WO2020161214A1 - Use of anti-ceacam5 immunoconjugates for treating lung cancer - Google Patents

Use of anti-ceacam5 immunoconjugates for treating lung cancer Download PDF

Info

Publication number
WO2020161214A1
WO2020161214A1 PCT/EP2020/052932 EP2020052932W WO2020161214A1 WO 2020161214 A1 WO2020161214 A1 WO 2020161214A1 EP 2020052932 W EP2020052932 W EP 2020052932W WO 2020161214 A1 WO2020161214 A1 WO 2020161214A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
amino acid
immunoconjugate
seq
ceacam5
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2020/052932
Other languages
English (en)
French (fr)
Inventor
Aurore ALLARD
Mustapha CHADJAA
Cécile Combeau
Brigitte Demers
Christophe Henry
Semra YORUK
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sanofi SA
Original Assignee
Sanofi SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from EP19305173.7A external-priority patent/EP3693023A1/en
Priority to KR1020217025390A priority Critical patent/KR20210124260A/ko
Priority to CN202080012901.6A priority patent/CN114173823A/zh
Priority to CA3129106A priority patent/CA3129106A1/en
Priority to EP20702487.8A priority patent/EP3920972A1/en
Priority to MX2021009514A priority patent/MX2021009514A/es
Priority to BR112021014636A priority patent/BR112021014636A2/pt
Priority to JP2021546257A priority patent/JP7597718B2/ja
Priority to SG11202107843WA priority patent/SG11202107843WA/en
Priority to US17/425,603 priority patent/US20220080053A1/en
Application filed by Sanofi SA filed Critical Sanofi SA
Priority to AU2020219405A priority patent/AU2020219405A1/en
Publication of WO2020161214A1 publication Critical patent/WO2020161214A1/en
Priority to CONC2021/0010032A priority patent/CO2021010032A2/es
Priority to IL285306A priority patent/IL285306A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6853Carcino-embryonic antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68033Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3007Carcino-embryonic Antigens
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3023Lung
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/86Lung

Definitions

  • the present disclosure relates to the field of therapeutic treatment of cancers, such as non-squamous non-small cell lung cancer (NSQ NSCLC), which express CEACAM5.
  • cancers such as non-squamous non-small cell lung cancer (NSQ NSCLC)
  • NSQ NSCLC non-squamous non-small cell lung cancer
  • Certain aspects of the invention relate to the use of CEACAM5 antagonists, such as anti-CEACAM5 antibodies and immunoconjugates, to treat lung cancer.
  • ADCs antibody drug conjugates
  • Lung cancer for example, is an aggressive form of cancer that is accounts for hundreds of thousands of deaths in the United States. Unfortunately, it tends to recur after initial treatment and become more resistant to subsequent treatment. While multiple treatments have been utilized for the treatment of individuals with lung cancer, more effective treatments are needed.
  • This disclosure provides, inter alia, methods for treating lung cancer (e.g., NSQ NSCLC) in a subject in need thereof comprising administering an effective amount of an antibody or immunoconjugate (comprising the antibody) that specifically binds CEACAM5.
  • lung cancer e.g., NSQ NSCLC
  • an antibody or immunoconjugate comprising the antibody that specifically binds CEACAM5.
  • This disclosure provides, inter alia, antibodies, or immunoconjugates comprising an antibody (also called ADC or antibody-drug conjugate), and methods for treating a cancer that express CEACAM5 in a subject in need thereof comprising administering an effective amount of an antibody or immunoconjugate that specifically binds CEACAM5.
  • the cancer expresses human carcinoembryonic antigen-related cell adhesion molecule 5 (hCEACAM5).
  • the cancer highly expresses hCEACAM5.
  • the cancer expresses the A3-B3 domain of hCEACAM5 comprising SEQ ID NOs: 10 and 11, such that the antibody or the immunoconjugate binds the domain.
  • the disclosure provides an antibody, or an immunoconjugate comprising an antibody, for use in treating high carcinoembryonic antigen-related cell adhesion molecule 5 cancer in a subject in need thereof.
  • the antibody specifically binds human carcinoembryonic antigen-related cell adhesion molecule 5 (hCEACAM5) and the antibody comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises the three complementarity determining regions HCDR1 , HCDR2 and HCDR3 and wherein the VL comprises the three CDRs LCDR1, LCDR2 and LCDR3, wherein the HCDR1 comprises the amino acid sequence of SEQ ID NO: 3 (GFVFSSYD); the HCDR2 comprises the amino acid sequence of SEQ ID NO: 4 (ISSGGGIT); the HCDR3 comprises the amino acid sequence of SEQ ID NO: 5 (AAHYFGSSGPFAY); the LCDR1 comprises the amino acid sequence of SEQ ID NO: 6 (ENIFSY)
  • the disclosure provides an antibody , or an immunoconjugate comprising an antibody, for use in treating non squamous non-small cell lung cancer (NSQNSCLC) in a subject in need thereof, wherein the antibody specifically binds hCEACAM5 and wherein the antibody comprises a VH and a VL, wherein the VH comprises the three complementarity determining regions HCDR1 , HCDR2 and HCDR3 and wherein the VL comprises the three CDRs LCDR1 , LCDR2 and LCDR3, wherein the HCDR1 comprises the amino acid sequence of SEQ ID NO: 3; the HCDR2 comprises the amino acid sequence of SEQ ID NO: 4; the HCDR3 comprises the amino acid sequence of SEQ ID NO: 5; the LCDR1 comprises the amino acid sequence of SEQ ID NO: 6; the LCDR2 comprises the amino acid sequence of NTR; and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 7.
  • NTR non squamous non-small cell lung cancer
  • the disclosure provides an antibody, or an immunoconjugate comprising an antibody, for use in treating a subject that has been pre-treated with a cancer therapeutic, wherein the antibody specifically binds hCEACAM5 and wherein the antibody comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises the three complementarity determining regions HCDR1 , HCDR2 and HCDR3 and wherein the VL comprises the three CDRs LCDR1, LCDR2 and LCDR3, wherein the HCDR1 comprises the amino acid sequence of SEQ ID NO: 3; the HCDR2 comprises the amino acid sequence of SEQ ID NO: 4; the HCDR3 comprises the amino acid sequence of SEQ ID NO: 5; the LCDR1 comprises the amino acid sequence of SEQ ID NO: 6; the LCDR2 comprises the amino acid sequence of NTR; and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 7.
  • VH heavy chain variable region
  • VL light chain variable region
  • the VH comprises the
  • the subject is a high carcinoembryonic antigen-related cell adhesion molecule expresser.
  • the subject was pre-treated with an agent or drug for treatment of non-small cell lung cancer.
  • the agent or drug is selected from the group consisting of: a chemotherapy agent, an angiogenesis inhibitor, an epidermal growth factor receptor (EGFR) inhibitor, an anaplastic lymphoma kinase (ALK) inhibitor, a receptor tyrosine kinase (ROS1) inhibitor, and an immune checkpoint inhibitor.
  • the immune checkpoint inhibitor is a PD-1 inhibitor and/or a PD- L1 inhibitor.
  • the cancer is NSQ NSCLC.
  • the VH comprises SEQ ID NO: 1
  • the heavy chain comprises SEQ ID NO: 8
  • the VL comprises SEQ ID NO: 2
  • the light chain comprises SEQ ID NO: 9
  • the antibody is conjugated or linked to at least one growth inhibitory agent.
  • the growth inhibitory agent is a cytotoxic agent.
  • the growth inhibitory agent is selected from the group consisting of chemotherapeutic agents, enzymes, antibiotics, and toxins such as small molecule toxins or enzymatically active toxins, taxoids, vincas, taxanes, maytansinoid or maytansinoid analogs, tomaymycin or pyrrolobenzodiazepine derivatives, cryptophycin derivatives, leptomycin derivatives, auristatin or dolastatin analogs, prodrugs, topoisomerase II inhibitors, DNA alkylating agents, anti-tubulin agents, and CC-1065 or CC-1065 analogs.
  • the growth inhibitory agent is N2’-deacetyl-N2’-(3-mercapto-l - oxopropylj-maytansine (DM1) or N2’-deacetyl-N-2’(4-methyl-4-mercapto-l-oxopentyl)- maytansine (DM4).
  • the growth inhibitory agent is DM4.
  • the antibody is covalently attached via a cleavable or non- cleavable linker to the at least one growth inhibitory agent.
  • the linker is selected from the group consisting of N-succinimidyl
  • pyridyldithiobutyrate SPDB
  • 4-(Pyridin-2-yldisulfanyl)-2-sulfo-butyric acid sulfo-SPDB
  • succinimidyl N-maleimidomethyl
  • cyclohexane- 1-carboxy late SMCC
  • the linker is SPDB.
  • the antibody is huMAb2-3.
  • the subject has a hCEACAM5 expression of a percent score greater than or equal to 50 (consisting of 2+ and 3+ intensities) in the tumor cell populations, for example, the hCEACAM5 expression of a percent score greater than or equal to at least about 50, at least about 50 to about 80, at least about 80, or about 100 (consisting of 2+ and 3+ intensities).
  • the percentage of hCEACAM5 expression is at least about 50% to about 80% of the tumor cells populations, at least about 80%, at least about 90%, at least about 95%, or about 100% of the tumor cells populations.
  • the cancer is a non-squamous non-small cell lung carcinoma that highly expresses hCEACAM5 in at least about 50%, at least about 50% to about 80%, at least about 80%, at least about 90%, at least about 95%, or about 100% of the tumor cell population.
  • the antibody, or an immunoconjugate comprising the antibody is administered intravenously, for example by intravenous infusion.
  • the antibody, or an immunoconjugate comprising the antibody is administered at a rate of 2.5 mg/min for the first 30 minutes. In various embodiments, after about 30 minutes, the rate of administration of the antibody is increased to 5 mg/min.
  • antibody, or an immunoconjugate comprising the antibody is administered at a dose level of 5, 10, 20, 30, 40, 60, 80, 100, 120, 150, 180, or 210 mg/m 2 based on the body surface area of the subject.
  • the immunoconjugate comprising the antibody is administered at a dose level of 100 mg/m 2 based on the body surface area of the subject, which corresponds to the maximum tolerated dose (MTD) determined during the escalation phase.
  • MTD maximum tolerated dose
  • the antibody, or an immunoconjugate comprising the antibody is administered at a dose of about 2.5 mg/m 2 to about 5 mg/m 2 .
  • the antibody, or an immunoconjugate comprising the antibody is administered for one hour at a dose of about 2.5 mg/m 2 to about 5 mg/m 2 .
  • the dose includes 2.5 mg/m 2 of the antibody, 5 mg/m 2 of the antibody and all doses in between 2.5 mg/m 2 and 5 mg/m 2 , for example 2.75, 3, 3.25, 3.5, 3.75, 4, 4.25, 4.5, and 4.75 mg/m 2 .
  • the body surface area is calculated using the height and actual body of the subject.
  • the antibody, or an immunoconjugate comprising the antibody is administered at every 14 days. In various embodiments, the antibody, or an immunoconjugate comprising the antibody, is administered every three weeks.
  • the disclosure provides the immunoconjugate huMAb2-3 -SPDB-DM4 for use in treating non squamous non-small cell lung cancer (NSQNSCLC) in a subject in need thereof, wherein the immunoconjugate huMAb2-3-SPDB-DM4 is administered every two weeks at a dose level of 100 mg/m 2 .
  • NQNSCLC non squamous non-small cell lung cancer
  • the disclosure provides the immunoconjugate huMAb2-3 -SPDB-DM4 for use in treating non squamous non-small cell lung cancer (NSQNSCLC) in a subject in need thereof, wherein the immunoconjugate huMAb2-3-SPDB-DM4 is administered every three weeks at a dose level of 100 mg/m 2 .
  • NQNSCLC non squamous non-small cell lung cancer
  • the disclosure provides the immunoconjugate huMAb2-3-SPDB- DM4 for use in treating non squamous non-small cell lung cancer (NSQNSCLC) in a subject in need thereof, wherein the immunoconjugate huMAb2-3-SPDB-DM4 is administered at a first dose level of 150 mg/m 2 or 170 mg/m 2 and then every two weeks at a dose level of 100 mg/m 2 .
  • NQNSCLC non squamous non-small cell lung cancer
  • the subject prior to administering the antibody, or an immunoconjugate comprising the antibody, the subject is administered a pre-medication.
  • the pre medication is a histamine HI antagonist.
  • the histamine HI antagonist is diphenylhydramine or
  • the subject was previously treated with an agent or drug for treatment of non-small cell lung cancer.
  • the agent or drug is selected from the group consisting of: a chemotherapy agent, an angiogenesis inhibitor, an epidermal growth factor receptor (EGFR) inhibitor, anaplastic lymphoma kinase (ALK) inhibitor, a receptor tyrosine kinase (ROS1) inhibitor, and an immune checkpoint inhibitor.
  • the immune checkpoint inhibitor is a PD-1 inhibitor and/or a PD-L1 inhibitor.
  • progression of at least one symptom of cancer is reduced, slowed, halted, or otherwise ameliorated.
  • the tumor growth rate or tumor size is reduced after treatment with the antibody.
  • the expression pattern, intensity and proportion of expressing cells indicates a reduction, slowing or halting of the cancer.
  • the disclosure provides a pharmaceutical composition comprising the antibody described herein, or an immunoconjugate comprising the antibody, and a pharmaceutically acceptable carrier.
  • the disclosure provides an immunoconjugate for use in treating high carcinoembryonic antigen-related cell adhesion molecule cancer in a subject in need thereof, wherein the immunoconjugate comprises an antibody drug conjugate (ADC) that specifically binds hCEACAM5 and comprises the antibody as described above, wherein progression of at least one symptom of cancer is reduced, slowed, halted, or otherwise ameliorated.
  • ADC antibody drug conjugate
  • the disclosure provides an immunoconjugate for use in treating NSQ NSCLC in a subject in need thereof, wherein the immunoconjugate comprises an ADC that specifically binds hCEACAM5 and comprises the antibody as described above, wherein progression of at least one symptom of cancer is reduced, slowed, halted, or otherwise ameliorated.
  • the disclosure provides an immunoconjugate for use in treating a subject that is a heavily pre-treated high carcinoembryonic antigen-related cell adhesion molecule expresser, wherein the immunoconjugate comprises an ADC that specifically binds hCEACAM5 and comprises the antibody as described above, wherein progression of at least one symptom of cancer is reduced, slowed, halted, or otherwise ameliorated.
  • immunoconjugate comprises the antibody huMAb2-3.
  • the growth inhibitory agent comprises DM4; and wherein the linker comprises SPDB.
  • the ADC comprises huMAb2-3-SPDB-DM4.
  • the tumor growth rate or tumor size is reduced after treatment with the immunoconjugate.
  • expression pattern, intensity and proportion of expressing cells indicates a reduction, slowing or halting of the cancer.
  • the disclosure provides a pharmaceutical composition
  • a pharmaceutical composition comprising the antibody described herein, or the immunoconjugate described, and a pharmaceutically acceptable carrier.
  • the disclosure provides a method for treating high carcinoembryonic antigen-related cell adhesion molecule 5 cancer in a subject in need thereof, the method comprising administering an antibody that specifically binds hCEACAM5 wherein the antibody comprises a VH and a VL, wherein the VH comprises the three complementarity determining regions HCDR1 , HCDR2 and HCDR3) and wherein the VL comprises the three CDRs LCDR1, LCDR2 and LCDR3, wherein the HCDR1 comprises the amino acid sequence of SEQ ID NO: 3; the HCDR2 comprises the amino acid sequence of SEQ ID NO: 4; the HCDR3 comprises the amino acid sequence of SEQ ID NO: 5; the LCDR1 comprises the amino acid sequence of SEQ ID NO: 6; the LCDR2 comprises the amino acid sequence of NTR; and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 7.
  • the disclosure provides a method for treating NSQ NSCLC in a subject in need thereof, the method comprising administering an antibody specifically binds hCEACAM5 wherein the antibody comprises a VH and a VL, wherein the VH comprises the three complementarity determining regions HCDR1 , HCDR2 and HCDR3 and wherein the VL comprises the three CDRs LCDR1, LCDR2 and LCDR3, wherein the HCDR1 comprises the amino acid sequence of SEQ ID NO: 3; the HCDR2 comprises the amino acid sequence of SEQ ID NO: 4; the HCDR3 comprises the amino acid sequence of SEQ ID NO: 5; the LCDR1 comprises the amino acid sequence of SEQ ID NO: 6; the LCDR2 comprises the amino acid sequence of NTR; and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 7.
  • the disclosure provides a method for treating a subject that has been pre-treated with a cancer therapeutic, wherein the antibody specifically binds hCEACAM5 wherein the antibody comprises a VH and a VL, wherein the VH comprises the three complementarity determining regions HCDR1, HCDR2 and HCDR3and wherein the VL comprises the three CDRs LCDR1, LCDR2 and LCDR3, wherein the HCDR1 comprises the amino acid sequence of SEQ ID NO: 3; the HCDR2 comprises the amino acid sequence of SEQ ID NO: 4; the HCDR3 comprises the amino acid sequence of SEQ ID NO: 5; the LCDR1 comprises the amino acid sequence of SEQ ID NO: 6; the LCDR2 comprises the amino acid sequence of NTR; and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 7.
  • the subject is a high carcinoembryonic antigen-related cell adhesion molecule expresser.
  • the subject was pre-treated with an agent or drug for treatment of non-small cell lung cancer.
  • the agent or drug is selected from the group consisting of: an chemotherapy agent, an angiogenesis inhibitor, an epidermal growth factor receptor (EGFR) inhibitor, an anaplastic lymphoma kinase (ALK) inhibitor, a receptor tyrosine kinase (ROS1) inhibitor, and an immune checkpoint inhibitor.
  • the immune checkpoint inhibitor is a PD-1 inhibitor and/or a PD-L1 inhibitor.
  • the cancer is NSQ NSCLC.
  • the VH comprises SEQ ID NO: 1.
  • the heavy chain comprises SEQ ID NO: 8.
  • the VL comprises SEQ ID NO: 2.
  • the light chain comprises SEQ ID NO: 9.
  • the antibody is conjugated or linked to at least one growth inhibitory agent.
  • the growth inhibitory agent is a cytotoxic agent.
  • the growth inhibitory agent is selected from the group consisting of chemotherapeutic agents, enzymes, antibiotics, and toxins such as small molecule toxins or enzymatically active toxins, taxoids, vincas, taxanes, maytansinoid or maytansinoid analogs, tomaymycin or pyrrolobenzodiazepine derivatives, cryptophycin derivatives, leptomycin derivatives, auristatin or dolastatin analogs, prodrugs, topoisomerase II inhibitors, DNA alkylating agents, anti-tubulin agents, and CC-1065 or CC-1065 analogs.
  • the growth inhibitory agent is DM1 or DM4.
  • the growth inhibitory agent is DM4.
  • the antibody is covalently attached via a cleavable or non-cleavable linker to the at least one growth inhibitory agent.
  • the linker is selected from the group consisting of SPDB, sulfo- SPDB, and SMCC. In one embodiment, the linker is SPDB.
  • the antibody is huMAb2-3.
  • the subject patients has a hCEACAM5 expression of a percent score greater than or equal to 50 (consisting of 2+ and 3+ intensities) in the tumor cell populations.
  • the percentage of hCEACAM5 expression is at least about 50% to about 80% of the tumor cell populations, at least about 80% or about 100% of the tumor cell populations.
  • the cancer is a non-squamous non-small cell lung carcinoma that highly expresses hCEACAM5 in at least about 50%, at least about 50% to about 80%, at least about 80%, or about 100% of the tumor cell population.
  • the antibody is administered intravenously, for example by intravenous infusion.
  • the antibody, or an immunoconjugate comprising the antibody is administered at a rate of 2.5 mg/min for the first 30 minutes. In various embodiments of the method, after 30 minutes, the rate of administration of the antibody is increased to 5 mg/min.
  • the antibody, or an immunoconjugate comprising the antibody is administered at a dose level of 5, 10, 20, 30, 40, 60, 80, 100, 120, 150, 180, or 210 mg/m 2 based on the body surface area of the subject. In various embodiments of the method, the antibody, or an immunoconjugate comprising the antibody, is administered at a dose of about 2.5 mg/m2 to about 5 mg/m2. For example, the antibody, or an immunoconjugate comprising the antibody, is administered for one hour at a dose of about 2.5 mg/m2 to about 5 mg/m2.
  • the dose includes 2.5 mg/m 2 of the antibody, or of an immunoconjugate comprising the antibody, 5 mg/m 2 of the antibody , or of an immunoconjugate comprising the antibody, and all doses in between 2.5 mg/m 2 and 5 mg/m 2 , for example 2.75, 3, 3.25, 3.5, 3.75, 4, 4.25, 4.5, and 4.75 mg/m 2 .
  • the body surface area is calculated using the height and actual body of the subject.
  • the antibody, or an immunoconjugate comprising the antibody is administered at every 14 days. In various embodiments, the antibody, or an immunoconjugate comprising the antibody, is administered every three weeks.
  • the subject prior to administering the antibody, or an immunoconjugate comprising the antibody, the subject is administered a pre-medication, for example the subject is pre-medication is a histamine HI antagonist.
  • the histamine HI antagonist is diphenylhydramine or dexchlorpheniramine.
  • agent or drug for treatment of non-small cell lung cancer.
  • agent or drug is selected from the group consisting of: a chemotherapy agent, an angiogenesis inhibitor, an EGFR inhibitor, anaplastic lymphoma kinase (ALK) inhibitor, a receptor tyrosine kinase (ROS1) inhibitor, and an immune checkpoint inhibitor.
  • the immune checkpoint inhibitor is a PD-1 inhibitor and/or a PD-L1 inhibitor.
  • progression of at least one symptom of cancer is reduced, slowed, halted, or otherwise ameliorated.
  • the tumor growth rate or tumor size is reduced after treatment with the antibody.
  • the expression pattern, intensity and proportion of expressing cells indicates a reduction, slowing or halting of the cancer.
  • the disclosure provides a pharmaceutical composition comprising the antibody described herein, or an immunoconjugate comprising the antibody, and a pharmaceutically acceptable carrier.
  • the antibody is administered as an ADC that specifically binds hCEACAM5 and comprises any antibody described herein, wherein progression of at least one symptom of cancer is reduced, slowed, halted, or otherwise ameliorated after administration/treatment with the ADC.
  • the ADC comprises the antibody huMAb2-3; wherein the growth inhibitory agent comprises DM4; and wherein the linker comprises SPDB.
  • the ADC comprises huMAb2-3-SPDB-DM4.
  • the tumor growth rate and/or tumor size is reduced after treatment with the antibody and/or the immunoconjugate.
  • the expression pattern, intensity and proportion of expressing cells indicates a reduction, slowing or halting of the cancer after treatment with the antibody and/or the immunoconjugate.
  • the antibody and/or immunoconjugate is administered as a pharmaceutical composition comprising a pharmaceutically acceptable carrier.
  • Figures 1A, IB and 1C show respectively examples of 1+, 2+, 3+ staining intensities.
  • Figure 2 is a bar graph of the best relative tumor shrinkage in patients treated with huMAb2-3-SPDB-DM4 according to category of centralized CEACAM5 expression in an archival sample.
  • CEACAM5 expression (2+/3+) of patients is ⁇ 50%, between 50% and 80% or >or .
  • PR means Partial Response.
  • SD means Stable Disease.
  • PD means Progression Disease.
  • Figure 3 illustrates the best relative tumor shrinkage observed in the 32patients treated in the high CEACAM5-expression (Lung) cohort and in the patients of the moderate expressers cohort.
  • CEACAM5 expression (2+/3+) of patients is ⁇ 50% or >50%.
  • PR means Partial
  • SD Stable Disease
  • PD Progression Disease
  • FIG. 4 illustrates the time to progression (TTP) in the 32patients treated in the high CEACAM5 -expression (Lung) cohort.
  • compositions for the treatment of NSQ NSCLC, and the improvement of at least one symptom of the disease.
  • compositions include at least one antibody that specifically binds
  • the ADC huMAb2-3-SPDB- DM4 is an immunoconjugate combining the huMAb2-3 (anti-CEACAM5) antibody and the maytansinoid derivative 4 (DM4), a potent antimitotic agent that inhibits microtubule assembly.
  • DM4 is covalently bound to huMAb2-3 through an optimized linker SPDB [N-succinimidyl 4- (2-pyridyldithio)-butyrate] that is stable in plasma and cleavable inside cells. After binding and internalization in targeted cancer cells, huMAb2-3-SPDB-DM4 is degraded, releasing cytotoxic DM4 metabolites.
  • high CEACAM5 cancer refers to several types including lung, cancer.
  • the lung cancer is non-squamous non-small cell lung cancer.
  • high CEACAM5 expressers have greater than 2+ intensity in at least 50% of expressing tumor cell population.
  • High CEACAM5 expressers represent -20% of lung cancer.
  • the ADC described herein comprising a DM4 cytotoxic agent, SPDB linker and humanized antibody huMAb2-3 was administered in a proof of concept study. Data show that the ADC achieved proof of concept in a subset of lung cancer.
  • the ADC was analyzed in a Phase 1/2 study in heavily pre-treated high CEACAM5 expressers.
  • the ADC demonstrated competitive Overall Response Rate (ORR) and Duration of Response (DoR) for in 3L setting.
  • ORR Overall Response Rate
  • DoR Duration of Response
  • Most common Adverse Drug Reactions (ADRs) were ocular toxicity (reversible without treatment discontinuation), and minimal hematological/nerve toxicity.
  • “heavily pre-treated” refers to the pre-treatment of a subject for more than 1 month.
  • a subject who is heavily pre-treated has undergone treatment for more than 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 months.
  • the pre-treatment is the administration of one or more cancer therapeutics.
  • NSCLC Non-small cell lung cancer
  • Non-small cell lung cancer is a disease in which malignant (cancer) cells form in the tissues of the lung. Smoking is the major cause of the disease. This is a type of epithelial lung cancer other than small cell lung carcinoma.
  • ADCs Selectively targeting potent cytotoxics to tumor cells using ADCs has now been shown to be an effective strategy for the treatment of cancer, as demonstrated by the recent approvals of brentuximab vedotin for the treatment of Hodgkin lymphoma and trastuzumab emtansine (T- DM1) for the treatment of relapsed metastatic HER2+ breast cancer .
  • T- DM1 trastuzumab emtansine
  • Many other malignant diseases with unmet medical needs could benefit from such therapeutic options.
  • the mechanism of action of ADCs begins with its binding to a specific antigen, sufficiently expressed on the tumor cells in order to achieve a selective and efficient internalization of the drug.
  • Radical surgery is the standard of care for fit stage I NSCLC patients ( e.g .
  • Adjuvant treatment should be offered only as part of an investigation trial. Stage II and IIIA adjuvant cisplatin-based chemotherapy remains the gold standard for completely resected NSCLC tumors.
  • Other chemotherapeutic agents used in combination with cisplatin, or with each other, may include carboplatin, paclitaxel (Taxol), albumin-bound paclitaxel (nab-paclitaxel,
  • radiotherapy may be used in patients with N2 lymph nodes.
  • treatment may include multiple cycles of cisplatin-based chemotherapy plus a 3rd generation cytotoxic agent or a cytostatic drug (anti-EGFR, anti-VEGFR).
  • Treatments for cancers, including lung cancers can include angiogenesis inhibitors, Epidermal growth factor receptor (EGFR) inhibitors, anaplastic lymphoma kinase (ALK) inhibitors, receptor tyrosine kinase ROS1 inhibitors and immune checkpoint inhibitors.
  • EGFR Epidermal growth factor receptor
  • ALK anaplastic lymphoma kinase
  • Angiogenesis inhibitors may include, but are not limited to, Axitinib (Inlyta),
  • Bevacizumab (Avastin), Cabozantinib (Cometriq), Everolimus (Afinitor, Zortress),
  • Epidermal growth factor receptor (EGFR) inhibitors may include, but are not limited to, gefitinib (Iressa), erlotinib (Tarceva), lapatinib (Tykerb), cetuximab (Erbitux), neratinib (Nerlynx), osimertinib (Tagrisso), panitumumab (Vectibix), vandetanib (Caprelsa), necitumumab (Protrazza) and dacomitinib (Vizimpro).
  • Immune checkpoint inhibitors may include, but are not limited to, Programmed Death 1 (PD-1) receptor (PD-1) binding agents (e.g. pembrolizumab, nivolumab, cimiplimab),
  • PD-1 receptor (PD-1) binding agents e.g. pembrolizumab, nivolumab, cimiplimab
  • P-L1 binding agents e.g., atezolizumab, avelumab, durvalumab
  • CTLA-4 binding agents e.g., ipilimumab
  • 0X40 or OX40L binding agents e.g., Adenosine A2A receptor binding agents, B7-H3 binding agents, B7-H4 binding agents, BTLA binding agents, Indoleamine 2,3 -dioxygenase binding agents, Killer-cell Immunoglobulin-like Receptor (KIR) binding agents, Lymphocyte Activation Gene-3 (LAG-3) binding agents, nicotinamide adenine dinucleotide phosphate NADPH oxidase isoform (NOX2) binding agents, T-cell Immunoglobulin domain and Mucin domain 3 (TIM-3) binding agents, V-domain Ig suppressor of T cell activation (VISTA) binding agents, Glucocorticoid-Induced TNFR family
  • Carcino-embryonic antigen is a glycoprotein involved in cell adhesion.
  • CEA was first identified in 1965 (Gold and Freedman, J Exp Med, 121, 439, 1965) as a protein normally expressed by fetal gut during the first six months of gestation, and found in cancers of the pan creas, liver and colon.
  • the CEA family belongs to the immunoglobulin superfamily.
  • the CEA family which consists of 18 genes, is sub-divided in two sub-groups of proteins: the carcinoem- bryonic antigen-related cell adhesion molecule (CEACAM) sub-group and the pregnancy- specific glycoprotein subgroup .
  • CEACAM carcinoem- bryonic antigen-related cell adhesion molecule
  • CEACAM sub-group consists of 7 members: CEACAMl, CEACAM3, CEACAM4, CEACAM5, CEACAM6, CEACAM7 and CEACAM8.
  • CEACAM5 identical to the originally identified CEA, is highly expressed on the surface of colorectal, gastric, lung, breast, prostate, ovary, cervix, and bladder tumor cells and weakly ex-pressed in few normal epithelial tissues such as columnar epithelial and goblet cells in colon, mucous neck cells in the stomach and squamous epithelial cells in esophagus and cervix.
  • CEA-CAM5 may constitute a therapeutic target suitable for tumor specific targeting approaches, such as immunoconjugates.
  • the present invention provides antibodies directed against CEACAM5 and shows that they can be conjugated to a cytotoxic agent using a linker in v/voand safely administered to subjects having NSQ NSCLC.
  • Data show that the hCEACAM5 expression in various lung cancer cells was a percent score greater than or equal to about 50, about 50 to about 80, or about 100 (consisting of 2+ and 3+ intensities).
  • the extracellular domains of CEACAM family members are composed of repeated immunoglobulin-like (Ig-like) domains which have been categorized in 3 types, A, B and N, according to sequence homolo gies.
  • CEACAM5 contains seven such domains, namely N, Al, Bl, A2, B2, A3 and B3.
  • CEACAM5 the A and B domains of human CEACAM6 protein display sequence homologies with Al and A3 domains, and any of Bl to B3 domains of human CEACAM5, respectively, which are even higher than observed among the A domains and the B domains of human CEA-CAM5.
  • CEACAM7 or CEA-CAM8, lacking specificity to CEACAM5.
  • the specificity of the anti- CEACAM5 antibody is desired in view of CEA-targeted therapies such that it binds to human CEACAM5 -expressing tumor cells but does not bind to some normal tissues expressing the others CEACAM members. It is noteworthy that CEACAMl, CEACAM6 and CEACAM8 have been described as expressed by neutrophils of human and non-human primates where they have been shown to regulate granulopoiesis and to play a role in immune response.
  • An anti-CEACAM6 antibody drug conjugate has been described, such as the may- tansinoid anti-CEACAM6 antibody developed by Genentech (Strickland et al, 2009 J Pathol, 218, 380), which has been shown to induce CEACAM6-dependent haematopoietic toxicity in non-human primates. This toxicity, attributed to accumulation of the antibody drug conjugate in bone marrow and depletion of granulocytes and their cell precursors, was considered by the au thors as a major safety concern.
  • cross-reactivity of an anti-CEACAM5 antibody with CEACAM1 , CEACAM6, CEACAM7, or CEACAM8 may de-crease the therapeutic index of the compound by increased toxicity on normal tissues.
  • ADC antibody drug conjugate
  • CEACAM5 is described to be expressed, although at low level, in some normal cell tissues, it is critical to develop anti-CEACAM5 antibodies capable of binding to hu man CEACAM5 as well as to cynomolgus monkey (Macaca fascicularis ) CEACAM5, as such antibodies may be readily tested in preclinical toxicological studies in cynomolgus monkeys to evaluate their safety profile. Since it has been shown that the efficiency of therapeutic antibodies may be dependent on the localization of the epitope in the target, both in the case of functional antibodies (Doern et al. 2009, J. Biol. Chem 284 10254) and in the case where effector functions are involved (Beers et al.
  • Macaca fascicularis CEACAM5 sequence was cloned and a global alignment of human and Macaca fascicularis A, B and N domains was performed. This alignment predicted that there are very few regions, if any, to localize an ideal epitope that would be common to human and macaque CEACAM5 and not shared with any other family member.
  • Anti-human CEACAM5 antibodies have already been used in clinical trials, such as Immunomedics labetuzumab (also known as hMN14, Sharkey et al, 1995, Cancer Research 55, 5935). This antibody has been shown not to bind to related antigens, but is not cross-reacting with CEACAM5 from Macaca fascicularis.
  • Micromet’s MT111 antibody also known as MEDI-565 antibody of Medlmmune
  • MT111 antibody is a bi-specific antibody binding to human CEA- CAM5 and human CD3 (Peng et al, PLoS ONE 7(5): e3641 ; WO 2007/071426).
  • MT111 is said to have been created by fusion of a single chain variable fragment (scFv) from an antibody that recognizes human and cynomolgus CEACAM5 with scFv from an antibody that recognize hu man CD3. It has also been reported that MT111 does not bind other CEACAM family members (Peng et al, PLoS ONE 7(5): e3641). MT111 binds to a conformational epitope in the A2 domain of human CEA-CAM5.
  • scFv single chain variable fragment
  • mice were immunized with recombinant proteins and with tumour cells. They have screened hundreds of hybridoma using ELISA on several recombinant proteins of the CEACAM family, and flow cytometry with relevant cell lines, in order to select only immunoglobulins (IgGs) with the advantageous profile. Unexpectedly, they were able to select hybridoma clones and produce corresponding mature IgGs that comprise all of the desired features. They specifically bind to the A3-B3 domain of human CEACAM5 with a high affinity and do not recognize human CEACAM1 , CEACAM6, CEACAM7 and CEACAM8 proteins. In a cellular context, these antibodies display high affinity for tumor cells (in the nano molar range). Moreover, these antibodies also bind to Macaca fascicularis CEACAM5 protein with a ratio of affinity monkey/human less than or equal to 10.
  • CEACAM5 By targeting the A3-B3 domain of CEACAM5, these antibodies have increased tumour targeting potential, as they have the capacity to bind both full-length human CEACAM5 and to its splice variant identified by Peng et al See Finally, CEACAM5 is described in literature as a poorly internalizing surface protein (reviewed in Schmidt et al, 2008, Cancer Immunol. Immunother. 57, 1879), and therefore may not be a favourable target for antibody drug conjugates. In spite of what has been reported in the prior art, the inventors have shown that the antibodies they have produced are able to internalize the CEACAM5 -antibody complex after binding, and to induce cytotoxic activity on tumor cells in vitro when combined to a cytotoxic agent. The same antibodies combined to a cytotoxic agent are also able to markedly inhibit tumor growth in mice bearing human primary colon and stomach tumors. See WO2014079886, which is incorporated herein in its entirety.
  • the term“about” in quantitative terms refers to plus or minus 10% of the value it modifies (rounded up to the nearest whole number if the value is not sub-dividable, such as a number of molecules or nucleotides).
  • the phrase“about 100 mg” would encompass 90 mg to 110 mg, inclusive; the phrase“about 2500 mg” would encompass 2250 mg to 2750 mg.
  • the term“about” refers to plus or minus 10% relative to that percentage.
  • the phrase“about 20%” would encompass 18-22% and“about 80%” would encompass 72-88%, inclusive.
  • a or “an” entity refers to one or more of that entity; for example, “a symptom,” is understood to represent one or more symptoms.
  • a symptom is understood to represent one or more symptoms.
  • the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
  • CEACAM5 designates the “carcinoembryonic antigen-related cell adhesion molecule 5”, also known as “CD66e” (Cluster of Differentiation 66e) or CEA.
  • CEACAM5 is a glycoprotein involved in cell adhesion.
  • CEACAM5 is highly expressed in particular on the surface of colorectal, gastric, lung and uterine tumor cells.
  • GenBank AAA51967.1 contains the major haplotype (180, V83, 1112, 1113 and E398).
  • A“domain” may be any region of a protein, generally defined on the basis of sequence homologies and often related to a specific structural or functional entity.
  • CEACAM family members are known to be composed of Ig-like domains.
  • the term domain is used in this document to designate either individual Ig-like domains, such as“N-domain” or for groups of consecutive domains, such as“A3-B3 domain”.
  • a Domain organisation of human CEACAM5 is as follows (based on GenBank AAA51967.1 ; SEQ ID NO: 13):
  • the A3-B3 domain of human CEACAM5 consists of amino acids at positions 499-685 of SEQ ID NO: 13.
  • Macaca fascicularis CEACAM5 consists of amino acids at positions 465-654 of SEQ ID NO:53.
  • a "coding sequence” or a sequence “encoding” an expression product, such as a RNA, polypeptide, protein, or enzyme is a nucleotide sequence that, when expressed, results in the production of that RNA, polypeptide, protein, or enzyme, i.e., the nucleotide sequence encodes an amino acid sequence for that polypeptide, protein or enzyme.
  • a coding sequence for a protein may include a start codon (usually ATG) and a stop codon.
  • references to specific proteins can include a polypeptide having a native amino acid sequence, as well as variants and modified forms regardless of their origin or mode of preparation.
  • a protein which has a native amino acid sequence is a protein having the same amino acid sequence as obtained from nature.
  • Such native sequence proteins can be isolated from nature or can be prepared using standard recombinant and/or synthetic methods.
  • Native sequence proteins specifically encompass naturally occurring truncated or soluble forms, naturally occurring variant forms (e.g., alternatively spliced forms), naturally occurring allelic variants and forms including post-translational modifications.
  • Native sequence proteins include proteins carrying post-translational modifications such as glycosylation, or phosphorylation, or other modifications of some amino acid residues.
  • gene means a DNA sequence that codes for, or corresponds to, a particular sequence of amino acids which comprises all or part of one or more proteins or enzymes, and may or may not include regulatory DNA sequences, such as promoter sequences, which determine for example the conditions under which the gene is expressed. Some genes, which are not structural genes, may be transcribed from DNA to RNA, but are not translated into an amino acid sequence. Other genes may function as regulators of structural genes or as regulators of DNA transcription. In particular, the term gene may be intended for the genomic sequence encoding a protein, i.e. a sequence comprising regulator, promoter, intron and exon sequences.
  • a percentage of“sequence identity” may be determined by comparing the two sequences, optimally aligned over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
  • the percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
  • Optimal alignment of sequences for comparison is conducted by global pairwise alignment, e.g.
  • a “conservative amino acid substitution” is one in which an amino acid residue is substituted by another amino acid residue having a side chain R group with similar chemical properties (e.g., charge, size or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein.
  • Examples of groups of amino acids that have side chains with similar chemical properties include 1) aliphatic side chains: glycine, alanine, valine, leucine, and isoleucine; 2) aliphatic-hydroxyl side chains: serine and threonine; 3) amide-containing side chains: asparagine and glutamine; 4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; 5) basic side chains: lysine, arginine, and histidine; 6) acidic side chains: aspartic acid and glutamic acid; and 7) sulfur-containing side chains: cysteine and methionine.
  • Conservative amino acids substitution groups can also be defined on the basis of amino acid size
  • the present disclosure includes methods that comprise administering to a subject an antibody, or an antigen-binding fragment thereof, that binds specifically to CEACAM5.
  • hCEACAM5 means a human cytokine receptor that specifically binds human CEACAM5.
  • the antibody that is administered to the patient binds specifically to at least one domain of hCEACAM5.
  • CEACAM5 protein and which do not significantly cross-react with human CEACAM1, CEACAM6, CEACAM7 and CEACAM8 proteins, and with Macaca fascicularis CEACAM1 , CEACAM6 and CEACAM8 proteins.
  • the so-called“antibody MAbl” comprises:
  • variable domain of heavy chain consisting of sequence
  • EVMLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVATISSGGSYI YYLDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARPAYYGNPAMDYWGQGTS VTVSS (SEQ ID NO: 14, with CDRs shown in bold characters) in which FR1-H spans amino acid positions 1 to 25, CDR1-H spans amino acid positions 26 to 33, FR2-H spans amino acid positions 34 to 50, CDR2-H spans amino acid positions 51 to 58, FR3-H spans amino acid positions 59 to 96, CDR3-H spans amino acid positions 97 to 109, and FR4-H spans amino acid positions 110 to 120, and
  • variable domain of light chain consisting of sequence
  • FR1-L spans amino acid positions 1 to 26
  • CDR1-L spans amino acid positions 27 to 32
  • FR2-L spans amino acid positions 33 to 49
  • CDR2-L spans amino acid positions 50 to 52
  • FR3-L spans amino acid positions 53 to 88
  • CDR3-L spans amino acid positions 89 to 98
  • FR4-L spans amino acid positions 99 to 108.
  • the so-called“antibody MAb2” comprises:
  • variable domain of heavy chain consisting of sequence
  • VTVSA (SEQ ID NO: 16, with CDRs shown in bold characters) in which FR1-H spans amino acid positions 1 to 25, CDR1 -H spans amino acid positions 26 to 33, FR2-H spans amino acid positions 34 to 50, CDR2-H spans amino acid positions 51 to 58, FR3-H spans amino acid positions 59 to 96, CDR3-H spans amino acid positions 97 to 109, and FR4-H spans amino acid positions 1 10 to 120, and
  • variable domain of light chain consisting of sequence
  • a variant of antibody MAb2 was also generated by introducing a K52R substitution in the CDR2-L.
  • This variant which is called herein“Mab2K52R”, has essentially the same affinity for human and Macaca fascicularis CEACAM5 as MAb2.
  • the so-called“antibody MAb3” comprises:
  • variable domain of heavy chain consisting of sequence
  • variable domain of light chain consisting of sequence
  • the so-called“antibody MAb4” comprises:
  • variable domain of heavy chain consisting of sequence
  • VTVSA (SEQ ID NO:20, with CDRs shown in bold characters) in which FR1-H spans amino acid positions 1 to 25, CDR1-H spans amino acid positions 26 to 33, FR2-H spans amino acid positions 34 to 50, CDR2-H spans amino acid positions 51 to 58, FR3-H spans amino acid positions 59 to 96, CDR3-H spans amino acid positions 97 to 109, and FR4-H spans amino acid positions 110 to 120, and
  • variable domain of light chain consisting of sequence
  • the so-called“antibody MAb5” comprises:
  • variable domain of heavy chain consisting of sequence
  • ELQLVESGGVLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVTYINSGGGIT YYPDTVKGRFTISRDNARNTLYLQMSSLKSEDTAIYYCTAHYFGSSGPFAYWGQGTLV TVSA (SEQ ID NO:22, with CDRs shown in bold characters) in which FR1-H spans amino acid positions 1 to 25, CDR1-H spans amino acid positions 26 to 33, FR2-H spans amino acid positions 34 to 50, CDR2-H spans amino acid positions 51 to 58, FR3-H spans amino acid positions 59 to 96, CDR3-H spans amino acid positions 97 to 109, and FR4-H spans amino acid positions 110 to 120, and
  • variable domain of light chain consisting of sequence
  • the antibody of the invention is antibody huMAb2-3 or a variant thereof, i.e. an isolated antibody which binds to A3- B3 domain of human and Macaca fascicularis CEACAM5 proteins and which comprises:
  • a light chain consisting of sequence SEQ ID NO: 9 or a sequence at least 85% identical thereto or a heavy chain and a light chain.
  • the invention relates to an antibody which binds to human and Macaca fascicularis CEACAM5.
  • the antibody of the invention binds to the A3-B3 domains of human and Macaca fascicularis CEACAM5. More specifically, the antibody can bind to the human and Macaca fascicularis A3-B3 domains indifferently whether expressed in isolated form, or present in a soluble extracellular domain or membrane-anchored full-length CEACAM5 protein.
  • the specificity of the antibodies for the A3-B3 domain of human CEACAM5 is advantageous as no SNP with a frequency higher than 2% in Caucasian population was reported in this domain, which minimizes the risk that the antibodies’ epitope(s) on CEACAM5 be altered in part of the population.
  • the antibody according to the invention is specific for the surface human and Macaca fascicularis CEACAM5 proteins.
  • the antibody of the invention does not bind to, or does not significantly cross-react with human CEACAMl, human CEAC AM6, human CEACAM7, human CEAC AM8, Macaca fascicularis CEACAMl , Macaca fascicularis CEACAM6 and Macaca fascicularis CEACAM8 proteins.
  • the antibody does not bind to, or does not significantly cross- react with the extracellular domain of the aformentionned human and Macaca fascicularis CEAC AM proteins.
  • Human CEACAMl full-length protein is available in GenBank database under accession number NP 001703.2.
  • the extracellular domain of human CEACAMl consists of amino acids at positions 35-428 of this protein.
  • Human CEACAM6 full-length protein is available in GenBank database under accession number NP 002474.3.
  • the extracellular domain of human CEACAM6 consists of amino acids at positions 35-327 of this protein.
  • Human CEACAM7 full-length protein is available in GenBank database under accession number NP 008821.1.
  • the extracellular domain of human CEACAM7 consists of amino acids at positions 36-248 of this protein.
  • Human CEACAM8 full-length protein is available in GenBank database under accession number NP 001807.2.
  • the extracellular domain of human CEACAM8 consists of amino acids at positions 35-332 of this protein.
  • M. fascicularis CEACAM1 extracellular domain consists of amino acids at positions 35- 428 of full-length protein, i.e. amino acids 1-394 of the protein.
  • M. fascicularis CEACAM6 extracellular domain consists of amino acids at positions 35- 327 of full-length protein, i.e. amino acids 1-293 the protein.
  • M. fascicularis CEACAM8 extracellular domain consists of amino acids at positions 35- 332 of full-length protein, i.e. amino acids 1-298 of the protein.
  • antibody refers to immunoglobulin molecules comprising four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as multimers thereof (e.g ., IgM).
  • Each heavy chain comprises a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
  • the heavy chain constant region comprises three domains, CHI, CH2 and CH3.
  • Each light chain comprises a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
  • the light chain constant region comprises one domain (CL1).
  • the VH and VL regions can be further subdivided into regions of hypervariability, termed
  • CDRs complementarity determining regions
  • FR framework regions
  • the FRs of the antibody may be identical to the human germline sequences, or may be naturally or artificially modified.
  • An amino acid consensus sequence may be defined based on a side-by-side analysis of two or more CDRs.
  • antibody also includes antigen-binding fragments of full antibody molecules.
  • antigen-binding portion of an antibody, “antigen-binding fragment” of an antibody, and the like, as used herein, include any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex.
  • Antigen-binding fragments of an antibody may be derived, e.g., from full antibody molecules using any suitable standard techniques such as proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antibody variable and optionally constant domains.
  • DNA is known and/or is readily available from, e.g, commercial sources, DNA libraries (including, e.g, phage-antibody libraries), or can be synthesized.
  • the DNA may be sequenced and manipulated chemically or by using molecular biology techniques, for example, to arrange one or more variable and/or constant domains into a suitable configuration, or to introduce codons, create cysteine residues, modify, add or delete amino acids, etc.
  • Non-limiting examples of antigen-binding fragments include: (i) Fab fragments; (ii) F(ab')2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single-chain Fv (scFv) molecules; (vi) dAb fragments; and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g, an isolated complementarity determining region (CDR) such as a CDR3 peptide, or a constrained FR3-CDR3-FR4 peptide.
  • CDR complementarity determining region
  • engineered molecules such as domain-specific antibodies, single domain antibodies, domain- deleted antibodies, chimeric antibodies, CDR-grafted antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g, monovalent nanobodies, and bivalent nanobodies), small modular immunopharmaceuticals (SMIPs), and shark variable IgNAR domains, are also encompassed within the expression "antigen-binding fragment," as used herein.
  • an antigen-binding fragment of an antibody will typically comprise at least one variable domain.
  • the variable domain may be of any size or amino acid composition and will generally comprise at least one CDR which is adjacent to or in frame with one or more framework sequences.
  • the VH and VL domains may be situated relative to one another in any suitable arrangement.
  • the variable region may be dimeric and contain VH-VH, VH-VL or VL-VL dimers.
  • the antigen-binding fragment of an antibody may contain a monomeric VH or VL domain.
  • an antigen-binding fragment of an antibody may contain at least one variable domain covalently linked to at least one constant domain.
  • variable and constant domains that may be found within an antigen-binding fragment of an antibody include: (i) VH-CHl; (ii) VH-CH2; (iii) VH-CH3; (iv) VH-CH1-CH2; (v) VH-CHl -CH2-CH3; (vi) VH-CH2-CH3; (vn) VH-CL; (vm) VL-CH1; (IX) VL-CH2; (x) VL- CH3; (xi) VL-CH1-CH2; (xn) VH-CHl -CH2-CH3; (xm) VL-CH2-CH3; and (xiv) VL-CL.
  • variable and constant domains including any of the exemplary
  • variable and constant domains may be either directly linked to one another or may be linked by a full or partial hinge or linker region.
  • a hinge region may in various embodiments consist of at least 2 ( e.g ., 5, 10, 15, 20, 40, 60 or more) amino acids which result in a flexible or semi-flexible linkage between adjacent variable and/or constant domains in a single polypeptide molecule.
  • an antigen-binding fragment of an antibody may in various embodiments comprise a homo-dimer or hetero-dimer (or other multimer) of any of the variable and constant domain configurations listed above in non-covalent association with one another and/or with one or more monomeric VH or VL domain (e.g., by disulfide bond(s)).
  • the antibody or antibody fragment for use in the method of the invention may be a multispecific antibody, which may be specific for different epitopes of one target polypeptide or may contain antigen-binding domains specific for epitopes of more than one target polypeptide.
  • An exemplary bi-specific antibody format that can be used in the context of the present invention involves the use of a first immunoglobulin (Ig) C H 3 domain and a second Ig CH3 domain, wherein the first and second Ig CH3 domains differ from one another by at least one amino acid, and wherein at least one amino acid difference reduces binding of the bispecific antibody to Protein A as compared to a bi-specific antibody lacking the amino acid difference.
  • Ig immunoglobulin
  • the first Ig CH3 domain binds Protein A and the second Ig CH3 domain contains a mutation that reduces or abolishes Protein A binding such as an H95R modification (by IMGT exon numbering; H435R by EU numbering).
  • the second CH3 may further comprise an Y96F modification (by IMGT; Y436F by EU).
  • bispecific antibody format described above are contemplated within the scope of the present invention. Any multispecific antibody format, including the exemplary bispecific antibody formats disclosed herein, may in various embodiments be adapted for use in the context of an antigen-binding fragment of an anti-CEACAM5 antibody using routine techniques available in the art.
  • the CEACAM5 antibodies disclosed herein may comprise one or more amino acid substitutions, insertions and/or deletions in the framework and/or CDR regions of the heavy and light chain variable domains as compared to the corresponding germline sequences. Such mutations can be readily ascertained by comparing the amino acid sequences disclosed herein to germline sequences available from, for example, public antibody sequence databases.
  • the present invention includes antibodies, and antigen-binding fragments thereof, which are derived from any of the amino acid sequences disclosed herein, wherein one or more amino acids within one or more framework and/or CDR regions are back-mutated to the corresponding germline residue(s) or to a conservative amino acid substitution (natural or non-natural) of the
  • germline back-mutations such sequence changes are referred to herein as "germline back-mutations").
  • a person of ordinary skill in the art starting with the heavy and light chain variable region sequences disclosed herein, can easily produce numerous antibodies and antigen binding fragments which comprise one or more individual germline back-mutations or combinations thereof.
  • all of the framework residues and/or CDR residues within the VH and/or VL domains are mutated back to the germline sequence.
  • the antibodies of the present invention may contain any combination of two or more germline back- mutations within the framework and/or CDR regions, i.e., wherein certain individual residues are mutated back to the germline sequence while certain other residues that differ from the germline sequence are maintained.
  • antibodies and antigen-binding fragments that contain one or more germline back-mutations can be easily tested for one or more desired property such as, improved binding specificity, increased binding affinity, improved or enhanced antagonistic or agonistic biological properties (as the case may be), reduced immunogenicity, etc.
  • Antibodies and antigen-binding fragments obtained in this general manner are encompassed within the present invention.
  • the constant region of an antibody is important in the ability of an antibody to fix complement and mediate cell-dependent cytotoxicity.
  • the isotype of an antibody may be selected on the basis of whether it is desirable for the antibody to mediate cytotoxicity.
  • human antibody is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
  • the human antibodies featured in the disclosure may in various embodiments nonetheless include amino acid residues not encoded by human germline immunoglobulin sequences (e.g ., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in some embodiments CDR3.
  • the term "human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • recombinant human antibody is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell
  • antibodies isolated from a recombinant, combinatorial human antibody library (described further below), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor et al, (1992) Nucl. Acids Res. 20:6287-6295, incorporated herein by reference in its entirety,) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human
  • Such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VH sequences, may not naturally exist within the human antibody germline repertoire in vivo.
  • an immunoglobulin molecule comprises a stable four chain construct of approximately 150-160 kDa in which the dimers are held together by an interchain heavy chain disulfide bond.
  • the dimers are not linked via inter-chain disulfide bonds and a molecule of about 75-80 kDa is formed composed of a covalently coupled light and heavy chain (half-antibody).
  • humanised antibody or“humanized antibody” refers to an antibody which is wholly or partially of non-human origin and which has been modified to replace certain amino acids, for instance in the framework regions of the VH and VL domains, in order to avoid or minimize an immune response in humans.
  • the constant domains of a humanized antibody are most of the time human CH and CL domains.
  • CDR grafting or antibody reshaping, which involves grafting of the CDR sequences of a donor antibody, generally a mouse antibody, into the framework scaffold of a human antibody of different specificity. Since CDR grafting may reduce the binding specificity and affinity, and thus the biological activity, of a CDR grafted non-human antibody, back mutations may be introduced at selected positions of the CDR grafted antibody in order to retain the binding specificity and affinity of the parent antibody.
  • Amino acid residues that are candidates for back mutations are typically those that are located at the surface of an antibody molecule, while residues that are buried or that have a low degree of surface exposure will not normally be altered.
  • An alternative humanization technique to CDR grafting and back mutation is resurfacing, in which non-surface exposed residues of non human origin are retained, while surface residues are altered to human residues.
  • Another alternative technique is known as“guided selection” (Jespers et al. (1994) Biotechnology 12,
  • the frequency of appearance of the second form in various intact IgG isotypes is due to, but not limited to, structural differences associated with the hinge region isotype of the antibody.
  • a single amino acid substitution in the hinge region of the human IgG4 hinge can significantly reduce the appearance of the second form (Angal et al, (1993) Molecular Immunology 30: 105, incorporated by reference in its entirety) to levels typically observed using a human IgGl hinge.
  • the instant disclosure encompasses in various embodiments antibodies having one or more mutations in the hinge, CH2 or CH3 region which may be desirable, for example, in production, to improve the yield of the desired antibody form.
  • an “isolated antibody,” as used herein, means an antibody that has been identified and separated and/or recovered from at least one component of its natural environment.
  • an antibody that has been separated or removed from at least one component of an organism, or from a tissue or cell in which the antibody naturally exists or is naturally produced is an antibody that has been separated or removed from at least one component of an organism, or from a tissue or cell in which the antibody naturally exists or is naturally produced.
  • isolated antibody in various embodiments, the isolated antibody also includes an antibody in situ within a recombinant cell. In other embodiments, isolated antibodies are antibodies that have been subjected to at least one purification or isolation step. In various embodiments, an isolated antibody may be substantially free of other cellular material and/or chemicals.
  • the term "specifically binds,” or the like, means that an antibody or antigen-binding fragment thereof forms a complex with an antigen that is relatively stable under physiologic conditions.
  • Methods for determining whether an antibody specifically binds to an antigen are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, and the like.
  • an antibody that "specifically binds" CEACAM5 includes antibodies that bind CEACAM5 or portion thereof with a KD of less than about 1000 nM, less than about 500 nM, less than about 300 nM, less than about 200 nM, less than about 100 nM, less than about 90 nM, less than about 80 nM, less than about 70 nM, less than about 60 nM, less than about 50 nM, less than about 40 nM, less than about 30 nM, less than about 20 nM, less than about 10 nM, less than about 5 nM, less than about 4 nM, less than about 3 nM, less than about 2 nM, less than about 1 nM or about 0.5 nM, as measured in a surface plasmon resonance assay.
  • Specific binding can also be characterized by a dissociation constant of at least about lxl 0 6 M or smaller. In other embodiments, the dissociation constant is at least about lxl 0 7 M, lxl 0 8 M, or lxl 0 9 M.
  • CEACAM5 may, however, have cross-reactivity to other antigens, such as CEACAM5 molecules from other (non-human) species.
  • surface plasmon resonance refers to an optical phenomenon that allows for the analysis of real-time interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIACORE system (Biacore Life Sciences division of GE Healthcare, Piscataway, NJ).
  • KD is intended to refer to the equilibrium dissociation constant of an antibody-antigen interaction.
  • “Affinity” is defined, in theory, by the equilibrium association between the whole antibody and the antigen. It can be experimentally assessed by a variety of known methods, such as measuring association and dissociation rates with surface plasmon resonance or measuring the EC50 (or apparent KD) in an immunochemical assay (ELISA, FACS).
  • ELISA immunochemical assay
  • FACS Fluorescence Activated Cell Sorting
  • a monoclonal antibody binding to antigen l(Agl) is“cross-reactive” to antigen 2 (Ag2) when the EC50s are in a similar range for both antigens.
  • a monoclonal antibody binding to Agl is cross-reactive to Ag2 when the ratio of affinity of Ag2 to affinity of Agl is equal or less than 10 (for instance 5, 2, 1 or 0.5), affinities being measured with the same method for both antigens.
  • Affinity for human CEACAM5 or for Macaca fascicularis CEACAM5 may be determined as the EC50 value in an ELISA using soluble recombinant CEACAM5 as capture antigen.
  • the antibody of the invention may also have an apparent dissociation constant (apparent KD), as may be determined by FACS analysis on tumor cell line MKN45 (DSMZ, ACC 409) or on xenograft tumor cells deriving from patient (CR-IGR-034P available from Oncodesign Biotechnology, tumor collection CReMEC), which is ⁇ 25nM, for instance ⁇ 20nM, ⁇ 10nM, ⁇ 5nM, ⁇ 3nM or ⁇ lnM.
  • the apparent KD may be within the range 0.01-20 nM, or may be within the range 0.1-20nM, 0.1-lOnM, or 0.1 -5nM.
  • antibodies according to the invention have been shown to be able to detect CEACAM5 expression by immunohistochemistry in frozen and formalin-fixed and paraffin embedded (FFPE) tissue sections.
  • FFPE paraffin embedded
  • epitope refers to an antigenic determinant that interacts with a specific antigen binding site in the variable region of an antibody molecule known as a paratope.
  • a single antigen may have more than one epitope. Thus, different antibodies may bind to different areas on an antigen and may have different biological effects.
  • Epitopes may be either conformational or linear.
  • a conformational epitope is produced by spatially juxtaposed amino acids from different segments of the linear polypeptide chain.
  • a linear epitope is one produced by adjacent amino acid residues in a polypeptide chain.
  • an epitope may include moieties of saccharides, phosphoryl groups, or sulfonyl groups on the antigen.
  • the anti- CEACAM5 antibodies useful for the methods described herein may in various embodiments include one or more amino acid substitutions, insertions and/or deletions in the framework and/or CDR regions of the heavy and light chain variable domains as compared to the corresponding germline sequences from which the antibodies were derived. Such mutations can be readily ascertained by comparing the amino acid sequences disclosed herein to germline sequences available from, for example, public antibody sequence databases.
  • the present disclosure includes in various embodiments methods involving the use of antibodies, and antigen-binding fragments thereof, which are derived from any of the amino acid sequences disclosed herein, wherein one or more amino acids within one or more framework and/or CDR regions are mutated to the corresponding residue(s) of the germline sequence from which the antibody was derived, or to the corresponding residue(s) of another human germline sequence, or to a conservative amino acid substitution of the corresponding germline residue(s) (such sequence changes are referred to herein collectively as "germline mutations").
  • Numerous antibodies and antigen-binding fragments may be constructed which comprise one or more individual germline mutations or combinations thereof.
  • all of the framework and/or CDR residues within the VH and/or VL domains are mutated back to the residues found in the original germline sequence from which the antibody was derived.
  • only certain residues are mutated back to the original germline sequence, e.g., only the mutated residues found within the first 8 amino acids of FR1 or within the last 8 amino acids of FR4, or only the mutated residues found within CDR1, CDR2 or CDR3.
  • one or more of the framework and/or CDR residue(s) are mutated to the corresponding residue(s) of a different germline sequence (i.e., a germline sequence that is different from the germline sequence from which the antibody was originally derived).
  • the antibodies may contain any combination of two or more germline mutations within the framework and/or CDR regions, e.g., wherein certain individual residues are mutated to the corresponding residue of a certain germline sequence while certain other residues that differ from the original germline sequence are maintained or are mutated to the corresponding residue of a different germline sequence.
  • antibodies and antigen-binding fragments that contain one or more germline mutations can be easily tested for one or more desired property such as, improved binding specificity, increased binding affinity, improved or enhanced antagonistic or agonistic biological properties (as the case may be), reduced immunogenicity, etc.
  • the use of antibodies and antigen-binding fragments obtained in this general manner are encompassed within the present disclosure.
  • the present disclosure also includes methods involving the use of anti-CEACAM5 antibodies comprising variants of any of the HCVR, LCVR, and/or CDR amino acid sequences disclosed herein having one or more conservative substitutions.
  • the present disclosure includes the use of anti- CEACAM5 antibodies having HCVR, LCVR, and/or CDR amino acid sequences with, e.g., 10 or fewer, 8 or fewer, 6 or fewer, 4 or fewer, etc. conservative amino acid substitutions relative to any of the HCVR, LCVR, and/or CDR amino acid sequences disclosed herein.
  • the anti-CEACAM5 antibody in various embodiments comprises a heavy chain variable region (HCVR), light chain variable region (LCVR), and/or complementarity determining regions (CDRs) comprising any of the amino acid sequences of the anti-CEACAM5 antibodies described in Inti. Patent Pub. No. WO 2014/079886 Al, incorporated herein by reference in its entirety.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • CDRs complementarity determining regions
  • Amino acid sequence modification(s) of the antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody. It is known that when a humanised antibody is produced by simply grafting only CDRs in VH and VL of an antibody derived from a non-human animal in FRs of the VH and VL of a human antibody, the antigen binding activity may be reduced in comparison with that of the original antibody derived from a non-human animal. It is considered that several amino acid residues of the VH and VL of the non-human antibody, not only in CDRs but also in FRs, may be directly or indirectly associated with the antigen binding activity.
  • substitution of these amino acid residues with different amino acid residues derived from FRs of the VH and VL of the human antibody would reduce the binding activity.
  • the reduced antigen binding activity could be increased by replacing the identified amino acids with amino acid residues of the original antibody derived from a non-human animal.
  • a further object of the present invention also encompasses function-conservative variants of the polypeptides of the present invention.
  • certain amino acids may be substituted by other amino acids in a protein structure without appreciable loss of activity. Since the interactive capacity and nature of a protein define its biological functional activity, certain amino acid substitutions can be made in a protein sequence, and of course in its DNA encoding sequence, while nevertheless obtaining a protein with like properties. It is thus contemplated that various changes may be made in the antibodies sequences of the invention, or corresponding DNA sequences which encode said polypeptides, without appreciable loss of their biological activity.
  • Neutral positions can be seen as positions where any amino acid substitution could be incorporated to the antibodies. Indeed, in the principle of alanine-scanning, alanine is chosen since it this residue does not carry specific structural or chemical features. It is generally admitted that if an alanine can be substituted for a specific amino acid without changing the properties of a protein, many other, if not all amino acid substitutions are likely to be also neutral. In the opposite case where alanine is the wild-type amino acid, if a specific substitution can be shown as neutral, it is likely that other substitutions would also be neutral.
  • amino acid substitutions are generally therefore based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
  • Exemplary substitutions which take any of the foregoing characteristics into consideration are well known to those of skill in the art and include: arginine and lysine;
  • glutamate and aspartate glutamate and aspartate
  • serine and threonine glutamine and asparagine
  • valine leucine and isoleucine
  • ADCC antigen-dependent cell-mediated cytotoxicity
  • CDC complement dependent cytotoxicity
  • This may be achieved by introducing one or more amino acid substitutions in an Fc region of the antibody.
  • cysteine residue(s) may be introduced in the Fc region, thereby allowing inter-chain disulfide bond formation in this region.
  • the homodimeric antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and/or antibody-dependent cellular cytotoxicity (ADCC) (Caron PC. et al. 1992; and Shopes B. 1992).
  • Another type of amino acid modification of the antibody of the invention may be useful for altering the original glycosylation pattern of the antibody, i.e. by deleting one or more carbohydrate moieties found in the antibody, and/or adding one or more glycosylation sites that are not present in the antibody.
  • Addition or deletion of glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above- described tripeptide sequences (for N-linked glycosylation sites).
  • Another type of modification involves the removal of sequences identified, either in silico or experimentally, as potentially resulting in degradation products or heterogeneity of antibody preparations.
  • deamidation of asparagine and glutamine residues can occur depending on factors such as pH and surface exposure.
  • Asparagine residues are particularly susceptible to deamidation, primarily when present in the sequence Asn-Gly, and to a lesser extent in other dipeptide sequences such as Asn-Ala.
  • substitutions in a sequence to remove one or more of the implicated residues are also intended to be encompassed by the present invention.
  • the sugar(s) may be attached to (a) arginine and histidine, (b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d) free hydroxyl groups such as those of serine, threonine, orhydroxyproline, (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide group of glutamine.
  • arginine and histidine (b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d) free hydroxyl groups such as those of serine, threonine, orhydroxyproline, (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide group of glutamine.
  • free carboxyl groups such as those of cysteine
  • free sulfhydryl groups such as those of cyste
  • Removal of any carbohydrate moieties present on the antibody may be accomplished chemically or enzymatically.
  • Chemical deglycosylation requires exposure of the antibody to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N- acetylgalactosamine), while leaving the antibody intact.
  • Chemical deglycosylation is described by Sojahr H. et al. (1987) and by Edge, AS. et al. (1981).
  • Enzymatic cleavage of carbohydrate moieties on antibodies can be achieved by the use of a variety of endo-and exo-glycosidases as described by Thotakura, NR. et al. (1987).
  • Another type of covalent modification of the antibody comprises linking the antibody to one of a variety of non-proteinaceous polymers, e.g., polyethylene glycol, polypropylene glycol, or polyoxyalkylenes, in the manner set forth in CIS Patent Nos. 4,640, 835; 4,496, 689; 4,301, 144; 4,670, 417; 4,791, 192 or 4,179,337.
  • non-proteinaceous polymers e.g., polyethylene glycol, polypropylene glycol, or polyoxyalkylenes
  • the antibody of the invention is antibody huMAb2-3 or a variant thereof.
  • the different amino acid sequences for the huMAb2-3 antibody are shown below in SEQ ID NOs: 1-9.
  • the heavy chain variable domain amino acid sequence of SEQ ID NO: 1 is
  • the light chain variable domain amino acid sequence of SEQ ID NO: 2 is DIQMTQ SP ASLS AS V GDRVTTTCRASENIF S YLAWY Q QKPGKSPKLL VYNTRTL A EGVPSRF S GS GS GTDF SLTI S SLQPEDF AT YY CQHHY GTPFTF GS GTKLEIK.
  • amino acid sequence of SEQ ID NO: 3 is GFVFSSYD.
  • amino acid sequence of SEQ ID NO: 4 is ISSGGGIT.
  • amino acid sequence of SEQ ID NO: 5 is AAHYFGSSGPFAY.
  • amino acid sequence of SEQ ID NO: 6 is ENIFSY.
  • the amino acid sequence of light chain CDR2 is NTR.
  • amino acid sequence of SEQ ID NO: 7 is QHHYGTPFT.
  • the heavy chain amino acid sequence of SEQ ID NO: 8 is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl
  • the light chain amino acid sequence of SEQ ID NO: 9 is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl
  • the antibodies disclosed herein bind to an epitope of the A3-B3 domain of human CEACAM5 protein.
  • the amino acid sequences of the A3-B3 domain epitopes bound by antibodies of the disclosure include SGANLNL (SEQ ID NO: 10), and INGIPQQHTQVLF (SEQ ID NO: 11).
  • bioequivalent refers to a molecule having similar bioavailability (rate and extent of availability) after administration at the same molar dose and under similar conditions ( e.g ., same route of administration), such that the effect, with respect to both efficacy and safety, can be expected to be essentially same as the comparator molecule.
  • compositions comprising an anti-CEACAM5 antibody, or an
  • immunoconjugate comprising the antibody, are bioequivalent if they are pharmaceutically equivalent, meaning they contain the same amount of active ingredient, in the same dosage form, for the same route of administration and meeting the same or comparable standards.
  • the disclosure in certain embodiments relates to methods comprising administering to the subject an antibody which comprises the heavy chain variable region comprising sequence SEQ ID NO: 1 and the light chain variable region comprising sequence SEQ ID NO: 2.
  • compositions comprising such antibody, and methods of using these compositions.
  • the antibody in various embodiments comprises the CDRs in the heavy chain variable region/domain of SEQ ID NO: 1 and the CDRs in light chain variable region/domain of SEQ ID NO: 2.
  • the antibody in various embodiments comprises the heavy chain variable region comprising sequence SEQ ID NO: 1 and the light chain variable region comprising sequence SEQ ID NO: 2 is an antibody that specifically binds CEACAM5. See international publication number WO 2014/079886 Al, incorporated herein by reference in its entirety.
  • the antibody comprises the heavy chain variable region comprising sequence SEQ ID NO: 8 and the light chain variable region comprising sequence SEQ ID NO: 9.
  • the present invention also includes cytotoxic conjugates, or immunoconjugates, or antibody-drug conjugates, or conjugates. As used herein, all these terms have the same meaning and are interchangeable.
  • the invention relates to“immunoconjugates” comprising an antibody of the invention linked or conjugated to at least one growth inhibitory agent, such as a cytotoxic agent or a radioactive isotope.
  • growth inhibitory agent such as a cytotoxic agent or a radioactive isotope.
  • cytotoxic agent refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells.
  • cytotoxic agent is intended to include chemotherapeutic agents, enzymes, antibiotics, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof, and the various antitumor or anti cancer agents disclosed below.
  • the cytotoxic agent is a taxoid, vincas, a maytansinoid or maytansinoid analog such as DM1 or DM4, a small drug, a tomaymycin or pyrrolobenzodiazepine derivative, a cryptophycin derivative, a leptomycin derivative, an auristatin or dolastatin analog, a prodrug, topoisomerase II inhibitors, a DNA alkylating agent, an anti -tubulin agent, a CC-1065 or CC- 1065 analog.
  • maytansinoids denotes maytansinoids and maytansinoid analogs.
  • Maytansinoids are drugs that inhibit microtubule formation and that are highly toxic to mammalian cells.
  • Examples of suitable maytansinoids include maytansinol and maytansinol analogs.
  • suitable maytansinol analogues include those having a modified aromatic ring and those having modifications at other positions.
  • suitable maytansinoids are disclosed in U.S. Patent Nos. 4,424,219; 4,256,746; 4,294,757; 4,307,016; 4,313,946; 4,315,929; 4,331,598; 4,361,650; 4,362,663; 4,364,866; 4,450,254; 4,322,348; 4,371,533; 6,333,410; 5,475,092; 5,585,499; and 5,846,545.
  • Suitable analogues of maytansinol having a modified aromatic ring include:
  • the cytotoxic conjugates of the present invention utilize the thiol-containing maytansinoid (DM1), formally termed N 2 -deacetyl -/V 2 -(3-mercapto- l-oxopropyl)-maytansine, as the cytotoxic agent.
  • DM1 is represented by the following structural formula (I):
  • the cytotoxic conjugates of the present invention utilize the thiol- containing maytansinoid DM4, formally termed N 2 -deacetyl-N- 2 (4-methyl-4-mercapto-l- oxopentyl)-maytansine, as the cytotoxic agent.
  • DM4 is represented by the following structural formula (II):
  • maytansines including thiol and disulfide- containing maytansinoids bearing a mono or di-alkyl substitution on the carbon atom bearing the sulfur atom
  • maytansines including thiol and disulfide- containing maytansinoids bearing a mono or di-alkyl substitution on the carbon atom bearing the sulfur atom
  • maytansines including thiol and disulfide- containing maytansinoids bearing a mono or di-alkyl substitution on the carbon atom bearing the sulfur atom
  • These include a maytansinoid having, at C-3, C-14 hydroxymethyl, C-15 hydroxy, or C-20 desmethyl, an acylated amino acid side chain with an acyl group bearing a hindered sulfhydryl group, wherein the carbon atom of the acyl group bearing the thiol functionality has one or two substituents, said substituents being CH3, C2H5, linear or branched alkyl or alkenyl having from 1 to 10
  • radioactive isotope is intended to include radioactive isotopes suitable for
  • radioactive isotopes of Lu Such radioisotopes generally emit mainly beta-radiation.
  • the radioactive isotope is alpha-emitter isotope, more precisely Thorium 227 which emits alpha-radiation.
  • the immunoconjugates according to the present invention can be prepared as described in the application W02004/091668.
  • the antibodies of the present invention are covalently attached, directly or via a cleavable or non-cleavable linker, to at least one growth inhibitory agent.
  • Linker means a chemical moiety comprising a covalent bond or a chain of atoms that covalently attaches a polypeptide to a drug moiety.
  • the conjugates may be prepared by in vitro methods.
  • a linking group is used. Suitable linking groups are well known in the art and include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups.
  • Conjugation of an antibody of the invention with cytotoxic agents or growth inhibitory agents may be made using a variety of bifunctional protein coupling agents including but not limited to N-succinimidyl pyridyldithiobutyrate (SPDB), butanoic acid 4-[(5-nitro-2-pyridinyl)dithio]-2,5-dioxo-l-pyrrolidinyl ester (nitro-SPDB), 4- (Pyridin-2-yldisulfanyl)-2-sulfo-butyric acid (sulfo-SPDB), N-succinimidyl (2-pyridyldithio) propionate (SPDP), succinimidyl (N-maleimidomethyl) cyclohexane- 1 -carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccin
  • a ricin immunotoxin can be prepared as described in Vitetta et al (1987).
  • Carbon labeled 1- isothiocyanatobenzyl methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody (WO 94/11026).
  • the linker may be a "cleavable linker" facilitating release of the cytotoxic agent or growth inhibitory agent in the cell.
  • a "cleavable linker” facilitating release of the cytotoxic agent or growth inhibitory agent in the cell.
  • an acid-labile linker, a peptidase-sensitive linker, an esterase labile linker, a photolabile linker or a disulfide-containing linker See e.g. U.S. Patent No. 5,208,020
  • the linker may be also a "non-cleavable linker” (for example SMCC linker) that might lead to better tolerance in some cases.
  • a fusion protein comprising the antibody of the invention and a cytotoxic or growth inhibitory polypeptide may be made, by recombinant techniques or peptide synthesis.
  • the length of DNA may comprise respective regions encoding the two portions of the conjugate either adjacent one another or separated by a region encoding a linker peptide which does not destroy the desired properties of the conjugate.
  • the antibodies of the present invention may also be used in Dependent Enzyme Mediated Prodrug Therapy by conjugating the polypeptide to a prodrug -activating enzyme which converts a prodrug (e.g. a peptidyl chemotherapeutic agent, see WO81/01145) to an active anti-cancer drug (See, for example, WO 88/07378 and U.S. Patent No. 4,975,278).
  • a prodrug e.g. a peptidyl chemotherapeutic agent, see WO81/01145
  • an active anti-cancer drug See, for example, WO 88/07378 and U.S. Patent No. 4,975,278.
  • the enzyme component of the immunoconjugate useful for ADEPT includes any enzyme capable of acting on a prodrug in such a way so as to convert it into its more active, cytotoxic form.
  • Enzymes that are useful in the method of this invention include, but are not limited to, alkaline phosphatase useful for converting phosphate-containing prodrugs into free drugs; arylsulfatase useful for converting sulfate-containing prodrugs into free drugs; cytosine deaminase useful for converting non-toxic fluorocytosine into the anticancer drug, 5-fluorouracil; proteases, such as serratia protease, thermolysin, subtilisin, carboxypeptidases and cathepsins (such as cathepsins B and L), that are useful for converting peptide-containing prodrugs into free drugs; D-alanylcarboxypeptidases, useful for converting prodrugs that contain D-amino acid substituents; carbohydrate- cleaving enzymes such as O-galactosidase and neuraminidase useful for converting glycosylated prodrugs into free drugs; P-lactama
  • the growth inhibitory agent is a maytansinoid, in an embodiment DM1 or DM4.
  • the antibody is conjugated to said at least one growth inhibitory agent by a linking group.
  • said linking group is a cleavable or a non-cleavable linker, such as SPDB, sulfo-SPDB, or SMCC.
  • the conjugate may be selected from the group consisting of:
  • the conjugate is a conjugate of formula (III), (IV) or (V) as defined above, in which the antibody is an antibody described herein.
  • the conjugate can be obtained by a process comprising the steps of:
  • the aqueous solution of cell-binding agent can be buffered with buffers such as, e.g. potassium phosphate, acetate, citrate or N-2-Hydroxyethylpiperazine-N’-2-ethanesulfonic acid (Hepes buffer).
  • buffers such as, e.g. potassium phosphate, acetate, citrate or N-2-Hydroxyethylpiperazine-N’-2-ethanesulfonic acid (Hepes buffer).
  • the buffer depends upon the nature of the cell-binding agent.
  • the cytotoxic compound is in solution in an organic polar solvent, e.g. dimethyl sulfoxide (DMSO) or dimethylacetamide (DMA).
  • DMSO dimethyl sulfoxide
  • DMA dimethylacetamide
  • the reaction temperature is usually comprised between 20 and 40°C.
  • the reaction time can vary from 1 to 24 hours.
  • the reaction between the cell-binding agent and the cytotoxic agent can be monitored by size exclusion chromatography (SEC) with a refractometric and/or UV detector. If the conjugate yield is too low, the reaction time can be extended.
  • SEC size exclusion chromatography
  • the conjugate can be purified e.g. by SEC, adsorption chromatography (such as ion exchange chromatography, IEC), hydrophobic interaction chromatograhy (HIC), affinity chromatography, mixed-support chromatography such as hydroxyapatite chromatography, or high performance liquid chromatography (HPLC).
  • SEC adsorption chromatography
  • IEC ion exchange chromatography
  • HIC hydrophobic interaction chromatograhy
  • HPLC high performance liquid chromatography
  • the term“aggregates” means the associations which can be formed between two or more cell-binding agents, said agents being modified or not by conjugation.
  • the aggregates can be formed under the influence of a great number of parameters, such as a high concentration of cell-binding agent in the solution, the pH of the solution, high shearing forces, the number of bonded dimers and their hydrophobic character, the temperature (see Wang & Gosh, 2008, J. Membrane Sci. , 318: 311-316, and references cited therein); note that the relative influence of some of these parameters is not clearly established.
  • proteins and antibodies the person skilled in the art will refer to Cromwell et al.
  • the conjugate-containing solution can be submitted to an additional step (iii) of chromatography, ultrafiltration and/or diafiltration.
  • the conjugate is recovered at the end of these steps in an aqueous solution.
  • the conjugate according to the invention is characterised by a“drug-to-antibody ratio” (or“DAR”) ranging from 1 to 10, for instance from 2 to 5, in particular from 3 to 4. This is generally the case of conjugates including maytansinoid molecules.
  • This DAR number can vary with the nature of the antibody and of the drug (i.e. the growth-inhibitory agent) used along with the experimental conditions used for the conjugation (like the ratio growth-inhibitory agent/antibody, the reaction time, the nature of the solvent and of the cosolvent if any).
  • the contact between the antibody and the growth-inhibitory agent leads to a mixture comprising several conjugates differing from one another by different drug-to- antibody ratios; optionally the naked antibody; optionally aggregates.
  • the DAR that is determined is thus a mean value.
  • a method which can be used to determine the DAR consists in measuring
  • 280 nm is a wavelength generally used for measuring protein concentration, such as antibody concentration.
  • the wavelength Xu is selected so as to allow discriminating the drug from the antibody, i.e. as readily known to the skilled person, lo is a wavelength at which the drug has a high absorbance and lo is sufficiently remote from 280 nm to avoid substantial overlap in the absorbance peaks of the drug and antibody lo may be selected as being 252 nm in the case of maytansinoid molecules.
  • a method of DAR calculation may be derived from Antony S. Dimitrov (ed), LLC, 2009, Therapeutic Antibodies and Protocols, vol 525, 445, Springer Science:
  • the absorbances for the conjugate at lo (A D ) and at 280 nm (A280) are measured either on the monomeric peak of the size exclusion chromatography (SEC) analysis (allowing to calculate the“DAR(SEC)” parameter) or using a classic spectrophotometer apparatus (allowing to calculate the“DAR(ETV)” parameter).
  • SEC size exclusion chromatography
  • CD and CA are respectively the concentrations in the solution of the drug and of the antibody
  • SDID and D280 are respectively the molar extinction coefficients of the drug at lo and 280 nm e .L , . o and A 28 O are respectively the molar extinction coefficients of the antibody at lo and 280 nm.
  • CD [(eA280 C Al ⁇ ) - (eAl ⁇ C A28O)] / [(e ⁇ l ⁇ X 8A28O) - (eAl ⁇ C 8D28O)]
  • CA [A28O - (CD X 8D28O)] / 8A280
  • the antibodies or immunoconjugates of the invention may be combined with
  • compositions comprising pharmaceutically acceptable excipients, and optionally sustained-release matrices, such as biodegradable polymers, to form therapeutic compositions.
  • sustained-release matrices such as biodegradable polymers
  • Another object of the invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising an antibody or an immunoconjugate of the invention and a pharmaceutically acceptable carrier or excipient.
  • the invention also relates to a polypeptide or an immunoconjugate according to the invention, for use as a medicament.
  • “Pharmaceutically” or “pharmaceutically acceptable” refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to a mammal, especially a human, as appropriate.
  • a pharmaceutically acceptable carrier or excipient refers to a non-toxic solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
  • “pharmaceutically-acceptable carriers” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, and the like that are
  • suitable carriers, diluents and/or excipients include one or more of water, amino acids, saline, phosphate buffered saline, buffer phosphate, acetate, citrate, succinate; amino acids and derivates such as histidine, arginine, glycine, proline, glycylglycine; inorganic salts NaCl, calcium chloride; sugars or polyalcohols such as dextrose, glycerol, ethanol, sucrose, trehalose, mannitol; surfactants such as Polysorbate 80, polysorbate 20, poloxamer 188; and the like, as well as combination thereof.
  • isotonic agents such as sugars, polyalcohols, or sodium chloride in the composition, and formulation may also contain an antioxidant such as tryptamine and a stabilizing agent such as Tween 20.
  • compositions The form of the pharmaceutical compositions, the route of administration, the dosage and the regimen naturally depend upon the condition to be treated, the severity of the illness, the age, weight, and gender of the patient, etc.
  • compositions of the invention can be formulated for a topical, oral, parenteral, intranasal, intravenous, intramuscular, subcutaneous or intraocular administration and the like.
  • the pharmaceutical compositions contain vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
  • vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
  • These may be isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.
  • the pharmaceutical composition can be administrated through drug combination devices.
  • the doses used for the administration can be adapted as a function of various parameters, and for instance as a function of the mode of administration used, of the relevant pathology, or alternatively of the desired duration of treatment.
  • an effective amount of the antibody or immunoconjugate of the invention may be dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
  • the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
  • the form must be sterile and injectable with the appropriate device or system for delivery without degradation. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
  • Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
  • An antibody or immunoconjugate of the invention can be formulated into a composition in a neutral or salt form.
  • Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, glycine, histidine, procaine and the like.
  • the carrier can also be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetables oils.
  • the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars or sodium chloride.
  • Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with any of the other ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by
  • a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • solutions Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
  • the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed.
  • aqueous solutions For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose.
  • aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
  • sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure.
  • one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, "Remington's Pharmaceutical Sciences" 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
  • the antibody or immunoconjugate of the invention may be formulated within a therapeutic mixture to comprise about 0.01 to 100 milligrams, per dose or so.
  • other pharmaceutically acceptable forms include, e.g., tablets or other solids for oral administration; time release capsules; and any other form currently used.
  • liposomes and/or nanoparticles are contemplated for the introduction of polypeptides into host cells.
  • the formation and use of liposomes and/or nanoparticles are known to those of skill in the art.
  • Nanocapsules can generally entrap compounds in a stable and reproducible way. To avoid side effects due to intracellular polymeric overloading, such ultrafine particles (sized around 0.1 pm) are generally designed using polymers able to be degraded in vivo.
  • Biodegradable polyalkyl-cyanoacrylate nanoparticles, or biodegradable polylactide or polylactide co glycolide nanoparticules that meet these requirements are contemplated for use in the present invention, and such particles may be are easily made.
  • Liposomes are formed from phospholipids that are dispersed in an aqueous medium and spontaneously form multilamellar concentric bilayer vesicles (also termed multilamellar vesicles (MLVs)).
  • MLVs generally have diameters of from 25 nm to 4 pm. Sonication of MLVs results in the formation of small unilamellar vesicles (SUVs) with diameters in the range of 200 to 500 A, containing an aqueous solution in the core.
  • SUVs small unilamellar vesicles
  • the physical characteristics of liposomes depend on pH, ionic strength and the presence of divalent cations.
  • an“effective amount” or “therapeutically effective amount” is a dose of the therapeutic that results in treatment of lung cancer (e.g ., NSQ NSCLC).
  • “treating” refers to causing a detectable improvement in one or more symptoms associated with lung cancer or causing a biological effect (e.g., a decrease in the level of a particular biomarker) that is correlated with the underlying pathologic mechanism(s) giving rise to the condition or symptom(s).
  • a dose of anti-CEACAM5 antibody , or an immunoconjugate comprising the antibody, which causes an improvement in any of the following symptoms or conditions associated with lung cancer is deemed a "therapeutically effective amount”:
  • a treatment has not been effective when a dose of anti-CEACAM5 antibody , or an immunoconjugate comprising the antibody, does not result in a detectable improvement in one or more parameters or symptoms associated with cancer (e.g., lung cancer) or which does not cause a biological effect that is correlated with the underlying pathologic mechanism(s) giving rise to the condition or symptom(s) of cancer.
  • cancer e.g., lung cancer
  • the anti-CEACAM5 antibody, or an immunoconjugate comprising the antibody is administered intravenously.
  • a therapeutically effective amount of anti-CEACAM5 antibody , or an immunoconjugate comprising the antibody, that is administered to the subject will vary depending upon the age and the size (e.g., body weight or body surface area) of the subject as well as the route of administration and other factors well known to those of ordinary skill in the art.
  • the dose of the antibody, or an immunoconjugate comprising the antibody varies depending on the body surface area of the subject. In certain embodiments, the dose of anti-CEACAM5 antibody, or an immunoconjugate comprising the antibody,
  • the administered to the subject is from about 1 mg/m 2 to about 500 mg/m 2 .
  • the dose of the antibody, or an immunoconjugate comprising the antibody, administered to the subject is from about 5 mg to about 300 mg/m 2 .
  • the dose of the antibody or an immunoconjugate comprising the antibody, administered to the subject is from about 5 to about 250 mg/m 2 .
  • the dose is about 5, 10, 20, 30, 40, 60, 80, 100, 120, 150, 180, or 210 mg/m 2 based on the body surface area of the subject.
  • the antibody, or an immunoconjugate comprising the antibody is administered at a dose of about 2.5 mg/m 2 to about 5 mg/m 2 .
  • the antibody, or an immunoconjugate comprising the antibody is administered for a period of time (e.g ., 30 minutes and one hour) at a dose of about 2.5 mg/m 2 to about 5 mg/m 2 .
  • the dose includes 2.5 mg/m 2 of the antibody, 5 mg/m 2 of the antibody , or an immunoconjugate comprising the antibody, and all doses in between 2.5 mg/m 2 and 5 mg/m 2 , for example 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, and 4.9 mg/m 2 .
  • the present invention includes (but is not limited to) methods wherein about 1 mg/m 2 , about 5 mg/m 2 , 10 mg/m 2 , about 15 mg/m 2 , about 20 mg/m 2 , about 25 mg/m 2 , about 30 mg/m 2 , about 35 mg/m 2 , about 40 mg/m 2 , about 45 mg/m 2 , about 50 mg/m 2 , about 55 mg/m 2 , about 60 mg/m 2 , about 65 mg/m 2 , about 70 mg/m 2 , about 75 mg/m 2 , about 80 mg/m 2 , about 85 mg/m 2 , about 90 mg/m 2 , about 95 mg/m 2 , about 100 mg/m 2 , about 105 mg/m 2 , about 110 mg/m 2 , about 115 mg/m 2 , about 120 mg/m 2 , about 125 mg/m 2 , about 130 mg/m 2 , about 135 mg/m 2 , about 140 mg/m 2 , about 145
  • “administered from about 1 to about 500 mg/kg” means that the referred to substance is administered at any value within the stated range including the endpoints of the range.
  • “the dose of anti-CEACAM5 antibody , or a immunoconjugate comprising the antibody, administered to the patient is from 1 mg/m 2 to 500 mg/m 2 ,” includes administration of 1 mg/m 2 of the anti-CEACAM5 antibody , or of an immunoconjugate comprising the antibody,, 500 mg/m 2 of the anti-CEACAM5 antibody , or of an immunoconjugate comprising the antibody, and all doses in between.
  • the CEACAM5 antibody , or an immunoconjugate comprising the antibody is administered at a dose of about 5, 10, 20, 30, 40, 60, 80, 100, 120, 150, 180, or 210 mg/m 2 over a period of time, for example once every 14 days (i.e., every two weeks) or 3 weeks.
  • the antibody, or an immunoconjugate comprising the antibody is used at a dose listed in Example 1.
  • the dose is administered at a constant rate. Alternatively, the dose is administered at a variable rate. In various embodiments, the dose is administered at a constant rate of about 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 2.5 or 5 mg/min.
  • the antibody, or an immunoconjugate comprising the antibody is administered at a rate for the first 30 minutes or for the first 1 hour. In various embodiments, after about 30 minutes or 1 hour, the rate of administration of the antibody is changed. For example, the rate is decreased. In various embodiments, the rate is increased. In various embodiments, the antibody, or an immunoconjugate comprising the antibody, is administered at a rate for the first 30 minutes or for the first 1 hour. In various embodiments, after about 30 minutes or 1 hour, the rate of administration of the antibody is changed. For example, the rate is decreased. In various embodiments, the rate is increased. In various embodiments, the antibody, or an immunoconjugate comprising the antibody, is administered at a rate for the first 30 minutes or for the first 1 hour. In various embodiments,
  • immunoconjugate comprising the antibody is administered at a rate of 2.5 mg/min for the first 30 minutes or 1 hour. In various embodiments, after about 30 minutes or 1 hour, the rate of administration of the antibody, or of an immunoconjugate comprising the antibody, is increased to 5 mg/min.
  • the methods of the present invention include administering multiple doses of an anti- CEACAM5 antibody, or an immunoconjugate comprising the antibody, to a patient over a specified time course.
  • the anti-CEACAM5 antibody , or an immunoconjugate comprising the antibody can be administered about 1 to 5 times per day, about 1 to 5 times per week, about 1 to 5 times every two weeks, about 1 to 5 times per month or about 1 to 5 times per year.
  • the methods of the invention include administering a first dose of anti-CEACAM5 antibody, or an immunoconjugate comprising the antibody, to a patient at a first time point, followed by administering at least a second dose of anti-CEACAM5 antibody , or an immunoconjugate comprising the antibody, to the patient at a second time point.
  • the first and second doses in certain embodiments, may contain the same amount of anti-CEACAM5 antibody, or of an immunoconjugate comprising the antibody,.
  • the time between the first and second doses may be from about a few hours to several weeks.
  • the second time point (i.e., the time when the second dose is administered) can be from about 1 hour to about 7 weeks after the first time point (i.e., the time when the first dose is administered).
  • the second time point can be about 1 hour, about 4 hours, about 6 hours, about 8 hours, about 10 hours, about 12 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 2 weeks, about 3 weeks, about 4 weeks, about 6 weeks, about 8 weeks, about 10 weeks, about 12 weeks, about 14 weeks or longer after the first time point.
  • the second time point is about 1 week or about 2 weeks.
  • Third and subsequent doses may be similarly administered throughout the course of treatment of the patient.
  • the invention provides methods of using therapeutic compositions comprising anti-CEACAM5 antibodies or antigen-binding fragments thereof, or immunoconjugates comprising the antibodies, and, optionally, one or more additional therapeutic agents.
  • the therapeutic compositions of the invention will be
  • formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles (such as LIPOFECTIN), DNA conjugates, anhydrous absorption pastes, oil-in- water and water- in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax.
  • vesicles such as LIPOFECTIN
  • Various delivery systems are known and can be used to administer the pharmaceutical composition of the invention, e.g., encapsulation in liposomes, microparticles, microcapsules, receptor mediated endocytosis (see, e.g., Wu et al. (1987) J. Biol. Chem. 262:4429-4432, incorporated herein by reference in its entirety).
  • Methods of introduction include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
  • composition may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local.
  • epithelial or mucocutaneous linings e.g., oral mucosa, rectal and intestinal mucosa, etc.
  • Administration can be systemic or local.
  • the CEACAM5 antibody, or an immunoconjugate comprising the antibody can be administered subcutaneously.
  • the pharmaceutical composition can also be delivered in a vesicle, such as a liposome (see Langer (1990) Science 249: 1527-1533, incorporated herein by reference in its entirety).
  • a vesicle such as a liposome
  • the pharmaceutical composition can be delivered in a controlled release system, for example, with the use of a pump or polymeric materials.
  • a controlled release system can be placed in proximity of the composition’s target, thus requiring only a fraction of the systemic dose.
  • the injectable preparations may include dosage forms for intravenous, subcutaneous, intracutaneous and intramuscular injections, local injection, drip infusions, etc. These injectable preparations may be prepared by methods publicly known.
  • the injectable preparations may be prepared, e.g, by dissolving, suspending or emulsifying the antibody or its salt described above in a sterile aqueous medium or an oily medium conventionally used for injections.
  • aqueous medium for injections there are, for example, physiological saline, an isotonic solution containing glucose and other auxiliary agents, etc.
  • the pharmaceutical compositions for oral or parenteral use described above are prepared into dosage forms in a unit dose suited to fit a dose of the active ingredients.
  • Such dosage forms in a unit dose include, for example, tablets, pills, capsules, injections
  • the anti-CEACAM5 antibody, or an immunoconjugate comprising the antibody, can be administered to the patient using any acceptable device or mechanism.
  • the administration can be any acceptable device or mechanism.
  • the administration can be any acceptable device or mechanism.
  • the administration can be any acceptable device or mechanism.
  • the administration can be any acceptable device or mechanism.
  • the administration can be any acceptable device or mechanism.
  • the administration can be any acceptable device or mechanism.
  • the administration can be any acceptable device or mechanism.
  • the methods of the present invention include the use of numerous reusable pen and/or autoinjector delivery devices to administer an anti-CEACAM5 antibody, or an immunoconjugate comprising the antibody (or pharmaceutical formulation comprising the antibody, or an immunoconjugate comprising the antibody).
  • Such devices include, but are not limited to AUTOPEN (Owen Mumford, Inc., Woodstock, UK), DISETRONIC pen (Disetronic Medical Systems, Bergdorf, Switzerland), HUMALOG MIX 75/25 pen, HUMALOG pen, HUMALIN 70/30 pen (Eh Lilly and Co., Indianapolis, IN), NOVOPEN I, II and III (Novo Nordisk, Copenhagen, Denmark), NOVOPEN JUNIOR (Novo Nordisk, Copenhagen, Denmark), BD pen (Becton Dickinson, Franklin Lakes, NJ), OR ⁇ REN, OPTIPEN PRO, OR ⁇ REN
  • disposable pen and/or autoinjector delivery devices having applications in subcutaneous delivery of a pharmaceutical composition of the present invention include, but are not limited to the
  • SOLOSTAR pen Sanofi-Aventis
  • FLEXPEN Novo Nordisk
  • KWIKPEN Eli Lilly
  • SURECLICK Autoinjector Amgen, Thousand Oaks, CA
  • PENLET Haselmeier, Stuttgart, Germany
  • EPIPEN Dey, L.P.
  • HUMIRA Pen AbbVie Inc., North Chicago, IL
  • the antibody, or an immunoconjugate comprising the antibody is administered with a prefilled syringe. In another embodiment, the antibody, or an immunoconjugate comprising the antibody, is administered with a prefilled syringe. In another embodiment, the antibody, or an immunoconjugate comprising the antibody, is administered with a prefilled syringe. In another embodiment, the antibody, or an immunoconjugate comprising the antibody, is administered with a prefilled syringe. In another embodiment, the antibody, or an immunoconjugate comprising the antibody, is administered with a prefilled syringe. In another embodiment, the antibody, or an immunoconjugate comprising the antibody, is administered with a prefilled syringe. In another embodiment, the antibody, or an immunoconjugate comprising the antibody, is administered with a prefilled syringe. In another embodiment, the antibody, or an immunoconjugate comprising the antibody, is administered with a prefilled syringe.
  • the immunoconjugate comprising the antibody, is administered with a prefilled syringe containing a safety system.
  • a safety system prevents an accidental needle-stick injury.
  • the antibody is administered with a prefilled syringe containing an ERIS safety system (West Pharmaceutical Services Inc.). See also U.S. patent numbers 5,215,534 and 9,248,242, incorporated herein by reference in their entireties.
  • the antibody, or an immunoconjugate comprising the antibody is administered with an auto-injector.
  • the antibody, or an immunoconjugate comprising the antibody is administered with an auto-injector.
  • the immunoconjugate comprising the antibody, is administered with an auto-injector featuring the PUSHCLICK technology (SHL Group).
  • the autoinjector is a device comprising a syringe that allows for administration of a dose of the composition and/or antibody to a subject. See also U.S. patent numbers 9,427,531 and 9,566,395, incorporated herein by reference in their entireties.
  • microinfusor to deliver an anti-CEACAM5 antibody, or an anti-CEACAM5 antibody
  • immunoconjugate comprising the antibody (or pharmaceutical formulation comprising the antibody , or an immunoconjugate comprising the antibody) to a patient is also contemplated herein.
  • microinfusor means a subcutaneous delivery device designed to slowly administer large volumes (e.g ., up to about 2.5 mL or more) of a therapeutic formulation over a prolonged period of time (e.g., about 10, 15, 20, 25, 30 or more minutes).
  • Micro infusors are particularly useful for the delivery of large doses of therapeutic proteins contained within high concentration and/or viscous solutions.
  • Example 1 TED13751 - A first-in-human study for the evaluation of the safety
  • the population to be treated was enriched, but not restricted, for patients with tumor types known to express CEACAM5; confirmation of the CEACAM5 expression was retrospectively using IHC on the most recent archival tissue samples and in a central laboratory. Expression of circulating CEACAM5 was also used for enrichment.
  • the maximum tolerated dose (MTD) of 100 mg/m 2 based on the body surface area of the subject was determined during the escalation phase.
  • the population to be treated was restricted to patients with NSQ NSCLC having CEACAM5 expression of >2+ in intensity involving 50% of the tumor cell population was documented during pre-screening on the most recent archival tissue sample and using local IHC evaluation for patients potentially eligible for study treatment in the gastric adenocarcinoma cohort.
  • the first one included patients with CEACAM5 expression of >2+ in intensity involving at least 50% of the tumor cell population.
  • the second cohort included patients that pre-screened positive at the intensity >2+ between 21% to ⁇ 50% of the tumor cell population.
  • CEACAM5 expression was documented essentially retrospectively and centrally on both archival and fresh (baseline sample) tumor tissues.
  • NSQ NSCLC Lung
  • NSQ NSCLC Lung bis
  • the safety of the first 6 patients enrolled in the expansion phase was reviewed by the Study Committee, when the 6th patient had been treated for two cycles, before enrolling the next patients.
  • the MTD (without the loading dose) was confirmed if a third or less of the treated patients (enrolled in the 3 cohorts) had experienced dose limiting toxicity (DLT) at the end of Cycle 2 at the planned dose of huMAb2-3-SPDB-DM4.
  • DLT dose limiting toxicity
  • a preliminary evaluation was on presence or absence of benefit from primary corneal toxicity prophylaxis in preventing corneal toxicity.
  • occurrence of cumulative toxicity, if any, was assessed.
  • the antitumor activity of the drug was evaluated, according to RECIST 1.1.
  • the duration of the study for an individual patient included a period for inclusion of up to 4 weeks (baseline period), a treatment period of at least 1 cycle (2 weeks), an end-of-treatment (EOT) visit around 30 days following the last investigational medical product (IMP)
  • At least 6 x 5 pm slides plus an additional number of slides that can be either 3 x 10 pm (best), or 6 x 5 pm, or equivalent to keep the same total amount of material needed, from FFPE archival tissue should be available for local testing at the site and/or shipment to the Sponsor, or laboratory designated by the Sponsor, evaluation of tumor CEACAM5 expression (retrospectively in the Escalation Phase and prospectively in the Expansion Phase) and exploration of other predictive biomarkers of response. If less material was available, patient could still be eligible after discussion with the Sponsor who assessed and confirmed that there was sufficient relevant material for key evaluations.
  • At least one lesion amenable to biopsy (Expansion cohort only). Patient must consent to a baseline biopsy for retrospective confirmation of tumor CEACAM5 expression before treatment initiation, except if NSCLC or SCLC without lesion amenable to biopsy).
  • the huMAb2-3-SPDB-DM4 ADC was supplied as a 25 mL extractable volume of concentrate for solution for infusion of 125 mg (5 mg/mL) contained in a 30 mL type I glass vial.
  • the drug is administered every 2 weeks at the MTD (100mg/m 2 ) as determined during the escalation phase.
  • the patient’s body surface area (BSA) was calculated using their height and actual body weight. For patients with a BSA >2.2 m2, the dose will be calculated on the basis of 2.2 m2 BSA.
  • Histamine HI antagonist diphenylhydramine 50 mg PO or equivalent [e.g., dexchlorpheniramine] given approximately 1 hour before huMAb2-3-SPDB- DM4 administration
  • huMAb2-3-SPDB-DM4 will be administered by IV infusion at a rate of 2.5 mg/min for the first 30 minutes and then increased to 5 mg/min in the absence of hypersensitivity reactions.
  • the huMAb2-3-SPDB-DM4 was administered on Day 1, and repeated every 14 days; this period of 14 days constituted one treatment cycle (1 cycle). Patients may continue treatment until disease progression, unacceptable toxicity, or willingness to stop.
  • the dose was administered to the patient within 7.5 hours from the bag preparation to the end of the dose infusion.
  • tumour burden Only patients with measurable disease at baseline were included in protocols where objective tumour response was the primary endpoint. Measurable disease was defined by the presence of at least one measurable lesion. In studies where the primary endpoint was tumour progression (either time to progression or proportion with progression at a fixed date), the protocol specificied if entry is restricted to those with measurable disease or whether patients having non- measurable disease only are also eligible. See Table 2 and Table 3.
  • CR Complete Response
  • Partial Response At least a 30% decrease in the sum of diameters of target lesions, taking as reference the baseline sum diameters.
  • PD Progressive Disease
  • Stable Disease Neither sufficient shrinkage to qualify for PR nor sufficient increase to qualify for PD, taking as reference the smallest sum diameters while on study
  • lymph nodes Disappearance of all non-target lesions and normalisation of tumour marker level. All lymph nodes must be non-pathological in size ( ⁇ 10 mm short axis).
  • PD Progressive Disease
  • PR PD SD provided minimum criteria for SD duration met, otherwise,
  • PR NE SD provided minimum criteria for SD duration met, otherwise
  • Best response in these trials is defined as the best response across all time points (for example, a patient who has SD at first assessment, PR at second assessment, and PD on last assessment has a best overall response of PR).
  • SD When SD is believed to be best response, it must also meet the protocol specified minimum time from baseline. If the minimum time is not met when SD is otherwise the best time point response, the patient’s best response depends on the subsequent assessments. For example, a patient who has SD at first assessment, PD at second and does not meet minimum duration for SD, will have a best response of PD. The same patient lost to follow-up after the first SD assessment would be considered non- evaluable.
  • CEACAM5 stained immunihistochemical slides are assessed by a pathologist by light microscopy.
  • CEACAM5 positivity is determined by the percentage of viable tumor cells expressing CEACAM5 positive membrane staining.
  • Tumor cells are CEACAM5 positive if they exhibit either partial or complete circumferential plasma membrane staining at 2+ and 3+ intensities. They are considered as negative is they exhibit staining at 1+ intensity (weak staining) or no staining (intensity 0).
  • a minimum of 100 viable tumor cells should be present on the section to determine the percentage of CEACAM5 positive cells.
  • % CEACAM5 positive 100 x# of tumor cells expressing CEACAM5 membrane staining at > 2+ intensity/Total # of viable tumor cells present in the section
  • Figures 1A, IB and 1C show respectively examples of 1+, 2+, 3+ staining intensities. 2+ and 3+ membrane staining intensities are considered CEACAM5 positive.
  • a general description of IHC process including scoring is given by So-Woon Kim et al (Journal of Pathology and
  • Example 2 TED13751 - Expansion Phase - NSQ NSCLC Cohort - Primary Phase
  • Example 1 there were two independent cohorts in the non-sqNSCLC expansion phase, based on local or central CEACAM5 expression assessment on archival tumor tissue: the first cohort included patients with CEACAM5 expression at >2+ in intensity involving at least 50% of the tumor cell population. The second independent cohort (Lung bis) included patients that pre-screened positive at the intensity of >2+ in 21% to ⁇ 50% of the tumor cell population. Both cohort were selected for treatment with 100mg/m 2 of huMAb2-3-SPDB-DM4.
  • CEACAM5 expression level For the NSQ NSCLC (Lung bis) cohort with CEACAM5 expression between >1% to ⁇ 50% at >2+ intensity, the relationship between CEACAM5 expression level and efficacy outcome will be assessed by adding a cohort of 28 treated patients with mild CEACAM5 membrane staining (at least 1% positive tumor cells and ⁇ 50% of tumor cells at intensity >2+).
  • Tables 1 and 2 summarize objective response results of non small cell lung cancer patients treated with huMAb2-3-SPDB-DM4. The tables compare objective response between NSCLC patients having hCEACAM5 expression of a percent score greater than or equal to 50 (consisting of 2+ and 3+ intensities) and patients having hCEACAM5 expression of a percent score of 1-49.
  • Table 1 Objective response of patients having hCEACAM5 expression of a percent score greater than or equal to 50 (consisting of 2+ and 3+ intensities)
  • Table 2 Objective response of patients having hCEACAM5 expression of a percent score of 1-49 (consisting of 2+ and 3+ intensities)
  • Table 3 Duration of response for huMAb2-3 - SPDB-DM4 treated NSCLC patients with a hCEACAM5 expression of a percent score greater than or equal to 50 (consisting of
  • Table 4 Time to progression for huMAb2-3 - SPDB-DM4 treated NSCLC patients with a hCEACAM5 expression of a percent score greater than or equal to 50 (consisting of 2+ and 3+ intensities)
  • Example 3 TED13751 - Expansion Phase - NSQ NSCLC High Expressers Cohort -
  • Table 7 best objective response in the 32patients treated in the high CEACAM5- expression (Lung) cohort.
  • Table 8 best objective response in patients pre-treated or not with anti-PD1/anti-PDL1 antibodies
  • these data demonstrate that proof of concept was achieved in a subset of NSCLC lung cancers treated with huMAb2-3-SPDB-DM4.
  • these data support the conclusion that huMAb2-3-SPDB-DM4 is effective in treating NSQ NSCLC, a subtype that represents approximately 60% lung cancers.
  • these data support the conclusion that huMAb2-3-SPDB-DM4 is particularly effective in treating high CEACAM5 expressing NSQ NSCLC, a tumor types that represents approximately 20% of NSQ NSCLC cancers.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Cell Biology (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Pulmonology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
PCT/EP2020/052932 2019-02-07 2020-02-06 Use of anti-ceacam5 immunoconjugates for treating lung cancer Ceased WO2020161214A1 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
AU2020219405A AU2020219405A1 (en) 2019-02-07 2020-02-06 Use of anti-CEACAM5 immunoconjugates for treating lung cancer
JP2021546257A JP7597718B2 (ja) 2019-02-07 2020-02-06 肺がんを処置するための抗ceacam5イムノコンジュゲートの使用
CA3129106A CA3129106A1 (en) 2019-02-07 2020-02-06 Use of anti-ceacam5 immunoconjugates for treating lung cancer
EP20702487.8A EP3920972A1 (en) 2019-02-07 2020-02-06 Use of anti-ceacam5 immunoconjugates for treating lung cancer
MX2021009514A MX2021009514A (es) 2019-02-07 2020-02-06 Uso de inmunoconjugados anti-ceacam5 para el tratamiento del cancer de pulmon.
BR112021014636A BR112021014636A2 (pt) 2019-02-07 2020-02-06 Uso de imunoconjugados anti-ceacam5 para tratamento de câncer de pulmão
SG11202107843WA SG11202107843WA (en) 2019-02-07 2020-02-06 Use of anti-ceacam5 immunoconjugates for treating lung cancer
KR1020217025390A KR20210124260A (ko) 2019-02-07 2020-02-06 폐암을 치료하기 위한 항-ceacam5 면역접합체의 용도
US17/425,603 US20220080053A1 (en) 2019-02-07 2020-02-06 Use of anti-ceacam5 immunoconjugates for treating lung cancer
CN202080012901.6A CN114173823A (zh) 2019-02-07 2020-02-06 抗ceacam5免疫缀合物用于治疗肺癌的用途
CONC2021/0010032A CO2021010032A2 (es) 2019-02-07 2021-07-29 Uso de inmunoconjugados anti-ceacam5 para el tratamiento del cáncer de pulmón
IL285306A IL285306A (en) 2019-02-07 2021-08-02 Use of anti-ceacam5 immunoconjugates for treating lung cancer

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201962802511P 2019-02-07 2019-02-07
US62/802,511 2019-02-07
EP19305173.7 2019-02-11
EP19305173.7A EP3693023A1 (en) 2019-02-11 2019-02-11 Use of anti-ceacam5 immunoconjugates for treating lung cancer
EP19305504.3 2019-04-18
EP19305504 2019-04-18

Publications (1)

Publication Number Publication Date
WO2020161214A1 true WO2020161214A1 (en) 2020-08-13

Family

ID=71947024

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2020/052932 Ceased WO2020161214A1 (en) 2019-02-07 2020-02-06 Use of anti-ceacam5 immunoconjugates for treating lung cancer

Country Status (14)

Country Link
US (1) US20220080053A1 (enExample)
EP (1) EP3920972A1 (enExample)
JP (1) JP7597718B2 (enExample)
KR (1) KR20210124260A (enExample)
CN (1) CN114173823A (enExample)
AU (1) AU2020219405A1 (enExample)
BR (1) BR112021014636A2 (enExample)
CA (1) CA3129106A1 (enExample)
CO (1) CO2021010032A2 (enExample)
IL (1) IL285306A (enExample)
MX (1) MX2021009514A (enExample)
SG (1) SG11202107843WA (enExample)
TW (1) TW202045539A (enExample)
WO (1) WO2020161214A1 (enExample)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022101165A1 (en) 2020-11-10 2022-05-19 Sanofi Ceacam5 antibody-drug conjugate formulation
WO2023099682A1 (en) 2021-12-02 2023-06-08 Sanofi Ceacam5 adc–anti-pd1/pd-l1 combination therapy
US20230181755A1 (en) * 2020-04-24 2023-06-15 Sanofi Antitumor combinations containing anti-ceacam5 antibody conjugates, trifluridine and tipiracil
EP4427763A1 (en) 2023-03-06 2024-09-11 Sanofi Antitumor combinations containing anti-ceacam5 antibody-drug conjugates, anti-vegfr-2 antibodies and anti-pd1/pd-l1 antibodies
WO2024251733A1 (en) 2023-06-05 2024-12-12 Sanofi Antitumor combinations containing anti-ceacam5 antibody-drug conjugates, anti-pd1/pd-l1 antibodies and anti-ctla4 antibodies
US12194321B2 (en) 2018-06-07 2025-01-14 Seagen Inc. Camptothecin conjugates
WO2025169012A1 (en) 2024-02-06 2025-08-14 Sanofi Methods of treating ceacam5-expressing cancers
US12570761B2 (en) 2012-11-20 2026-03-10 Sanofi Anti-CEACAM5 antibodies and uses thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025184208A1 (en) * 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibodies and uses thereof
US12521446B2 (en) 2024-02-27 2026-01-13 Bristol-Myers Squibb Company Anti-CEACAM5 antibody drug conjugates

Citations (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4256746A (en) 1978-11-14 1981-03-17 Takeda Chemical Industries Dechloromaytansinoids, their pharmaceutical compositions and method of use
WO1981001145A1 (en) 1979-10-18 1981-04-30 Univ Illinois Hydrolytic enzyme-activatible pro-drugs
US4294757A (en) 1979-01-31 1981-10-13 Takeda Chemical Industries, Ltd 20-O-Acylmaytansinoids
US4301144A (en) 1979-07-11 1981-11-17 Ajinomoto Company, Incorporated Blood substitute containing modified hemoglobin
US4307016A (en) 1978-03-24 1981-12-22 Takeda Chemical Industries, Ltd. Demethyl maytansinoids
US4313946A (en) 1981-01-27 1982-02-02 The United States Of America As Represented By The Secretary Of Agriculture Chemotherapeutically active maytansinoids from Trewia nudiflora
US4315929A (en) 1981-01-27 1982-02-16 The United States Of America As Represented By The Secretary Of Agriculture Method of controlling the European corn borer with trewiasine
US4322348A (en) 1979-06-05 1982-03-30 Takeda Chemical Industries, Ltd. Maytansinoids
US4331598A (en) 1979-09-19 1982-05-25 Takeda Chemical Industries, Ltd. Maytansinoids
US4362663A (en) 1979-09-21 1982-12-07 Takeda Chemical Industries, Ltd. Maytansinoid compound
US4364866A (en) 1979-09-21 1982-12-21 Takeda Chemical Industries, Ltd. Maytansinoids
US4371533A (en) 1980-10-08 1983-02-01 Takeda Chemical Industries, Ltd. 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof
US4424219A (en) 1981-05-20 1984-01-03 Takeda Chemical Industries, Ltd. 9-Thiomaytansinoids and their pharmaceutical compositions and use
US4450254A (en) 1980-11-03 1984-05-22 Standard Oil Company Impact improvement of high nitrile resins
US4496689A (en) 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
US4640835A (en) 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
WO1988007378A1 (en) 1987-03-09 1988-10-06 Cancer Research Campaign Technology Ltd. Improvements relating to drug delivery systems
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
US4975278A (en) 1988-02-26 1990-12-04 Bristol-Myers Company Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5215534A (en) 1991-12-02 1993-06-01 Lawrence De Harde Safety syringe system
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5475092A (en) 1992-03-25 1995-12-12 Immunogen Inc. Cell binding agent conjugates of analogues and derivatives of CC-1065
US6333410B1 (en) 2000-08-18 2001-12-25 Immunogen, Inc. Process for the preparation and purification of thiol-containing maytansinoids
US6629949B1 (en) 2000-05-08 2003-10-07 Sterling Medivations, Inc. Micro infusion drug delivery device
US6659982B2 (en) 2000-05-08 2003-12-09 Sterling Medivations, Inc. Micro infusion drug delivery device
WO2004091668A1 (en) 2003-04-15 2004-10-28 Algeta As Thorium-227 for use in radiotherapy of soft tissue disease
WO2007071426A1 (en) 2005-12-21 2007-06-28 Micromet Ag Pharmaceutical compositions with resistance to soluble cea
WO2008010101A2 (en) 2006-07-18 2008-01-24 Sanofi-Aventis Antagonist antibody against epha2 for the treatment of cancer
WO2014079886A1 (en) 2012-11-20 2014-05-30 Sanofi Anti-ceacam5 antibodies and uses thereof
US9248242B2 (en) 2012-04-20 2016-02-02 Safety Syringes, Inc. Anti-needle stick safety device for injection device
US9427531B2 (en) 2010-06-28 2016-08-30 Sanofi-Aventis Deutschland Gmbh Auto-injector
US9566395B2 (en) 2012-12-03 2017-02-14 Mylan Inc Medicament storage, dispensing, and administration system and method
WO2018227023A1 (en) * 2017-06-07 2018-12-13 Silverback Therapeutics, Inc. Antibody construct conjugates

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2761120A1 (en) * 2009-05-06 2010-11-11 Biotest Ag Uses of immunoconjugates targeting cd138
US10669338B2 (en) * 2016-06-17 2020-06-02 Immunomedics, Inc. Anti-PD-1 checkpoint inhibitor antibodies that block binding of PD-L1 to PD-1
AU2022402334A1 (en) * 2021-12-02 2024-07-18 Sanofi Ceacam5 adc–anti-pd1/pd-l1 combination therapy
JP2026508856A (ja) * 2023-03-01 2026-03-13 サノフイ Ceacam5を発現する神経内分泌がんを処置するための抗ceacam5免疫複合体の使用

Patent Citations (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4361650A (en) 1978-03-24 1982-11-30 Takeda Chemical Industries, Ltd. Fermentation process of preparing demethyl maytansinoids
US4307016A (en) 1978-03-24 1981-12-22 Takeda Chemical Industries, Ltd. Demethyl maytansinoids
US4256746A (en) 1978-11-14 1981-03-17 Takeda Chemical Industries Dechloromaytansinoids, their pharmaceutical compositions and method of use
US4294757A (en) 1979-01-31 1981-10-13 Takeda Chemical Industries, Ltd 20-O-Acylmaytansinoids
US4322348A (en) 1979-06-05 1982-03-30 Takeda Chemical Industries, Ltd. Maytansinoids
US4301144A (en) 1979-07-11 1981-11-17 Ajinomoto Company, Incorporated Blood substitute containing modified hemoglobin
US4331598A (en) 1979-09-19 1982-05-25 Takeda Chemical Industries, Ltd. Maytansinoids
US4362663A (en) 1979-09-21 1982-12-07 Takeda Chemical Industries, Ltd. Maytansinoid compound
US4364866A (en) 1979-09-21 1982-12-21 Takeda Chemical Industries, Ltd. Maytansinoids
WO1981001145A1 (en) 1979-10-18 1981-04-30 Univ Illinois Hydrolytic enzyme-activatible pro-drugs
US4371533A (en) 1980-10-08 1983-02-01 Takeda Chemical Industries, Ltd. 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof
US4450254A (en) 1980-11-03 1984-05-22 Standard Oil Company Impact improvement of high nitrile resins
US4313946A (en) 1981-01-27 1982-02-02 The United States Of America As Represented By The Secretary Of Agriculture Chemotherapeutically active maytansinoids from Trewia nudiflora
US4315929A (en) 1981-01-27 1982-02-16 The United States Of America As Represented By The Secretary Of Agriculture Method of controlling the European corn borer with trewiasine
US4424219A (en) 1981-05-20 1984-01-03 Takeda Chemical Industries, Ltd. 9-Thiomaytansinoids and their pharmaceutical compositions and use
US4640835A (en) 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
US4496689A (en) 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
WO1988007378A1 (en) 1987-03-09 1988-10-06 Cancer Research Campaign Technology Ltd. Improvements relating to drug delivery systems
US4975278A (en) 1988-02-26 1990-12-04 Bristol-Myers Company Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5215534A (en) 1991-12-02 1993-06-01 Lawrence De Harde Safety syringe system
US5475092A (en) 1992-03-25 1995-12-12 Immunogen Inc. Cell binding agent conjugates of analogues and derivatives of CC-1065
US5585499A (en) 1992-03-25 1996-12-17 Immunogen Inc. Cyclopropylbenzindole-containing cytotoxic drugs
US5846545A (en) 1992-03-25 1998-12-08 Immunogen, Inc. Targeted delivery of cyclopropylbenzindole-containing cytotoxic drugs
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US6629949B1 (en) 2000-05-08 2003-10-07 Sterling Medivations, Inc. Micro infusion drug delivery device
US6659982B2 (en) 2000-05-08 2003-12-09 Sterling Medivations, Inc. Micro infusion drug delivery device
US6333410B1 (en) 2000-08-18 2001-12-25 Immunogen, Inc. Process for the preparation and purification of thiol-containing maytansinoids
WO2004091668A1 (en) 2003-04-15 2004-10-28 Algeta As Thorium-227 for use in radiotherapy of soft tissue disease
WO2007071426A1 (en) 2005-12-21 2007-06-28 Micromet Ag Pharmaceutical compositions with resistance to soluble cea
WO2008010101A2 (en) 2006-07-18 2008-01-24 Sanofi-Aventis Antagonist antibody against epha2 for the treatment of cancer
US9427531B2 (en) 2010-06-28 2016-08-30 Sanofi-Aventis Deutschland Gmbh Auto-injector
US9248242B2 (en) 2012-04-20 2016-02-02 Safety Syringes, Inc. Anti-needle stick safety device for injection device
WO2014079886A1 (en) 2012-11-20 2014-05-30 Sanofi Anti-ceacam5 antibodies and uses thereof
US9566395B2 (en) 2012-12-03 2017-02-14 Mylan Inc Medicament storage, dispensing, and administration system and method
WO2018227023A1 (en) * 2017-06-07 2018-12-13 Silverback Therapeutics, Inc. Antibody construct conjugates

Non-Patent Citations (23)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. NP 001807.2
"Therapeutic Antibodies and Protocols", vol. 525, 2009, SPRINGER SCIENCE, pages: 445
ALMAGROFRANSSON, FRONT BIOSCI., vol. 13, 2008, pages 1619 - 1633
ANGAL ET AL., MOLECULAR IMMUNOLOGY, vol. 30, 1993, pages 105
BEERS ET AL., SEMIN HEMATOL, vol. 47, pages 107 - 114
CROMWELL ET AL., AAPS JOUNAL, vol. 8, no. 3, 2006, pages E572 - E579
DOERN ET AL., J. BIOL. CHEM, vol. 284, 2009, pages 10254
GOLDFREEDMAN, J EXP MED, vol. 121, 1965, pages 439
JESPERS ET AL., BIOTECHNOLOGY, vol. 12, 1994, pages 899
LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533
MEEHAN ET AL., J. CONTROLLED RELEASE, vol. 46, 1996, pages 107 - 116
NEEDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443
PENG ET AL., PLOS ONE, vol. 7, no. 5, pages e3641
POWELL ET AL.: "Compendium of excipients for parenteral formulations", J PHARM SCI TECHNOL, vol. 52, 1998, pages 1035 - 1038,1570-1580
SCHMIDT ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 57, 2008, pages 1879
SHARKEY ET AL., CANCER RESEARCH, vol. 50, 1990, pages 2823
SHARKEY ET AL., CANCER RESEARCH, vol. 55, 1995, pages 5935
SO-WOON KIM ET AL., JOURNAL OF PATHOLOGY AND TRANSLATIONAL MEDICINE, vol. 50, 2016, pages 411 - 418
STRICKLAND ET AL., J PATHOL, vol. 218, 2009, pages 380
TAYLOR ET AL., NUCL. ACIDS RES., vol. 20, 1992, pages 6287 - 6295
WALTER ET AL., ANAL. BIOCHEM., vol. 212, no. 2, 1993, pages 469 - 480
WANGGOSH, J. MEMBRANE SCI., vol. 318, 2008, pages 311 - 316
WU ET AL., J. BIOL. CHEM., vol. 262, 1987, pages 4429 - 4432

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12570761B2 (en) 2012-11-20 2026-03-10 Sanofi Anti-CEACAM5 antibodies and uses thereof
US12194321B2 (en) 2018-06-07 2025-01-14 Seagen Inc. Camptothecin conjugates
US20230181755A1 (en) * 2020-04-24 2023-06-15 Sanofi Antitumor combinations containing anti-ceacam5 antibody conjugates, trifluridine and tipiracil
WO2022101165A1 (en) 2020-11-10 2022-05-19 Sanofi Ceacam5 antibody-drug conjugate formulation
JP2023547707A (ja) * 2020-11-10 2023-11-13 サノフイ Ceacam5抗体-薬物コンジュゲート製剤
US12564642B2 (en) 2020-11-10 2026-03-03 Sanofi CEACAM5 antibody-drug conjugate formulation
JP7849358B2 (ja) 2020-11-10 2026-04-21 サノフイ Ceacam5抗体-薬物コンジュゲート製剤
WO2023099682A1 (en) 2021-12-02 2023-06-08 Sanofi Ceacam5 adc–anti-pd1/pd-l1 combination therapy
EP4427763A1 (en) 2023-03-06 2024-09-11 Sanofi Antitumor combinations containing anti-ceacam5 antibody-drug conjugates, anti-vegfr-2 antibodies and anti-pd1/pd-l1 antibodies
WO2024184349A1 (en) 2023-03-06 2024-09-12 Sanofi Antitumor combinations containing anti-ceacam5 antibody-drug conjugates, anti-vegfr-2 antibodies and anti-pd1/pd-l1 antibodies
WO2024251733A1 (en) 2023-06-05 2024-12-12 Sanofi Antitumor combinations containing anti-ceacam5 antibody-drug conjugates, anti-pd1/pd-l1 antibodies and anti-ctla4 antibodies
WO2025169012A1 (en) 2024-02-06 2025-08-14 Sanofi Methods of treating ceacam5-expressing cancers

Also Published As

Publication number Publication date
TW202045539A (zh) 2020-12-16
US20220080053A1 (en) 2022-03-17
JP2022523155A (ja) 2022-04-21
KR20210124260A (ko) 2021-10-14
CO2021010032A2 (es) 2021-10-29
EP3920972A1 (en) 2021-12-15
CN114173823A (zh) 2022-03-11
BR112021014636A2 (pt) 2021-12-21
IL285306A (en) 2021-09-30
MX2021009514A (es) 2021-11-04
AU2020219405A1 (en) 2021-08-26
JP7597718B2 (ja) 2024-12-10
CA3129106A1 (en) 2020-08-13
SG11202107843WA (en) 2021-08-30

Similar Documents

Publication Publication Date Title
US20220080053A1 (en) Use of anti-ceacam5 immunoconjugates for treating lung cancer
EP3344658B1 (en) Antibodies specific to human t-cell immunoglobulin and itim domain (tigit)
US20250041434A1 (en) Cea assay for patient selection in cancer therapy
KR20180086502A (ko) 항-lag3 항체 및 항원-결합 단편
EP3693023A1 (en) Use of anti-ceacam5 immunoconjugates for treating lung cancer
US10925971B2 (en) Methods of treating PRLR positive breast cancer
US20250154250A1 (en) Ceacam5 adc-anti-pd1/pd-l1 combination therapy
CA3198359A1 (en) Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins
CN120826244A (zh) 含有抗ceacam5抗体-药物缀合物、抗vegfr-2抗体和抗pd1/pd-l1抗体的抗肿瘤组合
KR20240099362A (ko) 혈액암에 대한 lag-3 길항제 요법
WO2025169012A1 (en) Methods of treating ceacam5-expressing cancers
WO2024251733A1 (en) Antitumor combinations containing anti-ceacam5 antibody-drug conjugates, anti-pd1/pd-l1 antibodies and anti-ctla4 antibodies
RU2828374C2 (ru) Применение иммуноконъюгатов к ceacam5 для лечения рака легкого
CN118613278A (zh) 癌症疗法中用于患者选择的cea测定
WO2026082894A1 (en) Ceacam5 antibody-drug conjugate for use in cancer therapy
CN118574639A (zh) Ceacam5 adc-抗pd1/pd-l1组合疗法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20702487

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: NC2021/0010032

Country of ref document: CO

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021014636

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 3129106

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021546257

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: DZP2021000503

Country of ref document: DZ

ENP Entry into the national phase

Ref document number: 2020219405

Country of ref document: AU

Date of ref document: 20200206

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020702487

Country of ref document: EP

Effective date: 20210907

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112021014636

Country of ref document: BR

Free format text: COM BASE NA LEGISLACAO VIGENTE, APRESENTAR OS CAMPOS 150 E 151 , REFERENTES A LISTAGEM DE SEQUENCIA.

WWP Wipo information: published in national office

Ref document number: NC2021/0010032

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112021014636

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210726

WWE Wipo information: entry into national phase

Ref document number: 521422478

Country of ref document: SA

WWR Wipo information: refused in national office

Ref document number: 521422478

Country of ref document: SA

WWD Wipo information: divisional of initial pct application

Ref document number: 818560

Country of ref document: NZ