A1/en
Priority to JP2021555170A priority patent/JP2022525400A/ja
Priority to AU2020237097A priority patent/AU2020237097A1/en
Priority to CA3140210A priority patent/CA3140210A1/en
Publication of WO2020185917A1 publication Critical patent/WO2020185917A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/4285Lipids; Lipoproteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/23On/off switch
    • A61K2239/24Dimerizable CARs; CARs with adapter
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/49Breast
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • Some embodiments of the methods and compositions provided herein relate to modulating the signaling of anti-hapten CAR T cells, such as anti-fluorescein CAR T cells, by the use of or administration of an unconjugated hapten, such as unconjugated fluorescein or a derivative thereof, such as a salt thereof.
  • chimeric antigen receptors are synthetic receptors that include an extracellular ligand binding domain, most commonly a single chain variable fragment of a monoclonal antibody (scFv) linked to intracellular signaling components, most commonly CD3z alone or combined with one or more costimulatory domains.
  • scFv monoclonal antibody
  • Much of the research in the design of chimeric antigen receptors has focused on defining scFvs and other ligand binding elements that target malignant cells without causing serious toxicity to essential normal tissues, and on defining the optimal composition of intracellular signaling modules to activate T cell effector functions.
  • CAR T cell-mediated therapy that is selective for specific targets and which minimizes adverse side effects.
  • Some embodiments of the methods and compositions provided herein include a method of treating, ameliorating, inhibiting, or providing a therapy to a subject having a cancer, comprising, consisting essentially of, or consisting of: (a) administering to the subject a composition comprising, consisting essentially of, or consisting of a lipid conjugated to a target moiety; (b) administering a cell to the subject, wherein the cell comprises, consist essentially of, or consists of a chimeric antigen receptor (CAR) or T cell receptor (TCR), which specifically binds to the target moiety; and (c) administering the target moiety unconjugated to the lipid to the subject.
  • CAR chimeric antigen receptor
  • TCR T cell receptor
  • step (c) is performed subsequent to step (b).
  • administration of the unconjugated target moiety reduces effector function of the CAR T cell, compared to effector function of the CAR T cell in the absence of the unconjugated target moiety. In some embodiments, administration of the unconjugated target moiety reduces cytokine production from the CAR T cell compared to cytokine production from the CAR T cell in the absence of the unconjugated target moiety.
  • the target moiety comprises, consists essentially of, or consists of biotin, digoxigenin, dinitrophenol, fluorescein, or a derivative or salt thereof.
  • the salt is a sodium, disodium, potassium, or dipotassium salt of biotin, digoxigenin, dinitrophenol, or fluorescein.
  • the salt is a calcium, magnesium, monophosphate, diphosphate, hydrochloride, sulfate, acetate, chloride, maleate, citrate, mesylate, nitrate, tartrate, aluminum, or gluconate salt.
  • the target moiety comprises, consists essentially of, or consists of fluorescein, or a derivative or salt thereof, such as sodium fluorescein.
  • the target moiety is unconjugated. In some embodiments, the target moiety is conjugated. In some embodiments, the target moiety is conjugated to a nucleic acid, DNA, RNA, nucleotide, sugar, carbohydrate, peptide, polypeptide, protein, antibody, hormone, lipid, ether lipid, phospholipid, or cholesterol. In some embodiments, the target moiety is conjugated to a phospholipid ether.
  • the lipid comprises, consists essentially of, or consists of a phospholipid ether (PLE).
  • PLE phospholipid ether
  • the cell is a precursor T cell. In some embodiments, the cell is a hematopoietic stem cell. In some embodiments, the cell is a CD8+ T cytotoxic lymphocyte cell selected from the group consisting of naive CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells. In some embodiments, the cell is a CD4+ T helper lymphocyte cell that is selected from the group consisting of naive CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
  • the cancer is a solid tumor, such as a colon cancer, breast cancer, ovarian cancer, lung cancer, pancreatic cancer, prostate cancer, melanoma, renal cancer, pancreatic cancer, brain cancer, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, bone cancer, or liver cancer, or a non-solid tumor, such as a leukemia, or a multiple myeloma.
  • a solid tumor such as a colon cancer, breast cancer, ovarian cancer, lung cancer, pancreatic cancer, prostate cancer, melanoma, renal cancer, pancreatic cancer, brain cancer, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, bone cancer, or liver cancer, or a non-solid tumor, such as a leukemia, or a multiple myeloma.
  • the subject is an animal. In some embodiments, the subject is a mammal. In some embodiments, the subject is a human, dog, cat, mouse, rat, cow, pig, horse, or chicken.
  • a method of treating, ameliorating, inhibiting, or providing a therapy to a subject having a cancer comprising:
  • composition comprising a lipid conjugated to a target moiety, such as biotin, digoxigenin, dinitrophenol or fluorescein;
  • step (c) administering the target moiety unconjugated to the lipid to the subject, such as a salt of biotin, digoxigenin, dinitrophenol or fluorescein, e.g., sodium, disodium, or a potassium salt of biotin, digoxigenin, dinitrophenol or fluorescein.
  • a salt of biotin, digoxigenin, dinitrophenol or fluorescein e.g., sodium, disodium, or a potassium salt of biotin, digoxigenin, dinitrophenol or fluorescein.
  • T cytotoxic lymphocyte cell selected from the group consisting of naive CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells.
  • T helper lymphocyte cell that is selected from the group consisting of naive CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
  • cancer is a solid tumor, such as a colon cancer, breast cancer, ovarian cancer, lung cancer, pancreatic cancer, prostate cancer, melanoma, renal cancer, pancreatic cancer, brain cancer, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, bone cancer, or liver cancer, or a non-solid tumor, such as a leukemia, or a multiple myeloma.
  • a solid tumor such as a colon cancer, breast cancer, ovarian cancer, lung cancer, pancreatic cancer, prostate cancer, melanoma, renal cancer, pancreatic cancer, brain cancer, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, bone cancer, or liver cancer, or a non-solid tumor, such as a leukemia, or a multiple myeloma.
  • a non-solid tumor such as a leukemia, or a multiple myeloma.
  • the target moiety unconjugated to the lipid is a salt of biotin, digoxigenin, dinitrophenol or fluorescein, e.g., sodium, disodium, or a potassium salt of biotin, digoxigenin, dinitrophenol or fluorescein.
  • FIG. 1 A depicts a flow cytometry analysis for FL-PLE integration into cells.
  • FIG. IB depicts a chromium release assay for effector T cells (CD8+ Mock or CD8+ antiFL(FITC-E2) CAR(Lg) T cells) mixed at various ratios with target cells (effectontarget, E:T).
  • the target cells are K562 control, K562 OKT3+, and K562 with 5 mM FL-PLE.
  • One CD8+ antiFL(FITC-E2) population was exposed to 50 pM NaFL.
  • FIG. 1C depicts a cytokine release assay for helper cells (CD4+ Mock or CD4+ antiFL(FITC-E2) CAR(Lg) T cells) and effector T cells (CD8+ Mock or CD8+ antiFL(FITC-E2) CAR(Lg) T cells) mixed with target cells.
  • the target cells are K562 control, K562 OKT3+, and K562 with 5 pM FL-PLE.
  • One CD4+ and CD8+ antiFL(FITC-E2) population was exposed to 50 pM NaFL.
  • FIG. 2A depicts tumor progression in an MDA-MB-231 adenocarcinoma tumor xenograft mouse model as measured by total flux (photons/sec) over time.
  • the tumor is bioluminescent with the addition of eGFP and luciferase genes.
  • FIG. 2B depicts levels of cytokine release syndrome (CRS) and cytotoxicity in an MDA-MB-231 adenocarcinoma tumor xenograft mouse model over time.
  • FIG. 2B (lower panel) is an enlargement of an area of FIG. 2B (upper panel).
  • FIG. 2C depicts percent survival in an MDA-MB-231 adenocarcinoma tumor xenograft mouse model.
  • FIG. 3A depicts CD4+ and CD8+ ratios of a T cell population from two donors after lentiviral transduction of the antiFL(Mut2) CAR (or Mock control), selection with methotrexate, and expansion.
  • FIG. 3B depicts successful CAR positivity of a T cell population from two donors after lentiviral transduction of the antiFL(Mut2) CAR (or Mock control), selection with methotrexate, and expansion.
  • FIG. 3C depicts flow cytometry detection of NaFL (0 or 5 mM) in K562 parental (control), K562 OKT3+, and MDA-MB-231 adenocarcinoma target cells.
  • FIG. 3D depicts a cytokine release assay measuring IL-2 using the effector cells generated in FIG. 3A-B, target cells tested in FIG. 3C, and a dose titration of NaFL (0, 1, 5, or 10 mM).
  • the effect of NaFL on reducing cytokine activity of antiFL(Mut2) CAR T cells is dose dependent.
  • FIG. 3E depicts a cytokine release assay measuring IFN-g using the effector cells generated in FIG. 3A-B, target cells tested in FIG. 3C, and a dose titration of NaFL (0, 1, 5, or 10 pM).
  • the effect of NaFL on reducing cytokine activity of antiFL(Mut2) CAR T cells is dose dependent.
  • FIG. 3F depicts a cytokine release assay measuring TNF-a using the effector cells generated in FIG. 3A-B, target cells tested in FIG. 3C, and a dose titration of NaFL (0, 1, 5, or 10 pM).
  • the effect of NaFL on reducing cytokine activity of antiFL(Mut2) CAR T cells is dose dependent.
  • the articles“a” and“an” are used herein to refer to one or to more than one (for example, at least one) of the grammatical object of the article.
  • “an element” means one element or more than one element.
  • “about” is meant a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that varies by as much as 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1% to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.
  • the practice of the present disclosure will employ, unless indicated specifically to the contrary, conventional methods of molecular biology and recombinant DNA techniques within the skill of the art.
  • the terms“peptide”,“polypeptide”, and“protein” as used herein refers to macromolecules comprised of amino acids linked by peptide bonds.
  • the numerous functions of peptides, polypeptides, and proteins are known in the art, and include but are not limited to enzymes, structure, transport, defense, hormones, or signaling. Peptides, polypeptides, and proteins are often, but not always, produced biologically by a ribosomal complex using a nucleic acid template, although chemical syntheses are also available.
  • nucleic acid template By manipulating the nucleic acid template, peptide, polypeptide, and protein mutations such as substitutions, deletions, truncations, additions, duplications, or fusions of more than one peptide, polypeptide, or protein can be performed. These fusions of more than one peptide, polypeptide, or protein can be joined in the same molecule adjacently, or with extra amino acids in between, e.g. linkers, repeats, epitopes, or tags, or any other sequence that is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95,
  • amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
  • a polypeptide or amino acid sequence“derived from” a designated protein refers to the origin of the polypeptide.
  • the polypeptide has an amino acid sequence that is essentially identical to that of a polypeptide encoded in the sequence, or a portion thereof wherein the portion consists of at least 10-20 amino acids, or at least 20-30 amino acids, or at least 30-50 amino acids, or which is immunologically identifiable with a polypeptide encoded in the sequence.
  • This terminology also includes a polypeptide expressed from a designated nucleic acid sequence.
  • antibody is intended to include any polypeptide chain-containing molecular structure with a specific shape that fits to and recognizes an epitope, where one or more non-covalent binding interactions stabilize the complex between the molecular structure and the epitope.
  • Antibodies utilized in the present invention may be polyclonal antibodies, although monoclonal antibodies are preferred because they may be reproduced by cell culture or recombinantly and can be modified to reduce their antigenicity.
  • immunoglobulin fragments or“binding fragments” comprising the epitope binding site (e.g., Fab', F(ab')2, single-chain variable fragment (scFv), diabody, minibody, nanobody, single domain antibody (sdAb), or other fragments) are useful as antibody moieties in the present invention.
  • Such antibody fragments may be generated from whole immunoglobulins by ricin, pepsin, papain, or other protease cleavage.
  • Minimal immunoglobulins may be designed utilizing recombinant immunoglobulin techniques.
  • Fv immunoglobulins for use in the present invention may be produced by linking a variable light chain region to a variable heavy chain region via a peptide linker (e.g., poly-glycine or another sequence which does not form an alpha helix or beta sheet motif).
  • a peptide linker e.g., poly-glycine or another sequence which does not form an alpha helix or beta sheet motif.
  • Nanobodies or single-domain antibodies can also be derived from alternative organisms, such as dromedaries, camels, llamas, alpacas, or sharks.
  • antibodies can be conjugates, e.g. pegylated antibodies, drug, radioisotope, or toxin conjugates.
  • Monoclonal antibodies directed against a specific epitope, or combination of epitopes will allow for the targeting and/or depletion of cellular populations expressing the marker.
  • Various techniques can be utilized using monoclonal antibodies to screen for cellular populations expressing the marker(s), and include magnetic separation using antibody-coated magnetic beads, "panning" with antibody attached to a solid matrix (i.e., plate), and flow cytometry
  • humanized antibodies are hybrid immunoglobulins, immunoglobulin chains or fragments thereof which contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, rabbit or primate having the desired specificity, affinity and capacity.
  • donor antibody such as mouse, rat, rabbit or primate having the desired specificity, affinity and capacity.
  • Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • the humanized antibody may comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications are made to further refine and optimize antibody performance and minimize immunogenicity when introduced into a human body.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
  • the humanized antibody may also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • Humanized antibodies can be engineered to contain human-like immunoglobulin domains, and incorporate only the complementarity-determining regions of the animal-derived antibody. This can be accomplished by carefully examining the sequence of the hyper-variable loops of the variable regions of a monoclonal antigen binding unit or monoclonal antibody, and fitting them to the structure of a human antigen binding unit or human antibody chains.
  • variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
  • variable regions of the heavy and light chains each consist of four framework regions (FRs) connected by three complementarity determining regions (CDRs) also known as hypervariable regions, and contribute to the formation of the antigen binding site of antibodies.
  • FRs framework regions
  • CDRs complementarity determining regions
  • variants of a subject variable region are desired, particularly with substitution in amino acid residues outside of a CDR region (i.e., in the framework region), appropriate amino acid substitution, preferably, conservative amino acid substitution, can be identified by comparing the subject variable region to the variable regions of other antibodies which contain CDR1 and CDR2 sequences in the same canonical class as the subject variable region (Chothia and Lesk, J Mol Biol 196(4): 901-917, 1987).
  • definitive delineation of a CDR and identification of residues comprising the binding site of an antibody is accomplished by solving the structure of the antibody and/or solving the structure of the antibody-ligand complex. In some embodiments, that can be accomplished by any of a variety of techniques known to those skilled in the art, such as X-ray crystallography. In some embodiments, various methods of analysis can be employed to identify or approximate the CDR regions. In some embodiments, various methods of analysis can be employed to identify or approximate the CDR regions. Examples of such methods include, but are not limited to, the Rabat definition, the Chothia definition, the IMGT approach (Lefranc et ak, 2003) Dev Comp Immunol. 27:55-77), computational programs such as Paratome (Kunik et al., 2012, Nucl Acids Res. W521-4), the AbM definition, and the conformational definition.
  • the Rabat definition is a standard for numbering the residues in an antibody and is typically used to identify CDR regions. See, e.g., Johnson & Wu, 2000, Nucleic Acids Res., 28: 214-8.
  • the Chothia definition is similar to the Rabat definition, but the Chothia definition takes into account positions of certain structural loop regions. See, e.g., Chothia et al., 1986, J. Mol. Biol., 196: 901-17; Chothia et al., 1989, Nature, 342: 877-83.
  • the AbM definition uses an integrated suite of computer programs produced by Oxford Molecular Group that model antibody structure.
  • the AbM definition models the tertiary structure of an antibody from primary sequence using a combination of knowledge databases and ab initio methods, such as those described by Samudrala et al., 1999, "Ab Initio Protein Structure Prediction Using a Combined Hierarchical Approach,” in PROTEINS, Structure, Function and Genetics Suppk, 3 : 194-198.
  • the contact definition is based on an analysis of the available complex crystal structures.
  • CDRs In another approach, referred to herein as the "conformational definition" of CDRs, the positions of the CDRs may be identified as the residues that make enthalpic contributions to antigen binding. See, e.g., Makabe et al., 2008, Journal of Biological Chemistry, 283 : 1156- 1166. Still other CDR boundary definitions may not strictly follow one of the above approaches but will nonetheless overlap with at least a portion of the Rabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues do not significantly impact antigen binding.
  • a CDR may refer to CDRs defined by any approach known in the art, including combinations of approaches. The methods used herein may utilize CDRs defined according to any of these approaches. In some embodiments containing more than one CDR, the CDRs may be defined in accordance with any of Rabat, Chothia, extended, IMGT, Paratome, AbM, and/or conformational definitions, or a combination of any of the foregoing. In some embodiments, the residue number of a variable region is numbered using the IMGT numbering system. [0064] As known in the art, a "constant region" of an antibody refers to the constant region of the antibody light chain or the constant region of the antibody heavy chain, either alone or in combination.
  • the term "compete,” as used herein with regard to an antibody, means that a first antibody, or an antigen-binding portion thereof, binds to an epitope in a manner sufficiently similar to the binding of a second antibody, or an antigen-binding portion thereof, such that the result of binding of the first antibody with its cognate epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody.
  • the alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody can, but need not be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope.
  • each antibody detectably inhibits the binding of the other antibody with its cognate epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to "cross-compete" with each other for binding of their respective epitope(s).
  • Both competing and cross-competing antibodies are encompassed by the present invention. Regardless of the mechanism by which such competition or cross-competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof), the skilled artisan would appreciate, based upon the teachings provided herein, that such competing and/or cross-competing antibodies are encompassed and can be useful for the methods disclosed herein.
  • An antibody that "preferentially binds" or “specifically binds” (used interchangeably herein) to an epitope is a term well understood in the art, and methods to determine such specific or preferential binding are also well known in the art.
  • a molecule is said to exhibit “specific binding” or “preferential binding” if it reacts or associates more frequently, and/or more rapidly, and/or with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances.
  • An antibody “specifically binds” or “preferentially binds” to a target if it binds with greater affinity, and/or avidity, and/or more readily, and/or with greater duration than it binds to other substances.
  • an antibody that specifically or preferentially binds to a CFD epitope is an antibody that binds this epitope with greater affinity, and/or avidity, and/or more readily, and/or with greater duration than it binds to other CFD epitopes or non-CFD epitopes. It is also understood by reading this definition that, for example, an antibody (or moiety or epitope) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding. Generally, but not necessarily, reference to binding means preferential binding.
  • substantially pure refers to material which is at least 50% pure (i.e., free from contaminants), more preferably, at least 90% pure, more preferably, at least 95% pure, yet more preferably, at least 98% pure, and most preferably, at least 99% pure.
  • a "host cell” includes an individual cell or cell culture that can be or has been a recipient for vector(s) for incorporation of polynucleotide inserts.
  • Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation.
  • a host cell includes cells transfected in vivo with a polynucleotide(s) of this invention.
  • the term "Fc region” is used to define a C-terminal region of an immunoglobulin heavy chain.
  • the "Fc region” may be a native sequence Fc region or a variant Fc region.
  • the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
  • the numbering of the residues in the Fc region is that of the EU index as in Kabat. Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.
  • the Fc region of an immunoglobulin generally comprises two constant domains, CH2 and CH3. As is known in the art, an Fc region can be present in dimer or monomeric form.
  • vector means a construct, which is capable of delivering, and, preferably, expressing, one or more gene(s) or sequence(s) of interest in a host cell.
  • vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
  • Proper formulation is dependent upon the route of administration chosen. Techniques for formulation and administration of the compounds described herein are known to those skilled in the art.
  • compositions will generally be tailored to the specific intended route of administration.
  • co-administer it is meant that a first compound described herein is administered at the same time, julst prior to, or just after the administration of a second compound described herein.
  • the term "therapeutic target” refers to a gene or gene product that, upon modulation of its activity (e.g., by modulation of expression, biological activity, and the like), can provide for modulation of the disease phenotype (e.g., fibrosis or cancer).
  • modulation is meant to refer to an increase or a decrease in the indicated phenomenon (e.g., modulation of a biological activity refers to an increase in a biological activity or a decrease in a biological activity).
  • cancer neoplasm
  • tumor tumor
  • tumor tumor
  • tumor tumor-associated phenotype
  • cancer tumor-associated phenotype
  • cancer tumor-associated phenotype
  • tumor tumor-associated phenotype
  • tumor tumor-associated phenotype
  • tumor tumor-associated phenotype
  • tumor tumor-associated phenotype
  • tumor tumor-associated phenotype
  • tumor tumor-associated phenotype
  • tumor tumor-associated phenotype
  • cancerous cells e.g., tumor cells
  • non-metastatic e.g., tumor cells, and non-metastatic cells. Detection of cancerous cells is of particular interest.
  • normal as used in the context of "normal cell,” is meant to refer to a cell of an untransformed phenotype or exhibiting a morphology of a non-transformed cell of the tissue type being examined.
  • Cancerous phenotype generally refers to any of a variety of biological phenomena that are characteristic of a cancerous cell, which phenomena can vary with the type of cancer.
  • the cancerous phenotype is generally identified by abnormalities in, for example, cell growth or proliferation (e.g., uncontrolled growth or proliferation), regulation of the cell cycle, cell mobility, cell-cell interaction, or metastasis, etc.
  • the term“immune cells” refers to cells of hematopoietic origin that are involved in the specific recognition of antigens.
  • Immune cells include antigen presenting cells (APCs), such as dendritic cells or macrophages, B cells, T cells, natural killer cells, and myeloid cells, such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes.
  • APCs antigen presenting cells
  • B cells such as dendritic cells or macrophages
  • T cells such as T cells
  • natural killer cells such as myeloid cells
  • myeloid cells such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes.
  • immune response refers to T cell-mediated, NK cell-mediated, macrophage-mediated, and/or B cell-mediated immune responses.
  • Exemplary immune responses include B cell responses (e.g., antibody production), NK cell responses or T cell responses (e.g., cytokine production, and cellular cytotoxicity) and activation of cytokine responsive cells, e.g., macrophages.
  • activating immune response refers to enhancing the level of T-cell-mediated and/or B cell-mediated immune response, using methods known to one of skilled in the art.
  • the level of enhancement is at least 20-50%, alternatively at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 120%, at least 150%, or at least 200%.
  • pharmaceutically acceptable carrier or “pharmaceutical acceptable excipient” includes any material which, when combined with an active ingredient, allows the ingredient to retain biological activity and is non-reactive with the subject's immune system.
  • examples include, but are not limited to, any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, various types of wetting agents, detergents such as polysorbate 20 to prevent aggregation, and sugars such as sucrose as cryoprotectant.
  • Preferred diluents for aerosol or parenteral administration are phosphate buffered saline (PBS) or normal (0.9%) saline.
  • a“carrier” refers to a compound, particle, solid, semi-solid, liquid, or diluent that facilitates the passage, delivery and/or incorporation of a compound to cells, tissues and/or bodily organs.
  • a lipid nanoparticle is a type of carrier that can encapsulate an oligonucleotide to thereby protect the oligonucleotide from degradation during passage through the bloodstream and/or to facilitate delivery to a desired organ, such as to the liver.
  • a“diluent” refers to an ingredient in a pharmaceutical composition that lacks pharmacological activity but may be pharmaceutically necessary or desirable.
  • a diluent may be used to increase the bulk of a potent drug whose mass is too small for manufacture and/or administration. It may also be a liquid for the dissolution of a drug to be administered by injection, ingestion or inhalation.
  • a common form of diluent in the art is a buffered aqueous solution such as, without limitation, phosphate buffered saline that mimics the composition of human blood.
  • excipient has its ordinary meaning as understood in light of the specification, and refers to inert substances, compounds, or materials added to a pharmaceutical composition to provide, without limitation, bulk, consistency, stability, binding ability, lubrication, disintegrating ability etc., to the composition.
  • Excipients with desirable properties include but are not limited to preservatives, adjuvants, stabilizers, solvents, buffers, diluents, solubilizing agents, detergents, surfactants, chelating agents, antioxidants, alcohols, ketones, aldehydes, ethylenediaminetetraacetic acid (EDTA), citric acid, salts, sodium chloride, sodium bicarbonate, sodium phosphate, sodium borate, sodium citrate, potassium chloride, potassium phosphate, magnesium sulfate sugars, dextrose, fructose, mannose, lactose, galactose, sucrose, sorbitol, cellulose, serum, amino acids, polysorbate 20, polysorbate 80, sodium deoxycholate, sodium taurodeoxycholate, magnesium stearate, octylphenol ethoxylate, benzethonium chloride, thimerosal, gelatin, esters, ethers, 2-phenoxyethanol, urea, or vitamins
  • the amount of the excipient may be found in a pharmaceutical composition at a percentage of 0%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 100% w/w or any percentage by weight in a range defined by any two of the aforementioned numbers.
  • adjuvant refers to a substance, compound, or material that stimulates the immune response and increase the efficacy of protective immunity and is administered in conjunction with an immunogenic antigen, epitope, or composition.
  • Adjuvants serve to improve immune responses by enabling a continual release of antigen, up- regulation of cytokines and chemokines, cellular recruitment at the site of administration, increased antigen uptake and presentation in antigen presenting cells, or activation of antigen presenting cells and inflammasomes.
  • adjuvants include but are not limited to alum, aluminum salts, aluminum sulfate, aluminum hydroxide, aluminum phosphate, calcium phosphate hydroxide, potassium aluminum sulfate, oils, mineral oil, paraffin oil, oil-in-water emulsions, detergents, MF59®, squalene, AS03, a-tocopherol, polysorbate 80, AS04, monophosphoryl lipid A, virosomes, nucleic acids, polyinosinic:polycytidylic acid, saponins, QS-21, proteins, flagellin, cytokines, chemokines, IL-1, IL-2, IL-12, IL-15, IL-21, imidazoquinolines, CpG oligonucleotides, lipids, phospholipids, dioleoyl phosphatidylcholine (DOPC), trehalose dimycolate, peptidoglycans, bacterial extracts, lip
  • purity of any given substance, compound, or material as used herein refers to the actual abundance of the substance, compound, or material relative to the expected abundance.
  • the substance, compound, or material may be at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% pure, including all decimals in between.
  • Purity may be affected by unwanted impurities, including but not limited to side products, isomers, enantiomers, degradation products, solvent, carrier, vehicle, or contaminants, or any combination thereof.
  • Purity can be measured technologies including but not limited to chromatography, liquid chromatography, gas chromatography, spectroscopy, UV-visible spectrometry, infrared spectrometry, mass spectrometry, nuclear magnetic resonance, gravimetry, or titration, or any combination thereof.
  • Some embodiments of the methods and compositions provided herein relate to modulating signaling of anti-hapten CAR T cells, such as anti-fluorescein CAR T cells, by the use or administration of an unconjugated hapten, such as fluorescein or a derivative or salt thereof, for instance sodium fluorescein.
  • an unconjugated hapten such as fluorescein or a derivative or salt thereof, for instance sodium fluorescein.
  • anti-fluorescein CAR T cells can work in conjugation with bispecific compounds such as fluorescein conjugated with a phospholipid ether (FL-PLE) or precursor FL-PLE (ProFL-PLE) in cancer therapies.
  • FL-PLE and ProFL-PLE include a tumor targeting moiety (PLE) and a CAR recognition/target moiety (FL) that are linked together via a spacer element.
  • the Pro moiety can provide an added level of safety that prevents recognition of the ProFL-PLE by the antiFL CAR T cell until it is processed in a tumor microenvironment to provide FL-PLE.
  • the FL-PLE has the structure
  • the ProFL-PLE has the structure
  • Some embodiments provided herein include aspects, which can prolong antiFL CAR T persistence by the use of or administration of unconjugated fluorescein, such as sodium fluorescein (NaFL) or disodium fluorescein or a salt of fluorescein.
  • unconjugated fluorescein such as sodium fluorescein (NaFL) or disodium fluorescein or a salt of fluorescein.
  • cytotoxic events can be inhibited during CAR T cell therapy, by administration of or use of unconjugated fluorescein, such as NaFL, disodium fluorescein, or a salt of fluorescein.
  • unconjugated fluorescein may interact and bind with antiFL CAR T cells, whereupon the binding of the unconjugated fluorescein with the antiFL CAR can substantially reduce signaling of the CAR T cell.
  • the unconjugated fluorescein can be cleared by the patient, and the antiFL CAR T cells can bind and be activated by target FL-PLE, which is embedded in a cell membrane of a cancer cell in a tumor.
  • binding of unconjugated fluorescein increases the persistence of antiFL CAR T cells in a subject.
  • NaFL can be administered at a concentration of 1 pM, 10 pM, 100 pM, 1 nM, 10 nM, 50 nM, 100 nM, 150 nM, 200 nM, 250 nM, 300 nM, 350 nM, 400 nM, 450 nM, 500 nM, 550 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 mM, 5 pM, 10 pM, 20 pM, 30 pM, 40 pM, 50 pM, 60 pM, 70 pM, 80 pM, 90 pM, 100 pM, 200 pM, 300 pM, 400 pM, 500 pM, 600 pM, 700 pM, 800 pM, 900 pM, 1 mM, 10 mM, 50 mM, 100 mM, 200 mM, 300 mM, 400 pM, 500 pM,
  • NaFL can be administered at an amount of 1 ng, 10 ng, 100 ng, 1 pg, 10 pg, 100 pg, 200 gg, 300 gg, 400 gg, 500 gg, 600 gg, 700 gg, 800 gg, 900 gg, 1 mg, 10 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg, 1 g, 2 g, 3 g, 4 g, 5 g, 6 g, 7 g, 8 g, 9 g, 10 g, 20 g, 30 g, 40 g, 50 g, 100 g, 1000 g, or any amount within a range defined by any two of the aforementioned amounts.
  • Some embodiments of the methods and compositions provided herein include aspects disclosed in Int. Pat. App. Pub. No. WO 2018/148224, and Int. Pat. App. Pub. No. WO 2019/156795, which are each hereby expressly incorporated by reference in their entireties.
  • Some embodiments of the methods and compositions provided herein include methods of treating or ameliorating or inhibiting a cancer in a subject. Some such embodiments include administering an effective amount to the subject a composition comprising, consisting essentially of, or consisting of a lipid conjugated to a target moiety; and administering a cell, such as a population of the cells, to the subject, wherein the cell comprises, consists essentially of, or consists of a chimeric antigen receptor (CAR) or T cell receptor (TCR), which specifically binds to the target moiety. Some embodiments include administering an unconjugated target moiety to the subject.
  • CAR chimeric antigen receptor
  • TCR T cell receptor
  • administering an unconjugated target moiety to the subject can modulate the activity of the CAR T cells.
  • the target moiety can bind to the CAR T cell without invoking substantial signaling in the CAR T cell.
  • the presence of unconjugated target moiety can reduce effector function of the CAR T cell, compared to effector function in the absence of the unconjugated target moiety.
  • the presence of unconjugated target moiety can reduce undesirable side effects of the CAR T cell, such as cytokine release syndrome in a subject, compared to side effects in the absence of the unconjugated target moiety.
  • % w/w or“% wt/wt” as used herein refers to a percentage expressed in terms of the weight of the ingredient or agent over the total weight of the composition multiplied by 100.
  • % v/v or“% vol/vol” as used herein refers to a percentage expressed in terms of the liquid volume of the compound, substance, ingredient, or agent over the total liquid volume of the composition multiplied by 100.
  • Chimeric receptor refers to a synthetically designed receptor comprising a ligand binding domain of an antibody or other protein sequence that binds to a molecule associated with the disease or disorder and is linked via a spacer domain to one or more intracellular signaling domains of a T cell or other receptors, such as a costimulatory domain.
  • Chimeric receptor can also be referred to as artificial T cell receptors, chimeric T cell receptors, chimeric immunoreceptors, and chimeric antigen receptors (CARs).
  • CARs are genetically engineered T- cell receptors designed to redirect T-cells to target cells that express specific cell-surface antigens.
  • T-cells can be removed from a subject and modified so that they can express receptors that can be specific for an antigen by a process called adoptive cell transfer. The T-cells are reintroduced into the patient where they can then recognize and target an antigen.
  • These CARs are engineered receptors that can graft a selected specificity onto an immune receptor cell.
  • chimeric antigen receptors or“CARs” are also considered by some investigators to include the antibody or antibody fragment, such as a binding fragment of an antibody or scFv, the spacer, signaling domain, and transmembrane region. Due to the surprising effects of modifying the different components or domains of the CAR described herein, such as the epitope binding region (for example, antibody fragment, scFv, or portion thereof), spacer, transmembrane domain, and/ or signaling domain), the components of the CAR are frequently distinguished throughout this disclosure in terms of independent elements.
  • CAR T cell targeting agent is given its plain and ordinary meaning in view of the specification and can be described, for example as a composition that that can integrate into the membrane of a target cell.
  • the CTCT comprises, consists essentially of, or consists of a lipid, wherein the lipid comprises a target moiety and a masking moiety.
  • the masking moiety may be unmasked in the presence of low pH, ROS species and within a tumor microenvironment, for example.
  • the masking moiety may be unmasked by an enzyme or other protein.
  • the masking moiety inhibits specific binding of a CAR to the target moiety.
  • the target moiety may be recognized and bound by a chimeric antigen receptor that is specific for the target moiety.
  • the masking moiety is removed at a pH of 4, 5, 6, or 6.5 or any pH in between a range defined by any two aforementioned values.
  • A“T cell receptor” or“TCR” is a molecule that is found on the surface of T lymphocytes or T cells that is responsible for the recognition of fragments of antigen bound to a major histocompatibility complex molecule.
  • Target moiety refers to a specific group or site on a molecule or chemical that is a binding target for another chemical or protein of interest.
  • a complex is provided, wherein the complex comprises, consists essentially of, or consists of a chimeric antigen receptor (CAR) or a T cell receptor (TCR) joined to a lipid, wherein the lipid comprises a target moiety and the CAR is joined to said lipid through an interaction with said target moiety.
  • CAR chimeric antigen receptor
  • TCR T cell receptor
  • the target moiety is biotin, digoxigenin, dinitrophenol or fluorescein and the unconjugated haptens administered in the methods described herein can be salts of biotin, digoxigenin, dinitrophenol or fluorescein, such as sodium, disodium, or potassium salts of biotin, digoxigenin, dinitrophenol or fluorescein.
  • A“single-chain variable fragment,” (scFv) is a fusion protein that can have variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a short linker peptide of ten to 25 amino acids.
  • the short linker peptide can comprise 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids.
  • the linker is usually rich in glycine for flexibility, as well as, serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of the linker.
  • the scFv can be specific for an antigen.
  • Antigen or“ Ag” as used herein, refers to a molecule that provokes an immune response. This immune response can involve either antibody production, or the activation of specific immunologically-competent cells, or both.
  • An antigen can be generated, synthesized, produced recombinantly or can be derived from a biological sample.
  • a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid such, for example, blood, plasma or ascites fluid.
  • a composition is provided, wherein the composition comprises, consists essentially of, or consists of cells manufactured by any one of the alternative methods herein.
  • the cells comprise, consist essentially of, or consist of a chimeric antigen receptor, wherein the chimeric antigen receptor comprises, consists essentially of, or consists of a scFv that is specific for an antigen.
  • Some embodiments provided herein relate to a ScFv described herein as antiFL(FITC-E2 TyrH133Ala) (also referred to as antiFL(TrylOOgAla), antiFL(FITC-E2 Mut2), or as antiFL(Mut2)), which can be incorporated into a CAR and used in a method in accordance with this disclosure (SEQ ID NO: 1 ), having an amino acid sequence of: S VLT QP S S V S A APGQK VTI SC S GS T SNIGNN Y V S W Y Q QHPGK APKLMIYD V SKRP S G VPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLFGTGTKLTVLGGGGG SGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAASGFTFGSFSMSWVRQAPGGGL EWVAGLSARSSLTHYADSVKGRFTISRDNAKNSVYLQMNSLRVEDTAVYYCARRS Y
  • scFv described herein as antiFL(4M5.3) which can be incorporated into a CAR and used in a method in accordance with this disclosure (SEQ ID NO: 2), having an amino acid sequence of: DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLRWYLQKPGQSPKVLIYKVS NRV S GVPDRF S GS GS GTDFTLKINRVE AEDLGV YF C S Q STHVP WTF GGGTKLEIK S S ADD AKKD AAKKDD AKKDD AKKDGGVKLDET GGGL V QPGGAMKL S C VT S GF TF GH YWMNWVRQSPEKGLEWVAQFRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQM NNLRVEDTGIYYCTGAS Y GMEYLGQGTS VT V S .
  • Some embodiments provided herein relate to a ScFv described herein as antiFL(4420), which can be incorporated into a CAR and used in a method in accordance with this disclosure (SEQ ID NO: 3), having an amino acid sequence of: DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSQGNTYLRWYLQKPGQSPKVLIYKVS NRF S GVPDRF S GS GS GTDFTLKI SRVE AEDLGVYF C S Q S THVP WTF GGGTKLEIGGG GS GGGGS GGGGSE VKLDET GGGL V QPGRPMKL S C V AS GF TF SD YWMNW VRQ SPEK GLEWVAQIRNKPYNYET YY SDS VKGRFTISRDDSKS S VYLQMNNLRVEDMGIYY CT GS YYGMD YWGQGTS VT VS S .
  • Some embodiments provided herein relate to a ScFv described herein as antiFL(4D5Flu), which can be incorporated into a CAR and used in a method in accordance with this disclosure (SEQ ID NO: 4), having an amino acid sequence of: DYKDIQMTQSPSSLSASVGDRVTITCRASQSLVHSQGNTYLRWYQQKPGKAPKVLIY K V SNRF S GVP SRF S GS GS GTDF TLTI S SLQPEDF AT Y Y CQQ S THVP WTF GQGTK VELK RAGGGGS GGGGS GGGGS S GGGS GGGGS GGSE V QL VES GGGL V QPGGSLRL SC A ASGFTFSDYWMNWVRQAPGKGLEWVAQIRNKPYNYETYYADSVKGRFTISRDTSK NT VYLQMNSLRAEDT AVYYCTGS YYGMD YWGQGTL VT VS S .
  • Some embodiments provided herein relate to a ScFv described herein as antiFL(FITC-E2), which can be incorporated into a CAR and used in a method in accordance with this disclosure (SEQ ID NO: 5), having an amino acid sequence of: S VLT QP S S V S A APGQK VTI SC S GS T SNIGNN Y V S W Y Q QHPGK APKLMI YD V SKRP S G VPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLFGTGTKLTVLGGGGG SGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAASGFTFGSFSMSWVRQAPGGGL EWVAGLSARSSLTHYADSVKGRFTISRDNAKNSVYLQMNSLRVEDTAVYYCARRS YD S SGYWGHF YS YMD VWGQGTL VT VS .
  • Some embodiments provided herein relate to a ScFv described herein as antiFL(FITC-E2 HisH131Ala), which can be incorporated into a CAR and used in a method in accordance with this disclosure (SEQ ID NO: 6), having an amino acid sequence of: S VLT QP S S V S A APGQK VTI SC S GS T SNIGNN YV S W Y Q QHPGK APKLMIYDV SKRP S G VPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLFGTGTKLTVLGGGGG SGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAASGFTFGSFSMSWVRQAPGGGL EWVAGLSARSSLTHYADSVKGRFTISRDNAKNSVYLQMNSLRVEDTAVYYCARRS YD S SGYWGAFYS YMD VWGQGTL VT VS .
  • Antigen specific binding domains can include protein or protein domains that can specifically bind to an epitope on a protein at a low or high binding affinity (fM to mM binding capacity).
  • the fusion protein comprises, consists essentially of, or consists of a protein or portion thereof that can modulate an immune response.
  • the protein comprises, consists essentially of, or consists of an antigen specific binding domain.
  • T-cells or“T lymphocytes” as used herein, can be from any mammalian species, preferably primate, including monkeys, dogs, or humans.
  • the T- cells are allogeneic (from the same species but different donor) as the recipient subject; in some alternatives the T-cells are autologous (the donor and the recipient are the same); in some alternatives the T-cells are syngeneic (the donor and the recipients are different but are identical twins).
  • “Individual”, “subject” or“patient,” as described herein, refers to any organism upon which the alternatives described herein may be used or administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes.
  • Subjects or patients include, for example, animals.
  • the subject is mice, rats, rabbits, non human primates, or humans.
  • the subject is a cow, sheep, pig, horse, dog, cat, primate or a human.
  • CCT CAR T cell tumor targeting
  • FL-PLE hapten fluorescein
  • fluorescein is a synthetic organic compound that is soluble in water and alcohol. It is widely used as a fluorescent tracer for many applications.
  • fluorescein is a target moiety on a lipid that is specifically recognized by a chimeric antigen receptor designed and/or selected for its ability to bind or interact with the fluorescein.
  • the lipid is a phospholipid ether.
  • “Hapten” as described herein is a small molecule that elicit an immune response only when conjugated or attached to a large carrier such as a protein.
  • the carrier may be one that also does not elicit an immune response by itself.
  • the carrier may be one that does elicit an immune response by itself.
  • the small-molecule hapten may also be able to bind to the antibody, but it will usually not initiate an immune response; usually only the hapten-carrier adduct can do this.
  • a hapten is a small molecule binding moiety, which can be bound by or have specificity towards a scFv or antibody.
  • Cancer is a group of diseases involving abnormal cell growth with the potential to invade or spread to other parts of the body.
  • Subjects that can be addressed using the methods described herein include subjects identified or selected as having cancer, including but not limited to colon, lung, liver, breast, renal, prostate, ovarian, skin (including melanoma), bone, leukemia, multiple myeloma, or brain cancer, etc. Such identification and/or selection can be made by clinical or diagnostic evaluation.
  • the tumor associated antigens or molecules are known, such as melanoma, breast cancer, brain cancer, squamous cell carcinoma, colon cancer, leukemia, myeloma, or prostate cancer.
  • Examples include but are not limited to B cell lymphoma, breast cancer, brain cancer, prostate cancer, and/or leukemia.
  • one or more oncogenic polypeptides are associated with kidney, uterine, colon, lung, liver, breast, renal, prostate, ovarian, skin (including melanoma), bone, brain cancer, adenocarcinoma, pancreatic cancer, chronic myelogenous leukemia or leukemia.
  • a method of treating, ameliorating, or inhibiting a cancer in a subject is provided by administering one or more of the CARs described herein to a subject in need thereof.
  • the cancer is breast, ovarian, lung, pancreatic, prostate, melanoma, renal, pancreatic, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, liver, colon, skin (including melanoma), bone or brain cancer.
  • the subject that receives one of the therapies described herein is also selected to receive an additional cancer therapy, which can include surgery, a cancer therapeutic, radiation, chemotherapy, targeted therapy, immunotherapy, hormonal therapy, or a cancer therapy drug.
  • the cancer therapy drug provided is, comprises, consists essentially of, or consists of Abiraterone, Alemtuzumab, Anastrozole, Aprepitant, Arsenic trioxide, Atezolizumab, Azacitidine, Bevacizumab, Bleomycin, Bortezomib, Cabazitaxel, Capecitabine, Carboplatin, Cetuximab, Chemotherapy drug combinations, Cisplatin, Crizotinib, Cyclophosphamide, Cytarabine,Denosumab, Docetaxel, Doxorubicin, Eribulin, Erlotinib, Etoposide, Everolimus, Exemestane, Filgrastim, Fluorouracil, Fulvestrant, Gemcitabine, Imatinib, Imiquimod, Ipilimumab, Ixabepilone, Lapatinib, Lenalidomide, Letrozole, Leuprolide, Mesn
  • Tumor microenvironment as described herein is a cellular environment, wherein a tumor exists.
  • the tumor microenvironment can include surrounding blood vessels, immune cells, fibroblasts, bone marrow-derived inflammatory cells, lymphocytes, signaling molecules or the extracellular matrix (ECM).
  • ECM extracellular matrix
  • CRS Cytokine release syndrome
  • cytokine storm refers to an uncontrolled release of proinflammatory cytokines by immune cells, including T cells, natural killer cells, macrophages, dendritic cells, B cells, monocytes, neutrophils, leukocytes, lymphocytes, in response to a disease, infection, or immunotherapy.
  • Immunotherapies that can cause CRS include but are not limited to rituximab, obinutuzumab, alemtuzumab, brentuximab, dacetuzumab, nivolumab, theralizumab, oxaliplatin, lenalidomide, or CAR T therapy.
  • CRS can be treated using anti inflammatory therapies, including but not limited to anti-cytokine antibodies, angiotensin converting enzyme inhibitors, angiotensin II receptor blockers, corticosteroids, free radical scavengers, or TNF-a blockers.
  • anti inflammatory therapies including but not limited to anti-cytokine antibodies, angiotensin converting enzyme inhibitors, angiotensin II receptor blockers, corticosteroids, free radical scavengers, or TNF-a blockers.
  • Cytokines refers to small proteins, polypeptides, or peptides that are involved in inflammatory signaling. Cytokines include but are not limited to chemokines, interferons, interleukins, lymphokines, tumor necrosis factors, CCL1, CC12, CCL3, CCL4, CCL5, CCL6, CCL7, CCL8, CCL9, CCL11, CCL12, CCL13, CCL14, CCL15, CCL16, CCL17, CCL18, CCL19, CCL20, CCL21, CCL22, CCL23, CCL24, CCL25, CCL26, CCL27, CCL28, CXCL1, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11, CXCL12, CXCL13, CXCL14, CXCL15, CXCL16, CXCL17
  • Some embodiments of the methods and compositions provided herein include methods of treating or ameliorating or inhibiting a cancer in a subject. Some such embodiments include administering an effective amount to the subject a composition comprising, consisting essentially of, or consisting of a lipid conjugated to a target moiety; and administering a cell, such as a population of the cells, to the subject, wherein the cell comprises, consists essentially of, or consists of a chimeric antigen receptor (CAR) or T cell receptor (TCR), which specifically binds to the target moiety.
  • CAR chimeric antigen receptor
  • TCR T cell receptor
  • Some embodiments include administering an unconjugated target moiety to the subject, such as a salt of biotin, digoxigenin, dinitrophenol or fluorescein, such as sodium, disodium, or potassium salts of biotin, digoxigenin, dinitrophenol or fluorescein.
  • administering an unconjugated target moiety to the subject can modulate the activity of the CAR T cells.
  • the target moiety can bind to the CAR T cell without invoking substantial signaling in the CAR T cell.
  • the presence of unconjugated target moiety can reduce effector function of the CAR T cell.
  • the presence of unconjugated target moiety can reduce undesirable side effects of the CAR T cell, such as cytokine release syndrome in a subject.
  • the terms“treating,”“treatment,”“therapeutic,” or“therapy” as used herein has its ordinary meaning as understood in light of the specification, and do not necessarily mean total cure or abolition of the disease or condition.
  • the term“treating” or “treatment” as used herein (and as well understood in the art) also means an approach for obtaining beneficial or desired results in a subject's condition, including clinical results.
  • Beneficial or desired clinical results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions, diminishment of the extent of a disease, stabilizing (e.g., not worsening) the state of disease, prevention of a disease's transmission or spread, delaying or slowing of disease progression, amelioration or palliation of the disease state, diminishment of the reoccurrence of disease, and remission, whether partial or total and whether detectable or undetectable.“Treating” and“treatment” as used herein also include prophylactic treatment. Treatment methods comprise administering to a subject a therapeutically effective amount of an active agent. The administering step may consist of a single administration or may comprise a series of administrations.
  • compositions are administered to the subject in an amount and for a duration sufficient to treat the patient.
  • the length of the treatment period depends on a variety of factors, such as the severity of the condition, the age and genetic profile of the patient, the concentration of active agent, the activity of the compositions used in the treatment, or a combination thereof.
  • the effective dosage of an agent used for the treatment or prophylaxis may increase or decrease over the course of a particular treatment or prophylaxis regime. Changes in dosage may result and become apparent by standard diagnostic assays known in the art. In some instances, chronic administration may be required.
  • Some embodiments described herein relate to a method of treating, inhibiting, ameliorating, preventing, or slowing a disease or disorder described herein.
  • the methods include administering to a subject identified as suffering from the disease or disorder described herein an effective amount of a cell described herein, or a pharmaceutical composition that includes an effective amount of a cell as described herein.
  • the cell comprises, consists essentially of, or consists of a chimeric antigen receptor (CAR) or T cell receptor (TCR), which specifically binds to a target moiety.
  • the method further includes administering to the subject an effective amount of the unconjugated target moiety.
  • the administration of the effective amount of the unconjugated target moiety reduces effector function or cytokine production of the cell comprising, consisting essentially of, or consisting of the CAR or TCR.
  • inventions described herein relate to using a cell or target moiety as described herein in the manufacture of a medicament for treating, inhibiting ameliorating, preventing, or slowing the disease or disorder described herein. Still other embodiments described herein relate to the use of a cell or target moiety as described herein or a pharmaceutical composition that includes an effective amount of a cell or target moiety as described herein for treating, inhibiting ameliorating, preventing, or slowing the disease or disorder described herein.
  • the invention is generally disclosed herein using affirmative language to describe the numerous embodiments.
  • the invention also includes embodiments in which subject matter is excluded, in full or in part, such as substances or materials, method steps and conditions, protocols, or procedures.
  • Example 2 In vivo intratumoral use of sodium fluorescein (NaFL) to reverse cytotoxic episodes by antiFL CAR T cells
  • mice After an adenocarcinoma (MDA-MB-231) tumor was established in 2 groups of mice by subcutaneous injection (2 tumors per mouse in opposite flanks), the mice received an intravenous injection of antiFL(FITC-E2) CAR T cells on day 6.
  • the control group no drug only received the antiFL(FITC-E2) CAR T cells and the tumor progressed as normal.
  • the second group received intratumoral injection of 1 pg FL-PLE prior to T cell injection on day 6 followed by re-dosing twice a week with FL-PLE until the tumor had regressed on day 45 (FIG. 2A).
  • mice were monitored for cytokine release syndrome (CRS) and cytotoxicity on a scale ranging from 1 (healthy) to 5 (dead) (FIG. 2B).
  • CRS cytokine release syndrome
  • the intratumoral dose of FL-PLE was increased to 2 pg per tumor.
  • the mice had levels of CRS/toxicity between 3 and 4 at which point they received a dose of 0.56 mg of NaFL via an intravenous injection.
  • the cytotoxicity level had dropped and by 12 hours had return to roughly the baseline levels prior to the past injection.
  • all doses of FL-PLE were administered at 1 pg per tumor. Every mouse from this group lived to day 90 (FIG. 2C). Also, at day 90 there were no tumors present, as seen in FIG. 2A.
  • This experiment demonstrated that NaFL quickly reduced cytotoxic events and that following administration and clearance of NaFL, the antiFL CAR T cells continued to function.
  • Example 3 In vitro use of NaFL is dose titratable in reducing the amount of activation of an antiFL CAR T cell
  • CD4+ and CD8+ T cells from peripheral blood mononuclear cell preparations from two donors were lentivirally transduced to express long CAR cassettes comprising the antiFL(Mut2) CAR.
  • the CAR cassette also contains the gene for a double mutant dihydrofolate reductase that allows for methotrexate positive selection to enrich for transduced CAR-expressing cells as well as the gene for the truncated CD 19 (CD19t) surface marker that denotes CAR positivity.
  • the selected cells are then subjected to a standard rapid expansion protocol using irradiated TM-LCL and PBMC feeder cells.
  • K562 parental (negative control), K562 OKT3+ (T cell activating positive control), and MDA-MB-231 target cells were incubated with 5 mM FL-PLE in PBS for 30 minutes followed by a wash to remove unbound FL-PLE. Cells were then returned to complete media. Cell integration of FL-PLE was analyzed by flow cytometry (FIG. 3C). There is a clear shift in FL-PLE amounts from the parental cell lines in contrast to those incubated with 5 mM FL-PLE. The amount of shift corresponds to the amount of fluorescein exposed on the surface of the cell (which is important for antiFL CAR T cell recognition).
  • K562 OKT3+ cells which were generated as a positive control to test the endogenous activation of T cells through the TCR) match the parental K562 line, showing that the addition of OKT3 does not interfere with fluorescein detection. These target cells are used for the following cytokine release assay.
  • a cytokine release assay was set up to examine how a dose titration of NaFL (0, 1, 5, and 10 pM) affects the activation of antiFL CAR T cells.
  • the CAR T cells are the antiFL(Mut2) CAR T cells generated in this example.
  • Target cells were incubated with FL- PLE/NaFL for 24 hours or overnight.
  • the media supernatant from target cell cultures were harvested and constituent cytokines were measured (e.g. with a Bio-Plex Human Cytokine Screening Panel).
  • the cytokines IL-2 (FIG. 3D), IFN-g (FIG. 3E), and TNF-a (FIG. 3F) were measured.
  • the antiFL(Mut2) CAR T cells are able to recognize the fluorescein moiety of the FL-PLE integrated in the plasma membrane of the target cells and are able to activate with both the K562 and MDA-MB-231 cells loaded with FL-PLE whereas the mock T cells do not activate in the presence of these cells.
  • the amount of activation is decreased by the amount of NaFL present in the solution in a linear fashion for all three cytokines tested for both donor T cells. Therefore, NaFL can be used in vitro to reduce cytokine production by antiFL CAR T cells in a dose titratable manner.
  • Example 4 In vivo intravenous use of NaFL to reverse cytotoxic episodes by antiFL CAR T cells
  • mice were prepared to test whether intravenous (IV) administration of NaFL as opposed to intratumoral administration (as seen in Example 2) can be used to reduce cytokine production by antiFL CAR T cells.
  • Group A - control (5 mice): MDA-MB-231 tumor + antiFL(Mut2) CAR T cells.
  • mice receiving FL-PLE were administered FL-PLE IV first.
  • AntiFL(Mut2) CAR T cells were subsequently administered in all mice 2 days following FL-PLE administration. No cytokine toxicity were observed in any mice over a 2 day period following CAR T administration. Following this 2 day period, a second injection of FL-PLE was administered in Groups B-D. After 24 hours or overnight, cytokine toxicity symptoms in mice of Groups B-D was observed. Reduction of cytokine toxicity symptoms in mice of Groups C and D was observed within 15 minutes after administration of NaFL.
  • mice of Groups C and D had cytokine levels comparable to baseline. Mice in Group B did not recover from the cytokine toxicity symptoms and were euthanized. This demonstrates that NaFL is well tolerated in vivo and can be used to reduce the cytokine response caused by antiFL CAR T cells by intravenous administration even if the subject does not have a tumor.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Medicinal Chemistry (AREA)
  • Cell Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Toxicology (AREA)
  • Genetics & Genomics (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Hematology (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
PCT/US2020/022130 2019-03-13 2020-03-11 Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers Ceased WO2020185917A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
EP20770256.4A EP3937975A4 (en) 2019-03-13 2020-03-11 FLUORESCEIN SODIUM AS AN INVERSION AGENT FOR ANTI-FLUORESCEIN CAR-T CELLS AND FLUORESCEIN-PHOSPHOLIPID ETHERS OR PHOSPHOLIPID-PHOSPHOLIPID ETHERS
US17/438,231 US20220125841A1 (en) 2019-03-13 2020-03-11 Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers
JP2021555170A JP2022525400A (ja) 2019-03-13 2020-03-11 フルオレセインエーテルリン脂質またはフルオレセインエーテルリン脂質前駆体と併用した抗フルオレセインcar t細胞に対する拮抗薬としてのフルオレセインナトリウム
AU2020237097A AU2020237097A1 (en) 2019-03-13 2020-03-11 Sodium fluorescein as a reversal agent for an anti-fluorescein CAR T cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers
CA3140210A CA3140210A1 (en) 2019-03-13 2020-03-11 Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962818030P 2019-03-13 2019-03-13
US62/818,030 2019-03-13

Publications (1)

Publication Number Publication Date
WO2020185917A1 true WO2020185917A1 (en) 2020-09-17

Family

ID=72426940

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/022130 Ceased WO2020185917A1 (en) 2019-03-13 2020-03-11 Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers

Country Status (6)

Country Link
US (1) US20220125841A1 (https=)
EP (1) EP3937975A4 (https=)
JP (1) JP2022525400A (https=)
AU (1) AU2020237097A1 (https=)
CA (1) CA3140210A1 (https=)
WO (1) WO2020185917A1 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023224715A1 (en) * 2022-05-19 2023-11-23 Massachusetts Institute Of Technology Car cells targeting an inserted ligand
EP4228660A4 (en) * 2020-10-14 2025-02-26 Georgia Tech Research Corporation Synthetic antigens as chimeric antigen receptor (car) ligands and uses thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12312416B2 (en) * 2018-02-06 2025-05-27 Seattle Children's Hospital Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors
CN115210252A (zh) 2020-02-04 2022-10-18 西雅图儿童医院(Dba西雅图儿童研究所) 抗二硝基苯酚的嵌合抗原受体

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150320799A1 (en) * 2012-12-20 2015-11-12 Purdue Research Foundation Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics
US20160136190A1 (en) * 2014-11-17 2016-05-19 Cellectar Biosciences, Inc. Phospholipid Ether Analogs as Cancer-Targeting Drug Vehicles
US20160361360A1 (en) * 2015-06-12 2016-12-15 Immunomedics, Inc. Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs
WO2018148224A1 (en) * 2017-02-07 2018-08-16 Seattle Children's Hospital (dba Seattle Children's Research Institute) Phospholipid ether (ple) car t cell tumor targeting (ctct) agents
WO2018160622A1 (en) * 2017-02-28 2018-09-07 Endocyte, Inc. Compositions and methods for car t cell therapy

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11408005B2 (en) * 2016-12-12 2022-08-09 Seattle Children's Hospital Chimeric transcription factor variants with augmented sensitivity to drug ligand induction of transgene expression in mammalian cells

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150320799A1 (en) * 2012-12-20 2015-11-12 Purdue Research Foundation Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics
US20160136190A1 (en) * 2014-11-17 2016-05-19 Cellectar Biosciences, Inc. Phospholipid Ether Analogs as Cancer-Targeting Drug Vehicles
US20160361360A1 (en) * 2015-06-12 2016-12-15 Immunomedics, Inc. Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs
WO2018148224A1 (en) * 2017-02-07 2018-08-16 Seattle Children's Hospital (dba Seattle Children's Research Institute) Phospholipid ether (ple) car t cell tumor targeting (ctct) agents
WO2018160622A1 (en) * 2017-02-28 2018-09-07 Endocyte, Inc. Compositions and methods for car t cell therapy

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3937975A4 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4228660A4 (en) * 2020-10-14 2025-02-26 Georgia Tech Research Corporation Synthetic antigens as chimeric antigen receptor (car) ligands and uses thereof
WO2023224715A1 (en) * 2022-05-19 2023-11-23 Massachusetts Institute Of Technology Car cells targeting an inserted ligand

Also Published As

Publication number Publication date
JP2022525400A (ja) 2022-05-13
CA3140210A1 (en) 2020-09-17
AU2020237097A1 (en) 2021-11-04
EP3937975A4 (en) 2023-06-21
AU2020237097A8 (en) 2022-01-06
US20220125841A1 (en) 2022-04-28
EP3937975A1 (en) 2022-01-19

Similar Documents

Publication Publication Date Title
CA3176792C (en) Anti-cd3 and anti-bcma bispecific antibodies wth modified heavy chain constant regions
AU2011223547B2 (en) Monoclonal antibodies directed to CD52
US20220125841A1 (en) Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers
WO2021222578A1 (en) Multispecific heavy chain antibodies with modified heavy chain constant regions
WO2021000530A1 (zh) 一种双特异性抗体及其制备方法与应用
CN115175694B (zh) 抗baff受体抗体及其用途
KR20230069959A (ko) 다발성 골수종을 치료하기 위한 방법
CA2761885A1 (en) Methods and compositions for treating lupus
JP2022502024A (ja) 抗ヒトcd45rc抗体及びその使用
JPWO2020004490A1 (ja) コンドロイチン硫酸プロテオグリカン−5に結合する抗体
CN118974091A (zh) T细胞结合蛋白
US20240239907A1 (en) C-X-C Motif Chemokine Receptor 6 (CXCR6) Binding Molecules, and Methods of Using the Same
CN119060184B (zh) 抗rage抗体及其应用
KR20210119448A (ko) Cd31 경쟁인자(competitor) 및 이의 용도
CN119371542B (zh) 抗rage抗体及其应用
WO2024222863A1 (en) Combination treatment targeting sirpa and claudin 18.2
US20250026841A1 (en) Bispecific antibodies targeting cd137 and uses thereof for anti-cancer immunotherapy
WO2026035616A1 (en) Combinations for the treatment of cancer
WO2022255248A1 (ja) 抗cd26抗体と免疫チェックポイント阻害剤との併用療法
JP2024534543A (ja) 腫瘍特異的二重特異性免疫細胞エンゲージャー
WO2025128264A1 (en) Anti-pd-1 monoclonal antibody and methods of use thereof
WO2021258140A1 (en) Cd83 binding protein conjugates for treating lymphoma
TW202602924A (zh) 抗ccr8抗體之醫藥配製物
HK40115334A (zh) 肿瘤特异性双特异性免疫细胞接合剂

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20770256

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3140210

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021555170

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020237097

Country of ref document: AU

Date of ref document: 20200311

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020770256

Country of ref document: EP

Effective date: 20211013