WO2020118198A1 - Systems for protein-protein interaction screening - Google Patents
Systems for protein-protein interaction screening Download PDFInfo
- Publication number
- WO2020118198A1 WO2020118198A1 PCT/US2019/064969 US2019064969W WO2020118198A1 WO 2020118198 A1 WO2020118198 A1 WO 2020118198A1 US 2019064969 W US2019064969 W US 2019064969W WO 2020118198 A1 WO2020118198 A1 WO 2020118198A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- nucleic acid
- fragment
- protein
- certain embodiments
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1055—Protein x Protein interaction, e.g. two hybrid selection
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B06—GENERATING OR TRANSMITTING MECHANICAL VIBRATIONS IN GENERAL
- B06B—METHODS OR APPARATUS FOR GENERATING OR TRANSMITTING MECHANICAL VIBRATIONS OF INFRASONIC, SONIC, OR ULTRASONIC FREQUENCY, e.g. FOR PERFORMING MECHANICAL WORK IN GENERAL
- B06B1/00—Methods or apparatus for generating mechanical vibrations of infrasonic, sonic, or ultrasonic frequency
- B06B1/02—Methods or apparatus for generating mechanical vibrations of infrasonic, sonic, or ultrasonic frequency making use of electrical energy
- B06B1/0207—Driving circuits
- B06B1/0223—Driving circuits for generating signals continuous in time
- B06B1/0269—Driving circuits for generating signals continuous in time for generating multiple frequencies
- B06B1/0276—Driving circuits for generating signals continuous in time for generating multiple frequencies with simultaneous generation, e.g. with modulation, harmonics
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B06—GENERATING OR TRANSMITTING MECHANICAL VIBRATIONS IN GENERAL
- B06B—METHODS OR APPARATUS FOR GENERATING OR TRANSMITTING MECHANICAL VIBRATIONS OF INFRASONIC, SONIC, OR ULTRASONIC FREQUENCY, e.g. FOR PERFORMING MECHANICAL WORK IN GENERAL
- B06B1/00—Methods or apparatus for generating mechanical vibrations of infrasonic, sonic, or ultrasonic frequency
- B06B1/02—Methods or apparatus for generating mechanical vibrations of infrasonic, sonic, or ultrasonic frequency making use of electrical energy
- B06B1/0292—Electrostatic transducers, e.g. electret-type
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/34—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
- C12Q1/37—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase involving peptidase or proteinase
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B30/00—Methods of screening libraries
- C40B30/04—Methods of screening libraries by measuring the ability to specifically bind a target molecule, e.g. antibody-antigen binding, receptor-ligand binding
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/536—Immunoassay; Biospecific binding assay; Materials therefor with immune complex formed in liquid phase
- G01N33/542—Immunoassay; Biospecific binding assay; Materials therefor with immune complex formed in liquid phase with steric inhibition or signal modification, e.g. fluorescent quenching
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
- G01N33/6845—Methods of identifying protein-protein interactions in protein mixtures
-
- G—PHYSICS
- G06—COMPUTING OR CALCULATING; COUNTING
- G06V—IMAGE OR VIDEO RECOGNITION OR UNDERSTANDING
- G06V40/00—Recognition of biometric, human-related or animal-related patterns in image or video data
- G06V40/10—Human or animal bodies, e.g. vehicle occupants or pedestrians; Body parts, e.g. hands
- G06V40/12—Fingerprints or palmprints
- G06V40/13—Sensors therefor
- G06V40/1306—Sensors therefor non-optical, e.g. ultrasonic or capacitive sensing
-
- H—ELECTRICITY
- H10—SEMICONDUCTOR DEVICES; ELECTRIC SOLID-STATE DEVICES NOT OTHERWISE PROVIDED FOR
- H10K—ORGANIC ELECTRIC SOLID-STATE DEVICES
- H10K59/00—Integrated devices, or assemblies of multiple devices, comprising at least one organic light-emitting element covered by group H10K50/00
- H10K59/60—OLEDs integrated with inorganic light-sensitive elements, e.g. with inorganic solar cells or inorganic photodiodes
- H10K59/65—OLEDs integrated with inorganic image sensors
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B06—GENERATING OR TRANSMITTING MECHANICAL VIBRATIONS IN GENERAL
- B06B—METHODS OR APPARATUS FOR GENERATING OR TRANSMITTING MECHANICAL VIBRATIONS OF INFRASONIC, SONIC, OR ULTRASONIC FREQUENCY, e.g. FOR PERFORMING MECHANICAL WORK IN GENERAL
- B06B2201/00—Indexing scheme associated with B06B1/0207 for details covered by B06B1/0207 but not provided for in any of its subgroups
- B06B2201/70—Specific application
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/02—Screening involving studying the effect of compounds C on the interaction between interacting molecules A and B (e.g. A = enzyme and B = substrate for A, or A = receptor and B = ligand for the receptor)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/10—Screening for compounds of potential therapeutic value involving cells
-
- H—ELECTRICITY
- H10—SEMICONDUCTOR DEVICES; ELECTRIC SOLID-STATE DEVICES NOT OTHERWISE PROVIDED FOR
- H10K—ORGANIC ELECTRIC SOLID-STATE DEVICES
- H10K59/00—Integrated devices, or assemblies of multiple devices, comprising at least one organic light-emitting element covered by group H10K50/00
- H10K59/40—OLEDs integrated with touch screens
Definitions
- nucleic acids, systems, and methods useful for interrogating protein-protein interactions, screening for antagonists or agonists of protein-protein interactions or discovering novel protein-protein interactions are useful for screening small-molecule or biologic agonists or antagonists of signaling pathways, such as G- protein coupled receptors, receptor tyrosine kinases, ion channels, and nuclear receptors.
- the system comprises nucleic acids that encode: a) a bait protein fused to a non-functional fragment of an enzyme that can cleave a target sequence, or that can be cleaved by an
- a prey protein e.g., a test protein fused to a non-functional fragment of an enzyme that can cleave a target sequence, or that can be cleaved by an endogenous enzyme that complements the enzyme or target sequence in a), and a transcription regulating protein; and c) a reporter gene under the control of a regulatory element that can be bound by the transcription regulating protein.
- association of the bait and prey reconstitutes a fully functional enzyme or target sequence that allows the transcription regulating protein to be cleaved and to activate the reporter gene.
- the reporter gene comprises a unique molecular identifier (UMI), which is unique to each individual prey protein. This allows for multiplexing of an assay that can interrogate the effect any given stimulus has on bait and prey interaction.
- UMI unique molecular identifier
- a system for protein-protein interaction screening comprising: (a) a first nucleic acid encoding a bait polypeptide coupled to a first fragment of a ubiquitin polypeptide; (b) a second nucleic acid encoding a prey polypeptide coupled to a second fragment of a ubiquitin polypeptide and a transcription regulating polypeptide; and (c) a third nucleic acid comprising a reporter element, wherein said reporter element comprises a regulatory element, a first reporter gene and a second reporter gene, wherein said regulatory element is configured to be bound by said transcription regulating polypeptide, wherein said second reporter gene encodes an RNA sequence that is unique to said prey polypeptide; wherein said first fragment of a ubiquitin polypeptide and said second fragment of a ubiquitin polypeptide form a cleavable ubiquitin molecule when said bait polypeptide interacts with said prey polypeptide, whereupon said cle
- said first fragment of a ubiquitin polypeptide is a C-terminal fragment of a ubiquitin polypeptide
- said second fragment of a ubiquitin polypeptide is an N-terminal fragment of a ubiquitin polypeptide.
- said first fragment of a ubiquitin polypeptide is an N- terminal fragment of a ubiquitin polypeptide
- said second fragment of a ubiquitin polypeptide is a C-terminal fragment of a ubiquitin polypeptide.
- said transcription regulating polypeptide comprises a synthetic transcription factor.
- said synthetic transcription factor comprises a fusion of a Gal4 DNA binding domain and-VPR activation domain.
- said bait polypeptide or said prey polypeptide is a membrane bound signaling polypeptide.
- said membrane-bound bait polypeptide or said prey polypeptide comprises a G protein coupled receptor, a receptor tyrosine kinase, or an ion channel.
- said membrane-bound bait polypeptide or said prey polypeptide comprises a G protein coupled receptor.
- said bait polypeptide or said prey polypeptide is an intracellular signaling polypeptide.
- said intracellular bait polypeptide or said prey polypeptide comprises a nuclear hormone receptor.
- said bait polypeptide or said prey polypeptide comprises an intracellular molecule that potentially interacts with said signaling polypeptide.
- said regulatory element comprises an inducible regulatory element.
- said inducible regulatory element comprises a Gal4 Upstream activation
- said first reporter gene encodes a fluorescent protein, a luciferase protein, a beta-galactosidase, a beta-glucuronidase, a chloramphenicol acetyltransferase, or a secreted placental alkaline phosphatase.
- said first reporter gene encodes a fluorescent protein or a luciferase protein.
- said first nucleic acid comprises a sequence encoding a promoter-less fluorescent protein.
- said fluorescent protein is a green fluorescent protein.
- said first nucleic acid comprises a sequence that directs site specific integration into a genome.
- said first nucleic acid comprises an attB sequence that directs site specific integration into a genome.
- said second nucleic acid comprises a sequence encoding a selectable surface marker.
- said selectable surface marker is a hemagglutinin polypeptide.
- described herein is a cell comprising said first nucleic acid, said second nucleic acid, and/or said third nucleic acid.
- said first nucleic acid, said second nucleic acid, and/or said third nucleic acid are integrated at an integration site for a transposable element.
- said first nucleic acid, said second nucleic acid, and/or said third nucleic acid are integrated at a predetermined genomic location.
- described herein is a method for testing a test substances effect on a protein-protein interaction comprising contacting a cell or a populations of cells comprising the system described herein to said test substance.
- the test substance is a chemical.
- a system for protein-protein interaction screening comprising: (a) a first nucleic acid encoding a bait polypeptide coupled to a first fragment of a protease polypeptide, a protease cleavage site, and a transcription regulating polypeptide; (b) a second nucleic acid encoding a prey polypeptide coupled to a second fragment of a protease polypeptide; and (c) a third nucleic acid comprising a reporter element, wherein said reporter element comprises a regulatory element, a first reporter gene and a second reporter gene, wherein said regulatory element is configured to be bound by said transcription regulating polypeptide, wherein said second reporter gene encodes an RNA sequence that is unique to said prey polypeptide; wherein said first fragment of a protease polypeptide and said second fragment of a protease polypeptide form an active protease when said bait polypeptide interacts with said prey polypeptide,
- said first fragment of a protease polypeptide is a C-terminal fragment of a protease polypeptide
- said second fragment of a protease polypeptide is an N- terminal fragment of a protease polypeptide.
- said first fragment of a protease polypeptide is a N-terminal fragment of a protease polypeptide
- said second fragment of a protease polypeptide is a C-terminal fragment of a protease polypeptide.
- said first fragment of a protease polypeptide and said second fragment of a protease polypeptide are derived from Tobacco Etch Virus nuclear -inclusion-a endopeptidase
- said transcription regulating polypeptide comprises a synthetic transcription factor.
- said synthetic transcription factor comprises a fusion of a Gal4 DNA binding domain and-VPR activation domain.
- said second nucleic acid encodes a second transcription regulating polypeptide coupled to said prey polypeptide, wherein said second transcription regulating polypeptide is configured to be cleaved by said active protease.
- said bait polypeptide or said prey polypeptide is a membrane bound signaling polypeptide.
- said membrane-bound bait polypeptide or said prey polypeptide comprises a G protein coupled receptor, a receptor tyrosine kinase, or an ion channel.
- said membrane- bound signaling polypeptide or said prey polypeptide comprises a G protein coupled receptor.
- said bait polypeptide or said prey polypeptide is an intracellular signaling polypeptide.
- said intracellular bait polypeptide or said prey polypeptide comprises a nuclear hormone receptor.
- said bait polypeptide or said prey polypeptide comprises an intracellular molecule that potentially interacts with said bait polypeptide.
- said regulatory element comprises an inducible regulatory element.
- said inducible regulatory element comprises a Gal4 Upstream activation Sequence (Gal4 UAS).
- said first reporter gene encodes a fluorescent protein, a luciferase protein, a beta-galactosidase, a beta-glucuronidase, a
- said first reporter gene encodes a fluorescent protein or a luciferase protein.
- said first nucleic acid comprises a sequence encoding a promoter-less fluorescent protein.
- said fluorescent protein is a green fluorescent protein.
- said first nucleic acid comprises a sequence that directs site specific integration into a genome.
- said first nucleic acid comprises an attB sequence that directs site specific integration into a genome.
- said second nucleic acid comprises a sequence encoding a selectable surface marker.
- said selectable surface marker is a hemagglutinin polypeptide.
- a cell comprising said first nucleic acid, said second nucleic acid, and/or said third nucleic acid.
- said first nucleic acid, said second nucleic acid, and/or said third nucleic acid are integrated at an integration site for a transposable element.
- said first nucleic acid, said second nucleic acid, and/or said third nucleic acid are integrated at a predetermined genomic location.
- described herein is a method for testing a test substances effect on a protein-protein interaction comprising contacting a cell or a populations of cells comprising the system described herein to said test substance.
- the test substance is a chemical.
- FIG. 1A depicts a schematic of a split protease (left) or split-ubiquitin (right) protein- protein interaction system at steady state before binding of bait polypeptide (ARRB2) to a prey polypeptide (membrane-associated).
- ARRB2 bait polypeptide
- FIG. IB depicts a schematic of a split protease (left) or split-ubiquitin (right) protein- protein interaction system at steady state after binding of bait polypeptide (ARRB2) to a prey polypeptide (membrane-associated).
- ARRB2 bait polypeptide
- FIG. 2 illustrates fold induction of a luminescent reporter split-ubiquitin compared to a dual-split-TEV system.
- FIG. 3A depicts a dose response curve of cells using a split-ubiquitin protein-protein interaction system and treated with Xamoterol.
- FIG. 3B depicts a dose response curve of cells using a dual-split-TEV protein-protein interaction system and treated with Xamoterol.
- a system for protein-protein interaction screening comprising: (a) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a ubiquitin polypeptide; (b) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a ubiquitin polypeptide, and a transcription regulating polypeptide; and (c) a third nucleic acid comprising a regulatory element, which is bound by said transcription regulating polypeptide and a reporter element; wherein said first fragment of a ubiquitin polypeptide and said second fragment of a ubiquitin polypeptide form a cleavable ubiquitin molecule when said bait polypeptide interacts with said prey polypeptide, whereupon said cleavable ubiquitin molecule is cleaved by a deubiquitinating enzyme, said transcription regulating polypeptide is released
- a system for protein-protein interaction screening comprising: (a) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a ubiquitin polypeptide; and (b) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a ubiquitin polypeptide, and a transcription regulating polypeptide and comprising a regulatory element, which is bound by said transcription regulating polypeptide and a reporter element; wherein said first fragment of a ubiquitin polypeptide and said second fragment of a ubiquitin polypeptide form a cleavable ubiquitin molecule when said bait polypeptide interacts with said prey polypeptide, whereupon said cleavable ubiquitin molecule is cleaved by a deubiquitinating enzyme, said transcription regulating polypeptide is released from said bait polypeptide, binds
- a system for protein-protein interaction screening comprising: (a) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a ubiquitin polypeptide, and comprising a regulatory element, which is bound by a transcription regulating polypeptide and a reporter element; and (b) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a ubiquitin polypeptide, and said transcription regulating polypeptide; wherein said first fragment of a ubiquitin polypeptide and said second fragment of a ubiquitin polypeptide form a cleavable ubiquitin molecule when said bait polypeptide interacts with said prey polypeptide, whereupon said cleavable ubiquitin molecule is cleaved by a deubiquitinating enzyme, said transcription regulating polypeptide is released from said bait polypeptide, bind
- a method to assay for protein-protein interaction comprising: (a) subjecting a cell to a physical or chemical stimulus, said cell comprising: (i) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a ubiquitin polypeptide; (ii) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a ubiquitin polypeptide, and a transcription regulating polypeptide; and (iii) a third nucleic acid comprising a regulatory element, which is bound by said transcription regulating polypeptide and a reporter element; wherein said first fragment of a ubiquitin polypeptide and said second fragment of a ubiquitin polypeptide form a cleavable ubiquitin molecule when said bait polypeptide interacts with said prey polypeptide, whereupon said cleavable ubiquitin
- a method to assay for protein-protein interaction comprising: (a) subjecting a cell to a physical or chemical stimulus, said cell comprising: (i) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a ubiquitin polypeptide; and (ii) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a ubiquitin polypeptide, and a transcription regulating polypeptide, and comprising a regulatory element, which is bound by said transcription regulating polypeptide and a reporter element; wherein said first fragment of a ubiquitin polypeptide and said second fragment of a ubiquitin polypeptide form a cleavable ubiquitin molecule when said bait polypeptide interacts with said prey polypeptide, whereupon said cleavable ubiquitin molecule is cleaved by a de
- a method to assay for protein-protein interaction comprising: (a) subjecting a cell to a physical or chemical stimulus, said cell comprising: (i) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a ubiquitin polypeptide, and comprising a regulatory element, which is bound by a transcription regulating polypeptide and a reporter element; and (ii) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a ubiquitin polypeptide, and said transcription regulating polypeptide; wherein said first fragment of a ubiquitin polypeptide and said second fragment of a ubiquitin polypeptide form a cleavable ubiquitin molecule when said bait polypeptide interacts with said prey polypeptide, whereupon said cleavable ubiquitin molecule is cleaved by a de
- a system for protein-protein interaction screening comprising: (a) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a protease polypeptide, a protease cleavage site, and a transcription regulating polypeptide; (b) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a protease polypeptide; and (c) a third nucleic acid comprising a regulatory element, which is bound by said transcription regulating polypeptide and a reporter element; wherein said first fragment of a protease polypeptide and said second fragment of a protease polypeptide form an active protease when said bait polypeptide interacts with said prey polypeptide, whereupon said protease cleavage site is cleaved by said active protease, said transcription regulating polypeptide is
- a system for protein-protein interaction screening comprising: (a) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a protease polypeptide, a protease cleavage site, and a transcription regulating polypeptide; (b) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a protease polypeptide, and comprising a regulatory element, which is bound by said transcription regulating polypeptide and a reporter element; wherein said first fragment of a protease polypeptide and said second fragment of a protease polypeptide form an active protease when said bait polypeptide interacts with said prey polypeptide, whereupon said protease cleavage site is cleaved by said active protease, said transcription regulating polypeptide is released from said bait polypeptide, bind
- a system for protein-protein interaction screening comprising: (a) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a protease polypeptide, a protease cleavage site, and a transcription regulating polypeptide, and comprising a regulatory element, which is bound by said
- transcription regulating polypeptide and a reporter element (b) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a protease polypeptide; wherein said first fragment of a protease polypeptide and said second fragment of a protease polypeptide form an active protease when said bait polypeptide interacts with said prey polypeptide, whereupon said protease cleavage site is cleaved by said active protease, said transcription regulating polypeptide is released from said bait polypeptide, binds to said regulatory element, and initiates transcription of said reporter element.
- a method to assay for protein-protein interaction comprising: (a) subjecting a cell to a physical or chemical stimulus, said cell comprising: (i) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a protease polypeptide, a protease cleavage site, and a transcription regulating polypeptide; (ii) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a protease polypeptide; and (iii) a third nucleic acid comprising a regulatory element, which is bound by said transcription regulating polypeptide and a reporter element; wherein said first fragment of a protease polypeptide and said second fragment of a protease polypeptide form an active protease when said bait polypeptide interacts with said prey polypeptide, whereupon said protease
- a method to assay for protein-protein interaction comprising: (a) subjecting a cell to a physical or chemical stimulus, said cell comprising: (i) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a protease polypeptide, a protease cleavage site, and a transcription regulating polypeptide; (ii) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a protease polypeptide and comprising a regulatory element, which is bound by said transcription regulating polypeptide, and a reporter element; wherein said first fragment of a protease polypeptide and said second fragment of a protease polypeptide form an active protease when said bait polypeptide interacts with said prey polypeptide, whereupon said protease cleavage site is cleaved by said
- a method to assay for protein-protein interaction comprising: (a) subjecting a cell to a physical or chemical stimulus, said cell comprising: (i) a first nucleic acid encoding a bait polypeptide or prey polypeptide coupled to a first fragment of a protease polypeptide, a protease cleavage site, and a transcription regulating polypeptide and comprising a regulatory element, which is bound by said transcription regulating polypeptide and a reporter element; (ii) a second nucleic acid encoding a prey polypeptide or a bait polypeptide coupled to a second fragment of a protease polypeptide; wherein said first fragment of a protease polypeptide, and said second fragment of a protease polypeptide form an active protease when said bait polypeptide interacts with said prey polypeptide, whereupon said protease cleavage site is cleaved by said
- polypeptide and“protein” are used interchangeably to refer to a polymer of amino acid residues and are not limited to a minimum length.
- Polypeptides including the provided polypeptide chains and other peptides, e.g., linkers and binding peptides, may include amino acid residues including natural and/or non-natural amino acid residues.
- the terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, phosphorylation, and the like.
- the polypeptides may contain modifications with respect to a native or natural sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification.
- Percent (%) sequence identity with respect to a reference polypeptide sequence is the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of
- determining percent amino acid sequence identity can be achieved in various ways that are known for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Appropriate parameters for aligning sequences are able to be determined, including algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from the source code.
- the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y, where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B.
- the polypeptides of the systems described herein can be encoded by a nucleic acid.
- a nucleic acid is a type of polynucleotide comprising two or more nucleotide bases.
- the nucleic acid is a component of a vector that can be used to transfer the polypeptide encoding polynucleotide into a cell.
- the term“vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- vectors capable of directing the expression of genes to which they are operatively linked are referred to herein as “expression vectors.” Suitable vectors comprise plasmids, bacterial artificial chromosomes, yeast artificial chromosomes, viral vectors and the like. In the expression vectors regulatory elements such as promoters, enhancers, polyadenylation signals for use in controlling transcription can be derived from mammalian, microbial, viral or insect genes.
- Vectors derived from viruses such as lentiviruses, retroviruses, adenoviruses, adeno-associated viruses, and the like, may be employed. Plasmid vectors can be linearized for integration into a chromosomal location. Vectors can comprise sequences that direct site-specific integration into a defined location or restricted set of sites in the genome (e.g., AttP-AttB recombination). Additionally, vectors can comprise sequences derived from transposable elements for integration.
- transfection refers to methods that intentionally introduce an exogenous nucleic acid into a cell through a process commonly used in laboratories. Transfection can be affected by, for example, lipofection, calcium phosphate precipitation, viral transduction, or electroporation. Transfection can be either transient or stable.
- the systems, nucleic acids, and methods described herein are useful to screen for protein-protein interactions.
- protein-protein interactions can be measured before and after an external stimulus such as a physical or chemical stimulus, or compared to control conditions run in parallel.
- the chemical stimulus can be an agonistic or antagonistic small molecule or biologic molecule.
- the system is useful for screening for pharmaceutical discovery purposes.
- the system minimally comprises nucleic acid(s) encoding a bait polypeptide, a prey polypeptide, and a reporter element.
- the bait polypeptide comprises a first fragment of a cleavable molecule or a cleaving molecule (e.g., a protease).
- the prey polypeptide comprises a second fragment of a cleavable molecule or a cleaving molecule.
- the prey polypeptide is a library of a plurality of prey polypeptides each encoded by a distinct nucleic acid and paired with a distinct reporter, such as for example a unique molecular identifier.
- Either the prey polypeptide or the bait polypeptide further comprises a transcription regulating polypeptide.
- the transcription regulating polypeptide is released either by cleavage of a fully formed protease supplied by the system, or an endogenous protease that acts on a cleavable molecule.
- a transcription activating polypeptide is released.
- the released transcription activating polypeptide then activates transcription of a reporter gene under the control of a promoter able to be bound by the transcription activating polypeptide.
- the reporter gene is unique to a certain prey polypeptide.
- Additional optional features of the system include a second transcription regulating provided, either conjugated to the same polypeptide as the first transcription regulating polypeptide or provided on the other polypeptide. Additionally, in certain embodiments, the transcription regulating polypeptide is replaced with a transcriptional repressor polypeptide that can bind a repressor element that is 5’ to a constitutively active reporter element, the reporter element comprising a reporter gene and a UMI. This allows for determining a disruption of a protein-protein interaction.
- the nucleic acids comprising this system may also comprise additional elements that allow for identification and selection of cells that have been transfected with the components of the system described herein.
- polypeptide, and comprising a reporter element are present on separate nucleic acid molecules, for example separate plasmids or viral vectors.
- the reporter element is present on the same nucleic acid molecule as the bait polypeptide.
- the reporter element is present on the same nucleic acid molecule as the prey polypeptide.
- nucleic acid(s) encoding a bait polypeptide, a prey polypeptide, and a reporter element for use in drug discovery.
- the method comprises contacting the nucleic acid(s) with a cell or population of cells under conditions sufficient for the nucleic acid(s) to be internalized and expressed by the cell (e.g., transfected); contacting the cell with a physical or chemical stimulus; and determining activation of the reporter element by one or more assays.
- the method comprises contacting a cell or population of cells comprising nucleic acid(s) encoding a bait polypeptide, a prey polypeptide, and a reporter element; and determining activation of the reporter element by one or more assays.
- FIG. 1A and IB depicts a single interaction in a single cell. It will be understood however that this reaction occurs many times in a single cell, and that different cells can comprise different specific prey polypeptides that are part of a library comprising at least 10 1 , 10 2 , 10 3 , 10 4 , 10 5 distinct prey polypeptides.
- a prey polypeptide is coupled to a fragment of either a protease (TEV, left side), or ubiquitin (Ub, right side).
- the prey polypeptide which is a library of potential interactors, comprises a complementary fragment of TEV or Ub that can functionally complement the activity of the fragment coupled to the bait.
- the schematic shows a transmembrane bait, but this could, in certain embodiments, be a soluble cytosolic polypeptide, or one that exists associated with the membrane of an intracellular organelle.
- the functionally reconstituted protease cleaves a protease cleavage site (TCS) to release a transcription factor (TF) that can bind a promoter that activates a reporter element through its activation domain (Gal4).
- TCS protease cleavage site
- TF transcription factor
- Gal4 activation domain
- deubiquitinating enzyme can cleave the fully reconstituted ubiquitin to release a transcription factor (TF) that can bind a promoter that activates a reporter element through its activation domain (Gal4).
- TF transcription factor
- Gal4 activation domain
- the systems, nucleic acids, and methods described herein are useful in interrogating protein-protein interactions between a bait polypeptide and a prey polypeptide.
- the interaction of bait or prey polypeptides may be of interest if they play a role in the pathology or etiology of a human disease. Therefore, systems that can provide multiplexed and efficient methods of testing interactions between a bait polypeptide and a prey polypeptide that interacts with the bait polypeptide have high utility.
- the bait or prey polypeptide comprises a cell surface expressed receptor or channel protein.
- Cell surface signaling polypeptides are proteins that are inserted or tethered to the membrane and transduce a signal that effects biological function of the cell when bound by a ligand or effected by a physical stimulus.
- the bait polypeptide comprises a G protein-coupled receptor, a receptor tyrosine kinase, or an ion channel.
- the bait or prey polypeptide comprises a G protein coupled receptor family member.
- G protein-coupled receptors also known as seven-(pass)- transmembrane domain receptors, are ligand binding cell surface signaling proteins.
- GPCRs G protein-coupled receptors
- GEF guanine nucleotide exchange factor
- the GPCR can then activate an associated G protein by exchanging the GDP bound to the G protein for a GTP.
- the G protein's a subunit, together with the bound GTP, can then dissociate from the b and g subunits to further affect intracellular signaling proteins or target functional proteins directly depending on the a subunit type (Gas, Gai/o, Gaq/11, Gal2/13).
- a subunit type Gas, Gai/o, Gaq/11, Gal2/13.
- the bait or prey polypeptide comprises a receptor tyrosine kinase family member.
- Receptor tyrosine kinases are high-affinity cell surface receptors for many polypeptide growth factors, cytokines, and hormones. Receptor tyrosine kinases have been shown not only to be key regulators of normal cellular processes but also to have a critical role in the development and progression of many types of cancer. There are many classes of RTKs any member of which can be utilized as the bait or prey polypeptide in the systems described herein.
- the RTK bait polypeptide comprises an RTK class I (EGF receptor family) (ErbB family); RTK class II (Insulin receptor family); RTK class III (PDGF receptor family); RTK class IV (VEGF receptors family); RTK class V (FGF receptor family); RTK class VI (CCK receptor family); RTK class VII (NGF receptor family); RTK class VIII (HGF receptor family); RTK class IX (Eph receptor family); RTK class X (AXL receptor family); RTK class XI (TIE receptor family); RTK class XII (RYK receptor family); RTK class XIII (DDR receptor family); RTK class XIV (RET receptor family); RTK class XV (ROS receptor family); RTK class XVI (LTK receptor family); RTK class XVII (ROR receptor family); RTK class XVIII (MuSK receptor family); RTK class XIX (LMR receptor); or RTK class XX (Undetermined) member.
- RTK class I Ep
- the bait or prey polypeptide comprises an ion channel.
- Ion channels are pore-forming membrane proteins that allow ions to pass through the channel pore. Ion channels may be classified by gating such as voltage gating, ligand gating, cyclic nucleotide gating, mechanosensitive gating, gating by other ions (e.g., calcium), light gating, or temperature gating. Ion channels may also be classified by type of ion gated and include potassium, sodium, calcium, protons, non-selective cation, or chloride.
- the bait or prey polypeptide comprises an intracellular signaling protein.
- the intracellular signaling protein comprises a nuclear hormone receptor.
- Nuclear hormone receptors are a class of intracellular proteins which are bound by small-molecule ligands and interact with other proteins to initiate transcription in the nucleus. Nuclear hormone receptors can exist in the cytosol associated with chaperone molecules or in the nucleus associated with DNA.
- Nuclear hormone receptors are divided into several groups as follows: Thyroid hormone receptor; Retinoic acid receptor; Peroxisome proliferator- activated receptor; Rev-ErbA; RAR-related orphan receptor; Liver X receptor-like; Vitamin D receptor-like; NRs with two DNA binding domains; Hepatocyte nuclear factor-4; Retinoid X receptor; Testicular receptor; TLX/PNR; COUP/EAR; Estrogen receptor; Estrogen related receptor; 3 -Ketosteroid receptors; NGFIB/NURRl/NORl; SF1/LRH1; GCNF; and DAX/SHP.
- Nuclear hormone receptors are denoted by an NRNC Symbol: NRIAI; NR1A2; NRIBI; NR1B2; NR1B3; NRICI; NR1C2; NR1C3; NR1D1; NR1D2; NRIFI;
- the bait or prey polypeptide comprises any one or more of: NR1A1;
- the methods used herein will be used to interrogate one or a small number of bait polypeptides compared to a large number of prey polypeptides.
- multiple GPCRs might interact with a single Ga subunit.
- a common Ga the bait polypeptide
- the prey polypeptide is supplied as a plurality of prey polypeptides, encoded by a plurality of nucleic acids, that interact or potentially interact with a single bait polypeptide.
- the system described above can be effectively utilized using a variety of methods.
- the system is useful in methods to interrogate protein-protein interactions, both at a steady-state and in response to a physical or chemical stimulus.
- the reporter element comprises a UMI mated to a particular prey polypeptide the system can be deployed in a multiplexed assay.
- a plurality of cells are incubated in one well of a multi-well plate.
- the plurality of cells are transfected with a plurality of nucleic acids encoding a library of prey polypeptides coupled to a transcription regulating polypeptide and comprising reporter elements with a prey polypeptide specific UMI.
- the cells can already comprise a nucleic acid encoding a bait polypeptide, or the nucleic acid encoding the bait polypeptide can be transfected along with the prey polypeptide.
- the transfected cells are then contacted with a chemical stimulus, after a sufficient amount of time to allow for expression of a reporter gene comprising the UMI, cell lysates are harvested, mRNA is reverse transcribed, and sequencing of the UMIs is performed by a next-generation sequencing technology. Sequencing results will indicate if transcription was activated, and the magnitude of any activation. In this example, activation would be indicative of a chemical stimulus causing the prey polypeptide to closely associate with the bait polypeptide. If the prey polypeptide comprises a transcriptional repressor then the opposite interaction can be interrogated (e.g., a chemical stimulus leading to disruption of a protein-protein interaction).
- the assays are carried out in multiwell formats such as 6, 12, 24, 48, 96, or 384-well format.
- each well is supplied with a different test chemical, or the test chemicals are supplied in duplicate, triplicate, or quadruplicate wells.
- the assay can also comprise one or more positive or a negative control wells.
- the systems, nucleic acids, and methods described herein rely on molecular complementation of two fragments of a cleavable molecule.
- the bait polypeptide comprises a first fragment and the prey polypeptide comprises a second fragment. While the first and second fragment can overlap each fragment independently lacks full function. As a result, when the bait polypeptide and the prey polypeptide are brought into proximity the first and second fragment combine to form a single cleavable molecule.
- the cleavable molecule for use with the systems, nucleic acids, and methods described herein is a ubiquitin molecule.
- Ubiquitin is a 76 amino acid protein that is highly conserved amongst eukaryotes and plays a key role in protein homeostasis. When ubiquitin is added to a polypeptide it marks that polypeptide for destruction by various cellular processes. Ubiquitin is recycled by cleavage from the marked polypeptide by a deubiquitinating enzyme.
- the Ubiquitin-60S ribosomal protein L40 comprises the following sequence:
- nucleic acids described herein encode a fragment of a ubiquitin molecule at least about 25, 30,
- a first fragment of a ubiquitin polypeptide is a C-terminal fragment of a ubiquitin polypeptide (Cub), and a second fragment of a ubiquitin polypeptide is an N-terminal fragment of a ubiquitin polypeptide (Nub).
- a first fragment of a ubiquitin polypeptide is an N- terminal fragment of a ubiquitin polypeptide (Nub), and a second fragment of a ubiquitin polypeptide is a C-terminal fragment of a ubiquitin polypeptide (Cub).
- the systems, nucleic acids, and methods described herein rely on molecular complementation of two fragments of a protease molecule.
- the bait polypeptide comprises a first fragment and the prey polypeptide comprises a second fragment. While the first and second fragment can overlap each fragment independently lacks full function. As a result, when the bait polypeptide and the prey polypeptide are brought into proximity the first and second fragment combine to form a single functional protease molecule.
- the functional protease for use with the methods, nucleic acids, and systems described herein is a from Tobacco Etch Virus nuclear -inclusion-a
- TEV protease endopeptidase
- the nucleic acids described herein encode a fragment of a TEV at least about 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids in length, or any integer therein, and at least about 90%, 95%, 97%, 98%, 99%, or 100% identical to that set forth in SEQ ID NO: X.
- TEV is highly specific and cleaves a polypeptide comprising the amino acid sequence EXLY ⁇ E>Q ⁇ cp where X is any residue, F is any large or medium hydrophobic residue and f is any small hydrophobic or polar residue. TEV exhibits optimal efficiency against the ENLYFQ ⁇ S amino acid sequence.
- a first fragment of a TEV polypeptide is a C-terminal fragment of a TEV polypeptide (CTEV), and a second fragment of a TEV polypeptide is an N-terminal fragment of a TEV polypeptide (NTEV).
- CTEV C-terminal fragment of a TEV polypeptide
- NTEV N-terminal fragment of a TEV polypeptide
- a first fragment of a TEV polypeptide is an N-terminal fragment of a TEV polypeptide (NTEV), and a second fragment of a TEV polypeptide is a C-terminal fragment of a ubiquitin polypeptide (CTEV).
- NTEV N-terminal fragment of a TEV polypeptide
- CTEV ubiquitin polypeptide
- a transcription regulating polypeptide is further present coupled to the bait polypeptide or the prey polypeptide.
- the transcription regulating polypeptide Upon molecular complementation of a split cleavage molecule or a split cleavable molecule the transcription regulating polypeptide is cleaved and released in an active form. This cleavage can be affected by either an endogenous enzyme (e.g., a deubiquitinating enzyme), or by the action of the split molecule itself (e.g., a reconstituted TEV protease).
- a transcription regulating polypeptide is coupled to the prey polypeptide.
- a transcription regulating polypeptide is coupled to the bait polypeptide.
- the system comprises two transcription regulating polypeptides that are coupled to the same polypeptide or different polypeptides.
- the prey polypeptide is coupled to a transcription regulating polypeptide; and the bait polypeptide is coupled to a transcription regulating polypeptide.
- the transcription regulating polypeptide is a transcription factor.
- the system described herein is compatible with any transcription factor commonly or potentially useable in a reporter assay.
- Common transcription factors used include LexA, Gal4, VP16 (from Herpes Simplex Virus), heat shock factor (HSF), NFAT, or CREB.
- the transcription factor is a synthetic transcription factor comprising a DNA bonding domain from a first transcription factor, and a transcription regulating domain from a second transcription factor.
- the transcription factor comprises a GAL4- VP16 chimeric transcription factor.
- the transcription factor comprises a GAL4-VPR chimeric transcription factor. The sequence of the Gal4-VPR chimeric transcription factor is given by the sequence set forth
- the system can provide information on a loss of protein- protein interaction, by employing a transcriptional repressor.
- the transcription regulating polypeptide is a transcriptional repressor.
- the transcriptional repressor comprises a KRAB domain (sequence RTLVTFKDVFVDFTR
- the transcriptional repressor is a synthetic repressor comprising a DNA bonding domain from a first transcription factor, and a transcriptional repressor domain from a transcriptional repressor protein.
- the transcriptional repressor with an amino acid sequence at least about 90%, 95%, 97%, 98%, 99%, or 100% identical to that set forth in SEQ ID NO: 4.
- the transcription regulating polypeptide is a synthetic transcription factor
- Synthetic transcription factors are artificial proteins capable of targeting and modulating gene expression. Some synthetic transcription factors are chimeric proteins containing domains from multiple different genes. In certain embodiments, synthetic transcription factors comprise a DNA binding domain from one gene and transcriptional regulatory domain from another gene.
- said synthetic transcription factor has a higher specificity for a regulatory element nucleotide sequence than any endogenous transcription factor. In certain embodiments, said synthetic transcription factor binds a synthetic transcription factor promoter nucleotide sequence not capable of being bound by an endogenous promoter. In certain embodiments, said synthetic transcription factor results in less background production of a reporter than would occur with use of an endogenous transcription factor.
- said DNA binding domain is non-endogenous to a cell containing a transcriptional relay system of the present invention.
- said DNA binding domain from a first transcription factor is from Gal 4, PPR1, LexA, Lac9, or combinations thereof.
- said DNA binding domain comprises an amino acid sequence set forth in
- said DNA binding domain comprises an amino acid sequence set forth in
- said DNA binding domain comprises an amino acid sequence set forth in
- said DNA binding domain comprises an amino acid sequence set forth in
- said DNA binding domain comprises an amino acid sequence set forth in
- said DNA binding domain comprises an amino acid sequence set forth in
- said DNA binding domain comprises an amino acid sequence set forth in
- said DNA binding domain comprises an amino acid sequence set forth in
- said DNA binding domain comprises an amino acid sequence variant of SEQ ID NO: 1.
- the amino acid sequence variant of SEQ ID NO: 1 is R15W, K23P, K23T, K23W, K23M, K23N, F68R, F68Q, L69P, L70P, Q9E, Q9A,
- amino acid sequence variant of SEQ ID NO: 21 is R15W. In certain embodiments, the amino acid sequence variant of SEQ ID NO: 21 is K23P. In certain
- the amino acid sequence variant of SEQ ID NO: 21 is K23T.
- the amino acid sequence variant of SEQ ID NO: 21 is K23W. In certain embodiments, the amino acid sequence variant of SEQ ID NO: 21 is K23M. In certain embodiments, the amino acid sequence variant of SEQ ID NO: 21 is K23N. In certain embodiments, the amino acid sequence variant of SEQ ID NO: 21 is K23W. In certain embodiments, the amino acid sequence variant of SEQ ID NO: 21 is K23M. In certain embodiments, the amino acid sequence variant of SEQ ID NO: 21 is K23N. In certain
- amino acid sequence variant of SEQ ID NO: 21 is F68R.
- amino acid sequence variant of SEQ ID NO: 21 is F68Q.
- the amino acid sequence variant of SEQ ID NO: 21 is L69P. In certain embodiments, the amino acid sequence variant of SEQ ID NO: 21 is L69P.
- the amino acid sequence variant of SEQ ID NO: 21 is L70P. In certain embodiments, the amino acid sequence variant of SEQ ID NO: 21 is L70P.
- amino acid sequence variant of SEQ ID NO: 21 is Q9E.
- the amino acid sequence variant of SEQ ID NO: 21 is Q9A.
- the amino acid sequence variant of SEQ ID NO: 21 is Q9N.
- the amino acid sequence variant of SEQ ID NO: 21 is R15K.
- the amino acid sequence variant of SEQ ID NO: 21 is R15A.
- the amino acid sequence variant of SEQ ID NO: 21 is R15M. In certain embodiments, the amino acid sequence variant of SEQ ID NO: 21 is K18R. In certain
- the amino acid sequence variant of SEQ ID NO: 21 is K18A.
- the amino acid sequence variant of SEQ ID NO: 21 is K18M. In certain embodiments, the amino acid sequence variant of SEQ ID NO: 21 is K23R. In certain
- the amino acid sequence variant of SEQ ID NO: 21 is K23A.
- the amino acid sequence variant of SEQ ID NO: 21 is K23M.
- said transcription activating domain from a second transcription factor is from VP64, p65, and Rta, and combinations thereof.
- said transcription activating domain comprises the amino acid sequence set forth in: R AGKPIPNPLLGLD S TD ALDDFDLDMLGSD ALDDFDLDMLGSD ALDDFDLDMLGSD ALDDFDLDMLGSPKKKRK V GS Q YLPDTDDRHRIEEKRKRT YETFK SIMKK SPF S GPTDP RPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVL PQAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFD DEDLGALLGN STDP AVFTDL AS VDN SEF QQLLNQGIP VAPHTTEPMLMEYPE AITRL VT G AQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISSGSGSGSRDSREGMFLP KPEAGSAISDVFEGREVCQPKRIRPFHPPGSPWANRPLPASLAPTPTGPVHEP
- the nucleic acids described herein encode a transcription factor with a VPR amino acid sequence at least 90% 95%, 97%, 98%, 99%, or 100% identical to that set forth in SEQ ID NO: 14. In certain embodiments, the nucleic acids described herein encode a transcription factor with a VPR amino acid sequence at least 90% identical to that set forth in SEQ ID NO: 14. In certain embodiments, the nucleic acids described herein encode a transcription factor with a VPR amino acid sequence at least 95% identical to that set forth in SEQ ID NO: 14. In certain embodiments, the nucleic acids described herein encode a
- nucleic acids described herein encode a
- nucleic acids described herein encode a
- nucleic acids described herein encode a
- a transcription activating domain on a synthetic transcription factor comprises an amino acid sequence variant that increases or decreases transcriptional activation.
- said transcription activating domain comprising an amino acid sequence variant that increases or decreases transcriptional activation is a sequence variant of SEQ ID NO: 14.
- a synthetic transcription factor encoded by a nucleic acid sequence of a transcription factor nucleic acid comprises a polypeptide sequence that destabilizes said synthetic transcription factors, also termed a“degron.”
- said polypeptide sequence that destabilizes said transcription factor comprises a PEST polypeptide sequence.
- a PEST polypeptide sequence is a polypeptide sequence containing a plurality of amino acids, wherein said polypeptide sequence is rich in the amino acids proline, glutamic acid, serine, and/or threonine.
- said polypeptide sequence that destabilizes said transcription factor comprises a CL1 polypeptide sequence.
- a CL1 polypeptide sequence may act as a degradation signal, leading to a shorter half-life of the resulting synthetic transcription factor.
- said polypeptide sequence that destabilizes said synthetic transcription factor aids in reduction of background signal of a reporter.
- said synthetic transcription factor comprises a GAL4-VP16 chimeric transcription factor.
- the transcription factor comprises a GAL4- VPR chimeric transcription factor.
- the sequence of the Gal4-VPR chimeric transcription factor is given by the sequence set forth
- the nucleic acids described herein encode a transcription factor with an amino acid sequence at least 90%, 95%, 97%, 98%, 99%, or 100% identical to that set forth in SEQ ID NO: 10. In certain embodiments, the nucleic acids described herein encode a transcription factor with an amino acid sequence at least 90% identical to that set forth in SEQ ID NO: 10. In certain embodiments, the nucleic acids described herein encode a transcription factor with an amino acid sequence at least 95% identical to that set forth in SEQ ID NO: 10. In certain embodiments, the nucleic acids described herein encode a transcription factor with an amino acid sequence at least 97% identical to that set forth in SEQ ID NO: 10.
- the nucleic acids described herein encode a transcription factor with an amino acid sequence at least 98% identical to that set forth in SEQ ID NO: 10. In certain embodiments, the nucleic acids described herein encode a transcription factor with an amino acid sequence at least 99% identical to that set forth in SEQ ID NO: 10. In certain embodiments, the nucleic acids described herein encode a transcription factor with an amino acid sequence 100% identical to that set forth in SEQ ID NO: 10.
- said synthetic transcription factor comprises a Gal4 DNA binding domain given by the amino acid sequence set forth in SEQ ID NO: 21. In certain embodiments, said synthetic transcription factor comprises a DNA binding domain with an amino acid sequence at least 90% 95%, 97%, 98%, 99%, or 100% identical to that set forth in SEQ ID NO: 21. In certain embodiments, said synthetic transcription factor comprises a DNA binding domain with an amino acid sequence at least 90% identical to that set forth in SEQ ID NO: 21. In certain embodiments, said synthetic transcription factor comprises a DNA binding domain with an amino acid sequence at least 95% identical to that set forth in SEQ ID NO: 21.
- said synthetic transcription factor comprises a DNA binding domain with an amino acid sequence at least 97% identical to that set forth in SEQ ID NO: 21. In certain embodiments, said synthetic transcription factor comprises a DNA binding domain with an amino acid sequence at least 98% identical to that set forth in SEQ ID NO: 21. In certain embodiments, said synthetic transcription factor comprises a DNA binding domain with an amino acid sequence at least 99% identical to that set forth in SEQ ID NO: 21. In certain embodiments, said synthetic transcription factor comprises a DNA binding domain with an amino acid sequence 100% identical to that set forth in SEQ ID NO: 21.
- said synthetic transcription factor comprises a transcription activating domain from VP64 given by the amino acid sequence set forth in
- said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 90% 95%, 97%, 98%, 99%, or 100% identical to that set forth in SEQ ID NO: 11. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 90% identical to that set forth in SEQ ID NO: 11. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 95% identical to that set forth in SEQ ID NO: 11.
- said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 97% identical to that set forth in SEQ ID NO: 11. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 98% identical to that set forth in SEQ ID NO: 11. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 99% identical to that set forth in SEQ ID NO: 11. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence 100% identical to that set forth in SEQ ID NO: 11.
- said synthetic transcription factor comprises a transcription activating domain from p65 given by the amino acid sequence set forth in
- said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 90% 95%, 97%, 98%, 99%, or 100% identical to that set forth in SEQ ID NO: 12. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 90% identical to that set forth in SEQ ID NO: 12. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 95% identical to that set forth in SEQ ID NO: 12. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 97% identical to that set forth in SEQ ID NO: 12.
- said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 98% identical to that set forth in SEQ ID NO: 12. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 99% identical to that set forth in SEQ ID NO: 12. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence 100% identical to that set forth in SEQ ID NO: 12.
- said synthetic transcription factor comprises a transcription activating domain from Rta given by the amino acid sequence set forth in
- said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 90% 95%, 97%, 98%, 99%, or 100% identical to that set forth in SEQ ID NO: 13.
- said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 90% identical to that set forth in SEQ ID NO: 13. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 95% identical to that set forth in SEQ ID NO: 13. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 97% identical to that set forth in SEQ ID NO: 13. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 98% identical to that set forth in SEQ ID NO: 13. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence at least 99% identical to that set forth in SEQ ID NO: 13. In certain embodiments, said synthetic transcription factor comprises a transcription activating domain with an amino acid sequence 100% identical to that set forth in SEQ ID NO: 13.
- the reporter element minimally comprises a regulatory element that is able to be bound by the transcription regulating polypeptide and a reporter gene.
- the reporter gene minimally comprises a unique molecular identifier (UMI).
- UMI unique molecular identifier
- a unique molecular identifier is a nucleotide sequence that is unique to a given prey polypeptide. Activation of the UMI reporter gene by the cleaved transcriptional activator can be determined by sequencing.
- the reporter element comprises a UMI and an additional reporter gene selected from a fluorescent protein, a luciferase gene, a beta-galactosidase gene, a beta-glucuronidase gene, a chloramphenicol acetyltransferase gene, a secreted placental alkaline phosphatase gene.
- these genes encode reporter polypeptides which can be assayed for a specific enzymatic activity, or in the case of a fluorescent reporter can be assayed for fluorescent emissions.
- the fluorescent protein comprises a green fluorescent protein (GFP), a red fluorescent protein (RFP), a yellow fluorescent protein (YFP), or a cyan fluorescent protein (CFP).
- the system described herein can utilize many different regulatory sequences that control activation of the reporter gene through transcription factor binding.
- the regulatory sequence is one that can be bound by the transcription regulating polypeptide or the
- the regulatory sequence is 5’ to the UMI, the reporter gene, or both.
- the regulatory sequence comprises a Gal4-UAS, which is able to be bound by a Gal4-VPR chimeric transcription factor.
- a UMI allows for multiplexing of different prey peptides in the same assay since transcription of the UMI will indicate association of a specific prey polypeptide with the bait.
- the UMI can be any length that allows for sufficient diversity to allow multiplexed
- the UMI will be between 8 and 20 nucleotides in length, however it may be longer.
- the UMI is 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nucleotides in length.
- Reporter activation can be measured in any suitable way that allows sequence determination of the UMI, with a preference for methods that allow sequence determination in a multiplex fashion.
- a next-generation sequencing technology is used to determine the sequence of the UMI.
- Next generation sequencing encompasses many kinds of sequencing such as pyrosequencing, sequencing-by-synthesis, single-molecule sequencing, second- generation sequencing, nanopore sequencing, sequencing by ligation, or sequencing by hybridization.
- Next-generation sequencing platforms are those commercially available from lllumina (RNA-Seq) and Helicos (Digital Gene Expression or "DGE").
- Next generation sequencing methods include, but are not limited to those commercialized by: 1 ) 454/Roche Lifesciences including but not limited to the methods and apparatus described in Margulies et al., Nature (2005) 437:376-380 (2005); and US Patent Nos. 7,244,559; 7,335,762; 7,21 1,390;
- Activation of an additional reporter molecule can be determined using standard assays to detect a luciferase protein, a beta-galactosidase protein, a beta-glucuronidase protein, a chloramphenicol acetyltransferase protein, a secreted placental alkaline phosphatase protein, or a fluorescent protein.
- these are enzymatic assays where a detectable signal is produced based upon the proteins enzymatic activity towards a substrate.
- luciferase expression can be measured in the presence of a luciferase substrate by a luminometer.
- a fluorescent reporter does not require a substrate, and the signal can be measured by fluorescence microscopy or a fluorescent plate reader. Fluorescent reporters are particularly useful for measuring reporter activation in live cells.
- the nucleic acids described herein additionally comprise one or more additional genes that encode a selecting polypeptide or a marking polypeptide.
- the nucleic acids described herein additionally comprise one or more additional genes that encode a polypeptide that confers antibiotic resistance to a transfected cell.
- the nucleic acids can comprise a selectable marker such as an antibiotic resistance gene that confers antibiotic resistance to neomycin/G418 resistance, puromycin resistance, zeocin resistance, or blasticidin resistance.
- the nucleic acids described herein additionally comprise one or more additional genes that encode a polypeptide that comprises an epitope tag that is expressed on the cell surface.
- the epitope tag comprises a c-Myc tag, a Hemagglutinin (HA) tag, a histidine tag, a V5 tag, or a FLAG tag.
- the nucleic acids described herein additionally comprise one or more additional promotorless genes that encode a fluorescent polypeptide. Such genes are useful when transfection is intended to lead to integration and is targeted for a specific location or landing pad.
- the“landing pad” in the cells genome comprises a promoter that can complement the lack of promotor in the pomotorless gene, and lead to expression of the promotorless gene only when the promoterless gene is integrated into the intended genomic location.
- Cells with correct integration can be selected by flow cytometry and cell sorting. This type of marker can also ensure that only a single copy of an intended nucleic acid is integrated in the genome and help avoid ectopic overexpression.
- a nucleic acid encoding a bait polypeptide comprises: a gene that encodes a polypeptide that confers antibiotic resistance to a transfected cell; a gene that encodes a polypeptide that comprises an epitope tag that is expressed on the cell surface; or a promotorless gene that encodes a fluorescent polypeptide.
- Cells useful in the method described herein are generally those that are able to be easily rendered transgenic with one or more exogenous nucleic acids encoding the bait polypeptide, the prey polypeptide, or that comprise a reporter element.
- the system nucleic acid(s) encoding a bait polypeptide, a prey polypeptide, and comprising a reporter element can be transfected or transduced into suitable cell line using methods known in the art, such as calcium phosphate transfection, lipid based transfection (e.g., LipofectamineTM, Lipofectamine-2000TM, Lipofectamine-3000TM, or Fugene® HD), electroporation, or viral transduction.
- the cell can also be a population of cells of the same type grown to confluency or near confluency in an appropriate tissue culture vessel.
- the cell used comprises a stable integration of either the nucleic acid encoding a bait polypeptide, the nucleic acid comprising the reporter element, or both.
- Stable cell lines can be made using random integration of a linearized nucleic acid, virally or transposon directed integration, or directed integration, for example using site specific recombination between an AttP and an AttB site.
- the cell comprises a single genomic integration of the nucleic acid encoding the bait polypeptide.
- the cell comprises a single genomic integration of the nucleic acid comprising the reporter element.
- the cell comprises a single integration of the nucleic acid encoding the bait polypeptide, and a single genomic integration of the nucleic acid comprising the reporter element.
- the cell or cell population used in the system is a eukaryotic cell.
- the cell or cell population is a mammalian cell.
- the cell or cell population is a human cell.
- the cell or cell population is SH-SY5Y, Human neuroblastoma; Hep G2, Human Caucasian hepatocyte carcinoma; 293 (also known as HEK 293), Human Embryo Kidney; RAW 264.7, Mouse monocyte macrophage; HeLa, Human cervix epitheloid carcinoma; MRC-5 (PD 19), Human fetal lung; A2780, Human ovarian carcinoma; CACO-2, Human Caucasian colon
- adenocarcinoma THP 1, Human monocytic leukemia; A549, Human Caucasian lung carcinoma; MRC-5 (PD 30), Human fetal lung; MCF7, Human Caucasian breast adenocarcinoma; SNL 76/7, Mouse SIM strain embryonic fibroblast; C2C12, Mouse C3H muscle myoblast; Jurkat E6.1, Human leukemic T cell lymphoblast; U937, Human Caucasian histiocytic lymphoma; L929, Mouse C3H/An connective tissue; 3T3 LI, Mouse Embryo; HL60, Human Caucasian
- Human ovarian carcinoma B9, Mouse B cell hybridoma; CHO-K1, Hamster Chinese ovary; MDCK, Canine Cocker Dogl kidney; 1321N1, Human brain astrocyto a; A431, Human squamous carcinoma; ATDC5, Mouse 129 teratocarcinoma AT805 derived; RCC4 PLUS VECTOR ALONE, Renal cell carcinoma cell line RCC4 stably transfected with an empty expression vector, pcDNA3, conferring neomycin resistance.; HUVEC (S200-05n), Human Pre screened Umbilical Vein Endothelial Cells (HUVEC); neonatal; Vero, Monkey African Green kidney; RCC4 PLUS VHL, Renal cell carcinoma cell line RCC4 stably transfected with pcDNA3-VHL; Fao, Rat hepatoma; J774A.1, Mouse BALB/c monocyte macrophage; MC3T3- El, Mouse C57BL/6 calvaria; J774.2,
- Example 1 Example protein interaction screen
- a screen using a split-ubiquitin or split- TEV system is used to screen for potential compounds that induce GPCR signaling.
- plate cells On day 1, plate cells in a 96-well assay plate at 30,000 cells/well. Plate the cells in 100 uL DMEM+10% FBS and add 50 uL OPTIMEM with 50-300 ng/mL doxycycline, depending on level of GPCR induction desired, 15 ug/mL cumate (for split-ubiquitin) or 7.5 ug/mL cumate (for dual-split- TEV).
- the cells in this example comprise a stably integrated nucleic acid encoding the bait protein, and a plurality of nucleic acids encoding a prey protein transiently transfected.
- a test compound at desired concentration in 50 uL OPTIMEM to each well.
- lysis buffer for either luciferase activity assay or for RNA extraction.
- RNA can be extracted using standard methods or kits.
- RNA can be quantified by standard downstream assays such as RT-qPCR or RNASeq.
- Luciferase activity can be assayed using the Promega Bright-Glo system and can be read on a standard luminometer such as a Thermo Fisher Luminoskan, while RNAseq can be performed on an Illumina MiSeq after sequencing library preparation.
- An exemplary induction of luciferase is shown in FIG. 2.
- a spit-TEV or split-UB system is deployed to determine the agonistic response to a given chemical stimulus, in this case the b ⁇ adrenergic agonist Xamoterol.
- a library of cell lines was constructed in either the split-ubiquitin (FIG. 3A) or split- TEV (FIG. 3B) configuration.
- This library comprises a library of cells each expressing different GPCR prey proteins each paired to a unique RNA barcode.
- cells were plated in a poly-L-lysine coated 384-well assay plate at 22,000 cells/well in 25 uL DMEM + 10%FBS.
- the media was replaced with 25 uL OPTI-MEM with 1000 ng/mL doxycycline and 120 ug/mL cumate.
- RNA extraction was added for RNA extraction.
- the extracted RNAs were reverse transcribed and amplified in a single step with Luna One-Step RT-qPCR mix to prepare sequencing libraries, and levels of RNA barcode are quantified by RNAseq.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Analytical Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Pathology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Food Science & Technology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Inorganic Chemistry (AREA)
- Mechanical Engineering (AREA)
- Plant Pathology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Toxicology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Sustainable Development (AREA)
- Human Computer Interaction (AREA)
- Multimedia (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3121805A CA3121805A1 (en) | 2018-12-07 | 2019-12-06 | Systems for protein-protein interaction screening |
| CN201980091434.8A CN113454217A (zh) | 2018-12-07 | 2019-12-06 | 用于蛋白质-蛋白质相互作用筛选的系统 |
| KR1020217020964A KR20210125476A (ko) | 2018-12-07 | 2019-12-06 | 단백질-단백질 상호작용 스크리닝을 위한 시스템 |
| US17/299,728 US20220162667A1 (en) | 2018-12-07 | 2019-12-06 | Systems for protein-protein interaction screening |
| EP19832237.2A EP3891279A1 (en) | 2018-12-07 | 2019-12-06 | Systems for protein-protein interaction screening |
| JP2021530298A JP2022509850A (ja) | 2018-12-07 | 2019-12-06 | タンパク質間相互作用スクリーニングのためのシステム |
| AU2019392906A AU2019392906A1 (en) | 2018-12-07 | 2019-12-06 | Systems for protein-protein interaction screening |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862776992P | 2018-12-07 | 2018-12-07 | |
| US62/776,992 | 2018-12-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020118198A1 true WO2020118198A1 (en) | 2020-06-11 |
Family
ID=69106181
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/064969 Ceased WO2020118198A1 (en) | 2018-12-07 | 2019-12-06 | Systems for protein-protein interaction screening |
Country Status (9)
| Country | Link |
|---|---|
| US (2) | US11354926B2 (https=) |
| EP (1) | EP3891279A1 (https=) |
| JP (1) | JP2022509850A (https=) |
| KR (1) | KR20210125476A (https=) |
| CN (1) | CN113454217A (https=) |
| AU (1) | AU2019392906A1 (https=) |
| CA (1) | CA3121805A1 (https=) |
| MA (1) | MA54392A (https=) |
| WO (1) | WO2020118198A1 (https=) |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113857023B (zh) * | 2016-06-20 | 2022-08-02 | 蝴蝶网络有限公司 | 用于微加工超声换能器的电接触布置 |
| EP3788798B1 (en) | 2018-05-03 | 2023-07-05 | BFLY Operations, Inc. | Ultrasonic transducers with pressure ports |
| US11501562B2 (en) | 2019-04-30 | 2022-11-15 | Bfly Operations, Inc. | Ultrasound face scanning and identification apparatuses and methods |
| US11988640B2 (en) | 2020-03-11 | 2024-05-21 | Bfly Operations, Inc. | Bottom electrode material stack for micromachined ultrasonic transducer devices |
| KR20220008402A (ko) * | 2020-07-09 | 2022-01-21 | 삼성디스플레이 주식회사 | 초음파 지문 센서, 및 이를 이용한 초음파 지문 센싱 방법 |
| US11087109B1 (en) * | 2020-07-27 | 2021-08-10 | Qualcomm Incorporated | Apparatus and method for ultrasonic fingerprint and force sensing |
| TW202240165A (zh) * | 2021-03-04 | 2022-10-16 | 美商蝴蝶營運公司 | 具有柱腳的微加工超音波換能器 |
| US12246348B2 (en) | 2021-03-04 | 2025-03-11 | BFLY Operations, Inc | Capacitive Micromachined ultrasonic transducers (CMUTs) having non-uniform pedestals |
| CN116140174B (zh) * | 2023-01-03 | 2024-11-29 | 深圳高性能医疗器械国家研究院有限公司 | 微纳超声发生器件以及声穿孔基因转染系统 |
| CN117928717B (zh) * | 2023-12-14 | 2025-10-24 | 华为技术有限公司 | 超声传感器、传感器模组、电子设备及车辆 |
Citations (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5750341A (en) | 1995-04-17 | 1998-05-12 | Lynx Therapeutics, Inc. | DNA sequencing by parallel oligonucleotide extensions |
| EP1348766A1 (en) * | 2002-03-28 | 2003-10-01 | Dualsystems Biotech AG | Method and kit for detecting membrane protein-protein interactions |
| US20040043388A1 (en) * | 2001-03-02 | 2004-03-04 | Come Jon H. | Three hybrid assay system |
| EP1483576A2 (de) * | 2002-03-13 | 2004-12-08 | Axaron Bioscience AG | Neue verfahren zur detektion und analyse von protein-interaktionen in vivo |
| US20060024678A1 (en) | 2004-07-28 | 2006-02-02 | Helicos Biosciences Corporation | Use of single-stranded nucleic acid binding proteins in sequencing |
| US20060024711A1 (en) | 2004-07-02 | 2006-02-02 | Helicos Biosciences Corporation | Methods for nucleic acid amplification and sequence determination |
| US20060286566A1 (en) | 2005-02-03 | 2006-12-21 | Helicos Biosciences Corporation | Detecting apparent mutations in nucleic acid sequences |
| US7170050B2 (en) | 2004-09-17 | 2007-01-30 | Pacific Biosciences Of California, Inc. | Apparatus and methods for optical analysis of molecules |
| US7211390B2 (en) | 1999-09-16 | 2007-05-01 | 454 Life Sciences Corporation | Method of sequencing a nucleic acid |
| US7244567B2 (en) | 2003-01-29 | 2007-07-17 | 454 Life Sciences Corporation | Double ended sequencing |
| US7244559B2 (en) | 1999-09-16 | 2007-07-17 | 454 Life Sciences Corporation | Method of sequencing a nucleic acid |
| US7276720B2 (en) | 2004-07-19 | 2007-10-02 | Helicos Biosciences Corporation | Apparatus and methods for analyzing samples |
| US7302146B2 (en) | 2004-09-17 | 2007-11-27 | Pacific Biosciences Of California, Inc. | Apparatus and method for analysis of molecules |
| US20080087826A1 (en) | 2004-11-16 | 2008-04-17 | Helicos Biosciences Corporation | Optical train and method for tirf single molecule detection and analysis |
| US20080103058A1 (en) | 2006-04-26 | 2008-05-01 | Helicos Biosciences Corporation | Molecules and methods for nucleic acid sequencing |
| US7405281B2 (en) | 2005-09-29 | 2008-07-29 | Pacific Biosciences Of California, Inc. | Fluorescent nucleotide analogs and uses therefor |
| US20080206764A1 (en) | 2000-06-07 | 2008-08-28 | Pacific Biosciences | Flowcell system for single molecule detection |
| US20080213770A1 (en) | 1998-05-01 | 2008-09-04 | Helicos Biosciences Corporation | Method of Determining The Nucleotide Sequence of Oligonucleotides and DNA Molecules |
| US7462468B1 (en) | 2005-01-28 | 2008-12-09 | Pacific Biosciences Of California, Inc. | DNA intercalating agents and methods of use |
| US7462452B2 (en) | 2004-04-30 | 2008-12-09 | Pacific Biosciences Of California, Inc. | Field-switch sequencing |
| US7476504B2 (en) | 2005-01-31 | 2009-01-13 | Pacific Biosciences Of California, Inc. | Use of reversible extension terminator in nucleic acid sequencing |
| US20090024331A1 (en) | 2007-06-06 | 2009-01-22 | Pacific Biosciences Of California, Inc. | Methods and processes for calling bases in sequence by incorporation methods |
| US20090029385A1 (en) | 2007-07-26 | 2009-01-29 | Pacific Biosciences Of California, Inc. | Molecular redundant sequencing |
| US7491498B2 (en) | 2003-11-12 | 2009-02-17 | Helicos Biosciences Corporation | Short cycle methods for sequencing polynucleotides |
| US20090061439A1 (en) | 2007-05-03 | 2009-03-05 | Helicos Biosciences Corporation | Methods and Compositions for Sequencing A Nucleic Acid |
| US7501245B2 (en) | 1999-06-28 | 2009-03-10 | Helicos Biosciences Corp. | Methods and apparatuses for analyzing polynucleotide sequences |
| US20090068655A1 (en) | 2003-04-08 | 2009-03-12 | Pacific Biosciences | Composition and method for nucleic acid sequencing |
Family Cites Families (45)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070224615A1 (en) * | 2003-07-09 | 2007-09-27 | Invitrogen Corporation | Methods for assaying protein-protein interactions |
| ATE534900T1 (de) * | 2003-07-09 | 2011-12-15 | Life Technologies Corp | Verfahren zum testen einer protein-protein- wechselwirkung |
| EP1651764A2 (en) * | 2003-08-06 | 2006-05-03 | Novartis AG | Ubiquitin-specific protease |
| US20060188890A1 (en) * | 2003-10-31 | 2006-08-24 | Proteologics, Inc. | Ubiquitin-based protein interaction assays and related compositions |
| KR100561851B1 (ko) | 2003-11-18 | 2006-03-16 | 삼성전자주식회사 | 지문 인식 센서 및 그 제조 방법 |
| WO2006042144A2 (en) | 2004-10-07 | 2006-04-20 | Ultra-Scan Corporation | Ultrasonic fingerprint scanning utilizing a plane wave |
| EP2002021B1 (en) * | 2006-03-16 | 2011-10-12 | Life Technologies Corporation | Methods for assaying protein-protein interaction |
| GB2453454B (en) | 2006-05-25 | 2011-08-17 | Ultra Scan Corp | Biometrical object reader having an ultrasonic wave manipulation device |
| MX2009000044A (es) * | 2006-06-30 | 2009-01-23 | Ambit Bios Corp | Etiqueta de acido nucleico detectable. |
| US8354997B2 (en) | 2006-10-31 | 2013-01-15 | Navisense | Touchless user interface for a mobile device |
| AU2009243918A1 (en) | 2008-05-07 | 2009-11-12 | Signostics Limited | Docking system for medical diagnostic scanning using a handheld device |
| AU2009289964A1 (en) * | 2008-09-05 | 2010-03-11 | Aarhus Universitet | Nuclear receptor sensor system in transgenic animal |
| US9533873B2 (en) | 2013-02-05 | 2017-01-03 | Butterfly Network, Inc. | CMOS ultrasonic transducers and related apparatus and methods |
| CN109954646B (zh) | 2013-03-15 | 2021-04-27 | 蝴蝶网络有限公司 | 超声装置 |
| WO2014151525A2 (en) | 2013-03-15 | 2014-09-25 | Butterfly Network, Inc. | Complementary metal oxide semiconductor (cmos) ultrasonic transducers and methods for forming the same |
| JP6315893B2 (ja) * | 2013-04-18 | 2018-04-25 | キヤノン株式会社 | 被検体情報取得装置、被検体情報取得方法、及びプログラム |
| WO2015009635A1 (en) | 2013-07-16 | 2015-01-22 | The Regents Of The University Of California | Mut fingerprint id system |
| AU2014293274B2 (en) * | 2013-07-23 | 2018-11-01 | Butterfly Network, Inc. | Interconnectable ultrasound transducer probes and related methods and apparatus |
| US9984270B2 (en) | 2013-08-05 | 2018-05-29 | Apple Inc. | Fingerprint sensor in an electronic device |
| US10478858B2 (en) | 2013-12-12 | 2019-11-19 | Qualcomm Incorporated | Piezoelectric ultrasonic transducer and process |
| US9067779B1 (en) | 2014-07-14 | 2015-06-30 | Butterfly Network, Inc. | Microfabricated ultrasonic transducers and related apparatus and methods |
| US9524415B2 (en) | 2014-07-18 | 2016-12-20 | Qualcomm Incorporated | Test techniques for assessing ultrasonic fingerprint sensors |
| US10008659B2 (en) | 2014-12-09 | 2018-06-26 | Lg Innotek Co., Ltd. | Fingerprint sensor |
| CN106999984B (zh) | 2014-12-11 | 2019-06-28 | 皇家飞利浦有限公司 | 两端子cmut设备 |
| US20160009544A1 (en) | 2015-03-02 | 2016-01-14 | Butterfly Network, Inc. | Microfabricated ultrasonic transducers and related apparatus and methods |
| JP6831330B2 (ja) * | 2015-03-05 | 2021-02-17 | コーニンクレッカ フィリップス エヌ ヴェKoninklijke Philips N.V. | 超音波システムおよび方法 |
| US10497748B2 (en) | 2015-10-14 | 2019-12-03 | Qualcomm Incorporated | Integrated piezoelectric micromechanical ultrasonic transducer pixel and array |
| US9710689B2 (en) | 2015-10-30 | 2017-07-18 | Essential Products, Inc. | Fingerprint sensors for mobile devices |
| US11813639B2 (en) * | 2016-05-03 | 2023-11-14 | Vanguard International Semiconductor Singapore Pte. Ltd. | Electrode arrangement for a pMUT and pMUT transducer array |
| US10445547B2 (en) | 2016-05-04 | 2019-10-15 | Invensense, Inc. | Device mountable packaging of ultrasonic transducers |
| US10408797B2 (en) | 2016-05-10 | 2019-09-10 | Invensense, Inc. | Sensing device with a temperature sensor |
| US10452887B2 (en) | 2016-05-10 | 2019-10-22 | Invensense, Inc. | Operating a fingerprint sensor comprised of ultrasonic transducers |
| US10856840B2 (en) | 2016-06-20 | 2020-12-08 | Butterfly Network, Inc. | Universal ultrasound device and related apparatus and methods |
| CN113857023B (zh) | 2016-06-20 | 2022-08-02 | 蝴蝶网络有限公司 | 用于微加工超声换能器的电接触布置 |
| US10235552B2 (en) | 2016-10-12 | 2019-03-19 | Qualcomm Incorporated | Hybrid capacitive and ultrasonic sensing |
| US10410034B2 (en) * | 2016-11-07 | 2019-09-10 | Qualcomm Incorporated | Ultrasonic biometric system with harmonic detection |
| US20180203017A1 (en) * | 2016-12-30 | 2018-07-19 | The Board Of Trustees Of The Leland Stanford Junior University | Protein-protein interaction detection systems and methods of use thereof |
| US10196261B2 (en) | 2017-03-08 | 2019-02-05 | Butterfly Network, Inc. | Microfabricated ultrasonic transducers and related apparatus and methods |
| KR102433315B1 (ko) * | 2017-12-27 | 2022-08-16 | 삼성전자주식회사 | 초음파 트랜스듀서가 임베디드된 유기 발광 다이오드 패널 및 이를 포함하는 표시 장치 |
| EP3745961B1 (en) | 2018-01-30 | 2025-10-01 | BFLY Operations, Inc. | Methods and apparatuses for packaging an ultrasound-on-a-chip |
| US11590532B2 (en) | 2018-03-09 | 2023-02-28 | Bfly Operations, Inc. | Ultrasound transducer devices and methods for fabricating ultrasound transducer devices |
| US11986349B2 (en) | 2018-05-03 | 2024-05-21 | Bfly Operations, Inc. | Ultrasound devices |
| TW201947717A (zh) | 2018-05-03 | 2019-12-16 | 美商蝴蝶網路公司 | 用於超音波晶片的垂直封裝及相關方法 |
| JP2021529459A (ja) | 2018-07-06 | 2021-10-28 | バタフライ ネットワーク,インコーポレイテッド | 超音波オンチップをパッケージングする方法及び装置 |
| US20200184176A1 (en) | 2018-12-07 | 2020-06-11 | Butterfly Network, Inc. | Ultrasound fingerprint detection and related apparatus and methods |
-
2019
- 2019-12-06 AU AU2019392906A patent/AU2019392906A1/en not_active Abandoned
- 2019-12-06 EP EP19832237.2A patent/EP3891279A1/en not_active Withdrawn
- 2019-12-06 CA CA3121805A patent/CA3121805A1/en active Pending
- 2019-12-06 KR KR1020217020964A patent/KR20210125476A/ko not_active Ceased
- 2019-12-06 JP JP2021530298A patent/JP2022509850A/ja active Pending
- 2019-12-06 CN CN201980091434.8A patent/CN113454217A/zh active Pending
- 2019-12-06 US US16/705,504 patent/US11354926B2/en active Active
- 2019-12-06 US US17/299,728 patent/US20220162667A1/en not_active Abandoned
- 2019-12-06 WO PCT/US2019/064969 patent/WO2020118198A1/en not_active Ceased
- 2019-12-06 MA MA054392A patent/MA54392A/fr unknown
Patent Citations (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5969119A (en) | 1995-04-17 | 1999-10-19 | Lynx Therapeutics, Inc. | DNA sequencing by parallel olgonucleotide extensions |
| US6306597B1 (en) | 1995-04-17 | 2001-10-23 | Lynx Therapeutics, Inc. | DNA sequencing by parallel oligonucleotide extensions |
| US5750341A (en) | 1995-04-17 | 1998-05-12 | Lynx Therapeutics, Inc. | DNA sequencing by parallel oligonucleotide extensions |
| US20080213770A1 (en) | 1998-05-01 | 2008-09-04 | Helicos Biosciences Corporation | Method of Determining The Nucleotide Sequence of Oligonucleotides and DNA Molecules |
| US7501245B2 (en) | 1999-06-28 | 2009-03-10 | Helicos Biosciences Corp. | Methods and apparatuses for analyzing polynucleotide sequences |
| US7244559B2 (en) | 1999-09-16 | 2007-07-17 | 454 Life Sciences Corporation | Method of sequencing a nucleic acid |
| US7335762B2 (en) | 1999-09-16 | 2008-02-26 | 454 Life Sciences Corporation | Apparatus and method for sequencing a nucleic acid |
| US7264929B2 (en) | 1999-09-16 | 2007-09-04 | 454 Life Sciences Corporation | Method of sequencing a nucleic acid |
| US7211390B2 (en) | 1999-09-16 | 2007-05-01 | 454 Life Sciences Corporation | Method of sequencing a nucleic acid |
| US20080206764A1 (en) | 2000-06-07 | 2008-08-28 | Pacific Biosciences | Flowcell system for single molecule detection |
| US20040043388A1 (en) * | 2001-03-02 | 2004-03-04 | Come Jon H. | Three hybrid assay system |
| EP1483576A2 (de) * | 2002-03-13 | 2004-12-08 | Axaron Bioscience AG | Neue verfahren zur detektion und analyse von protein-interaktionen in vivo |
| EP1348766A1 (en) * | 2002-03-28 | 2003-10-01 | Dualsystems Biotech AG | Method and kit for detecting membrane protein-protein interactions |
| US7244567B2 (en) | 2003-01-29 | 2007-07-17 | 454 Life Sciences Corporation | Double ended sequencing |
| US7323305B2 (en) | 2003-01-29 | 2008-01-29 | 454 Life Sciences Corporation | Methods of amplifying and sequencing nucleic acids |
| US20090068655A1 (en) | 2003-04-08 | 2009-03-12 | Pacific Biosciences | Composition and method for nucleic acid sequencing |
| US7491498B2 (en) | 2003-11-12 | 2009-02-17 | Helicos Biosciences Corporation | Short cycle methods for sequencing polynucleotides |
| US7462452B2 (en) | 2004-04-30 | 2008-12-09 | Pacific Biosciences Of California, Inc. | Field-switch sequencing |
| US20060024711A1 (en) | 2004-07-02 | 2006-02-02 | Helicos Biosciences Corporation | Methods for nucleic acid amplification and sequence determination |
| US7276720B2 (en) | 2004-07-19 | 2007-10-02 | Helicos Biosciences Corporation | Apparatus and methods for analyzing samples |
| US20060024678A1 (en) | 2004-07-28 | 2006-02-02 | Helicos Biosciences Corporation | Use of single-stranded nucleic acid binding proteins in sequencing |
| US7313308B2 (en) | 2004-09-17 | 2007-12-25 | Pacific Biosciences Of California, Inc. | Optical analysis of molecules |
| US7476503B2 (en) | 2004-09-17 | 2009-01-13 | Pacific Biosciences Of California, Inc. | Apparatus and method for performing nucleic acid analysis |
| US7170050B2 (en) | 2004-09-17 | 2007-01-30 | Pacific Biosciences Of California, Inc. | Apparatus and methods for optical analysis of molecules |
| US7302146B2 (en) | 2004-09-17 | 2007-11-27 | Pacific Biosciences Of California, Inc. | Apparatus and method for analysis of molecules |
| US7315019B2 (en) | 2004-09-17 | 2008-01-01 | Pacific Biosciences Of California, Inc. | Arrays of optical confinements and uses thereof |
| US20080087826A1 (en) | 2004-11-16 | 2008-04-17 | Helicos Biosciences Corporation | Optical train and method for tirf single molecule detection and analysis |
| US7462468B1 (en) | 2005-01-28 | 2008-12-09 | Pacific Biosciences Of California, Inc. | DNA intercalating agents and methods of use |
| US7476504B2 (en) | 2005-01-31 | 2009-01-13 | Pacific Biosciences Of California, Inc. | Use of reversible extension terminator in nucleic acid sequencing |
| US20060286566A1 (en) | 2005-02-03 | 2006-12-21 | Helicos Biosciences Corporation | Detecting apparent mutations in nucleic acid sequences |
| US7405281B2 (en) | 2005-09-29 | 2008-07-29 | Pacific Biosciences Of California, Inc. | Fluorescent nucleotide analogs and uses therefor |
| US20080103058A1 (en) | 2006-04-26 | 2008-05-01 | Helicos Biosciences Corporation | Molecules and methods for nucleic acid sequencing |
| US20090061439A1 (en) | 2007-05-03 | 2009-03-05 | Helicos Biosciences Corporation | Methods and Compositions for Sequencing A Nucleic Acid |
| US20090024331A1 (en) | 2007-06-06 | 2009-01-22 | Pacific Biosciences Of California, Inc. | Methods and processes for calling bases in sequence by incorporation methods |
| US20090029385A1 (en) | 2007-07-26 | 2009-01-29 | Pacific Biosciences Of California, Inc. | Molecular redundant sequencing |
Non-Patent Citations (10)
| Title |
|---|
| BOTVINNIK A ET AL: "Integrated analysis of receptor activation and dowstream signaling with EXTassays", vol. 7, no. 1, 1 January 2009 (2009-01-01), pages 74 - 80, XP002566572, ISSN: 1548-7091, Retrieved from the Internet <URL:http://www.nature.com/nmeth/journal/v7/n1/pdf/nmeth.1407.pdf> [retrieved on 20100128], DOI: 10.1038/NMETH.1407 * |
| JENNIFER D LEWIS ET AL: "Quantitative Interactor Screening with next-generation Sequencing (QIS-Seq) identifies Arabidopsis thaliana MLO2 as a target of the Pseudomonas syringae type III effector HopZ2", BMC GENOMICS, BIOMED CENTRAL, vol. 13, no. 1, 9 January 2012 (2012-01-09), pages 8, XP021123450, ISSN: 1471-2164, DOI: 10.1186/1471-2164-13-8 * |
| JULIA PETSCHNIGG ET AL: "Interactive proteomics research technologies: recent applications and advances", CURRENT OPINION IN BIOTECHNOLOGY, vol. 22, no. 1, 9 September 2010 (2010-09-09), pages 50 - 58, XP028276921, ISSN: 0958-1669, [retrieved on 20100909], DOI: 10.1016/J.COPBIO.2010.09.001 * |
| JULIA PETSCHNIGG: "The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells", NATURE METHODS, VOL.11, NR.5, 1 May 2014 (2014-05-01), pages 585 - 592, XP055301607, Retrieved from the Internet <URL:http://www.nature.com/nmeth/journal/v11/n5/pdf/nmeth.2895.pdf> [retrieved on 20160912], DOI: 10.1038/nmeth.2895 * |
| MARGULIES ET AL., NATURE, vol. 437, 2005, pages 376 - 380 |
| MICHAEL C WEHR ET AL: "Monitoring regulated protein-protein interactions using split TEV", NATURE METHODS, vol. 3, no. 12, 29 October 2006 (2006-10-29), New York, pages 985 - 993, XP055565855, ISSN: 1548-7091, DOI: 10.1038/nmeth967 * |
| See also references of EP3891279A1 |
| SUJAN S SHEKHAWAT ET AL: "Split-protein systems: beyond binary protein-protein interactions", CURRENT OPINION IN CHEMICAL BIOLOGY, vol. 15, no. 6, 1 December 2011 (2011-12-01), GB, pages 789 - 797, XP055268066, ISSN: 1367-5931, DOI: 10.1016/j.cbpa.2011.10.014 * |
| THAMINY S ET AL: "Identification of novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-hybrid system", GENOME RESEARCH, COLD SPRING HARBOR LABORATORY PRESS, US, vol. 13, no. 7, 1 July 2003 (2003-07-01), pages 1744 - 1753, XP002288002, ISSN: 1088-9051, DOI: 10.1101/GR.1276503 * |
| WEHR MICHAEL C ET AL: "Split protein biosensor assays in molecular pharmacological studies", DRUG DISCOVERY TODAY, ELSEVIER, AMSTERDAM, NL, vol. 21, no. 3, 21 November 2015 (2015-11-21), pages 415 - 429, XP029464364, ISSN: 1359-6446, DOI: 10.1016/J.DRUDIS.2015.11.004 * |
Also Published As
| Publication number | Publication date |
|---|---|
| MA54392A (fr) | 2021-10-13 |
| CA3121805A1 (en) | 2020-06-11 |
| EP3891279A1 (en) | 2021-10-13 |
| US20220162667A1 (en) | 2022-05-26 |
| CN113454217A (zh) | 2021-09-28 |
| US20200184177A1 (en) | 2020-06-11 |
| JP2022509850A (ja) | 2022-01-24 |
| US11354926B2 (en) | 2022-06-07 |
| AU2019392906A1 (en) | 2021-07-22 |
| KR20210125476A (ko) | 2021-10-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220162667A1 (en) | Systems for protein-protein interaction screening | |
| Mattijssen et al. | LARP4 mRNA codon-tRNA match contributes to LARP4 activity for ribosomal protein mRNA poly (A) tail length protection | |
| EP2985347B1 (en) | Method for detecting protein stability and uses thereof | |
| WO2001073105A1 (en) | Mammalian two-hybrid system | |
| EP2440667A1 (en) | Methods and kits for regulating intracellular trafficking of a target protein | |
| US20220177897A1 (en) | Transcriptional relay system | |
| Chen et al. | DAXX interacts with phage ΦC31 integrase and inhibits recombination | |
| Thakar et al. | Interaction of HRP‐2 isoforms with HDGF. Chromatin binding of a specific heteromer | |
| Wouters et al. | Assessing GPCR dimerization in living cells: Comparison of the NanoBiT assay with related bioluminescence-and fluorescence-based approaches | |
| JP2015097523A (ja) | 核小体ストレス応答を誘導する薬剤の探索のためのポリペプチドの組み合わせ及びスクリーニング方法 | |
| Yordanova et al. | Stop codon readthrough contexts influence reporter expression differentially depending on the presence of an IRES | |
| US12590959B2 (en) | Systems and methods for measuring cell signaling protein activity | |
| KR20230023218A (ko) | N-말단의 일부가 절단된 ATF6β 단백질을 이용한 소포체 스트레스 조절 물질 스크리닝 방법 | |
| US20250333748A1 (en) | A degron for regulating protein expression and methods thereof | |
| Donaldson et al. | Nuclear trafficking of the POZ-ZF protein Znf131 | |
| Ejeskär et al. | Method for efficient transfection of in vitro-transcribed mRNA into SK-N-AS and HEK293 cells: Difference in the toxicity of nuclear EGFP compared to cytoplasmic EGFP | |
| JP2008228627A (ja) | アリルハイドロカーボン受容体キメラタンパク質、それをコードする遺伝子、発現ベクター、形質転換細胞、および被験物質の毒性検出方法 | |
| Xie et al. | Efficient site-specific recombination by self-activating split-Dre recombinase in mammalian cells and E. coli | |
| Kostova | Functional characterization of a novel p97: ASPL protein complex | |
| KR102074591B1 (ko) | RavZ 단백질 유래 PI3P 결합 프로브 및 이를 이용한 세포내 소낭 검출 방법 | |
| WO2025153769A1 (en) | Method | |
| Mull | Mutational Analysis of a Conserved C-terminal Region in Gα12 and Gα13 Harbors Unique Determinants of SRF Signaling and RhoGEF Binding | |
| JP2001521619A (ja) | レポーターサブユニット相補による分子相互作用の検出 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19832237 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2021530298 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3121805 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2019832237 Country of ref document: EP Effective date: 20210707 |
|
| ENP | Entry into the national phase |
Ref document number: 2019392906 Country of ref document: AU Date of ref document: 20191206 Kind code of ref document: A |
|
| WWR | Wipo information: refused in national office |
Ref document number: 1020217020964 Country of ref document: KR |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2019832237 Country of ref document: EP |