WO2020104157A1 - Detergent composition - Google Patents

Detergent composition

Info

Publication number
WO2020104157A1
WO2020104157A1 PCT/EP2019/079656 EP2019079656W WO2020104157A1 WO 2020104157 A1 WO2020104157 A1 WO 2020104157A1 EP 2019079656 W EP2019079656 W EP 2019079656W WO 2020104157 A1 WO2020104157 A1 WO 2020104157A1
Authority
WO
WIPO (PCT)
Prior art keywords
detergent composition
enzyme
seq
sequence identity
composition according
Prior art date
Application number
PCT/EP2019/079656
Other languages
French (fr)
Inventor
Jens Carlo BENNINGHOFF
Simone Antonio DE ROSE
Michail ISUPOV
Dietmar Andreas LANG
Jennifer Ann LITTLECHILD-BOND
Sarah Rebecca SMITH
Mark Lawrence THOMPSON
Original Assignee
Unilever Plc
Unilever N.V.
Conopco, Inc., D/B/A Unilever
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Unilever Plc, Unilever N.V., Conopco, Inc., D/B/A Unilever filed Critical Unilever Plc
Priority to CN201980076305.1A priority Critical patent/CN113056548B/en
Priority to BR112021009789-9A priority patent/BR112021009789A2/en
Priority to EP19798034.5A priority patent/EP3884025B1/en
Publication of WO2020104157A1 publication Critical patent/WO2020104157A1/en
Priority to ZA2021/02551A priority patent/ZA202102551B/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16—Organic compounds
    • C11D3/38—Products with no well-defined composition, e.g. natural products
    • C11D3/386—Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38636—Preparations containing enzymes, e.g. protease or amylase containing enzymes other than protease, amylase, lipase, cellulase, oxidase or reductase
    • C11D2111/12—

Definitions

  • the invention concerns a detergent composition, more specifically a laundry detergent composition, said composition comprising a novel esterase enzyme.
  • Sebum is an oily soil which has remained a difficult stain to remove from worn garments.
  • Sebum consists of a number of fats and esters including wax esters, cholesterol esters, squalene and many free fatty acids/ alcohols. Sebum is liquid at body temperature, but solid at ambient temperature.
  • the present invention provides a detergent composition comprising:
  • esterase enzyme of enzyme class EC 3.1.1.1 , having at least 60% sequence identity to any one of SEQ ID NO: 1 to 4.
  • the esterase enzyme has at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity to any one of SEQ ID NO: 1 to 4.
  • esterase enzyme has 100% sequence identity to any one of SEQ ID NO: 1 to 4.
  • the detergent composition comprises from 0.1 to 10 wt.%, preferably from 0.2 to 9 wt.%, more preferably from 0.25 to 8, even more preferably from 0.5 to 6 wt.%, most preferably from 1 to 5 wt.% of a soil release polymer, more preferably a polyester based soil released polymer.
  • the polyester soil release polymer is a polyethylene and/or polypropylene terephthalate based soil release polymer, preferably a polypropylene terephthalate based soil release polymer.
  • the detergent composition comprises an alkoxylated polyamine, preferably at a level of from 0.1 to 8 wt.%, more preferably from 0.2 to 6 wt.%, most preferably from 0.5 to 5 wt.%.
  • the detergent composition is a laundry detergent composition.
  • the laundry detergent composition is a liquid or a powder, most preferably a liquid detergent.
  • the surfactant in the detergent composition comprises anionic and/or nonionic surfactant, in one case comprising both anionic and nonionic surfactant.
  • Preferred detergent compositions particularly laundry detergent compositions additionally comprise a further enzyme selected from the group consisting of: lipases, proteases, cellulases, alpha-amylases, peroxidases/oxidases, pectate lyases, and/or mannanases.
  • a further enzyme selected from the group consisting of: lipases, proteases, cellulases, alpha-amylases, peroxidases/oxidases, pectate lyases, and/or mannanases.
  • Preferred detergent compositions particularly laundry detergent compositions additionally comprise a further ingredient selected from fluorescent agent, perfume, shading dyes and polymers, and mixtures thereof.
  • the present invention provides a method of treatment of a fabric substrate with a sebum stain, said method comprising incorporation of an esterase enzyme of enzyme class EC 3.1.1.1 , having at least 60%, preferably at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity, most preferably 100%, sequence identity to any one of SEQ ID NO: 1 to 4 into a detergent composition comprising from 1 to 60 wt.% of a surfactant; and subsequent treatment of a fabric substrate with a sebum stain, with said composition.
  • the present invention provides the use of an esterase enzyme of enzyme class EC 3.1.1.1 , having at least 60%, preferably at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity, most preferably 100%, sequence identity to any one of SEQ ID NO: 1 to 4, to improve cleaning of sebum stains on fabric.
  • indefinite article“a” or“an” and its corresponding definite article“the” as used herein means at least one, or one or more, unless specified otherwise.
  • the detergent composition may take any suitable form, for example liquids, solids (including powders) or gels.
  • the detergent composition can be applied to any suitable substrate.
  • Particularly preferred substrates are textiles.
  • Particularly preferred detergent compositions are laundry detergent compositions.
  • Laundry detergent compositions may take any suitable form. Preferred forms are liquid or powder, with liquid being most preferred.
  • sequences disclosed herein are SEQ ID NO 1 to 4.
  • SEQ ID 1 is from Thermogutta terrifontis
  • SEQ ID 2 is from Thermogutta terrifontis
  • This sequence is a mutant of SEQ ID 1 and differs at the 37 position.
  • SEQ ID 3 is from Thermogutta terrifontis
  • This sequence is a mutant of SEQ ID 1 and differs at the 251 position.
  • SEQ ID 4 is from Archaeoglobus fulgidus
  • the esterase enzyme has at least 60% sequence identity to any one of SEQ ID NO: 1 to 4.
  • the esterase enzyme has at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity to any one of SEQ ID NO: 1 to 4.
  • esterase enzyme has 100% sequence identity to any one of SEQ ID NO: 1 to 4.
  • the esterase can be described as being of enzyme class EC 3.1.1.1 , known as
  • Preferred esterases are from Thermogutta terrifontis or Archaeoglobus fulgidus.
  • the detergent composition comprises surfactant (which may include a single surfactant or a mixture of two or more surfactants).
  • the composition comprises from 1 to 60 wt.%, preferably from 2 to 50 wt.%, more preferably from 3 to 45 wt.%, even more preferably from 5 to 40 wt.%, most preferably from 6 to 40 wt.% of surfactant.
  • the detergent composition (preferably a laundry detergent composition) comprises anionic and/or nonionic surfactant, preferably comprising both anionic and nonionic surfactant.
  • Suitable anionic detergent compounds which may be used are usually water-soluble alkali metal salts of organic sulphates and sulphonates having alkyl radicals containing from about 8 to about 22 carbon atoms, the term alkyl being used to include the alkyl portion of higher alkyl radicals.
  • suitable synthetic anionic detergent compounds are sodium and potassium alkyl sulphates, especially those obtained by sulphating higher Cs to Cis alcohols, produced for example from tallow or coconut oil, sodium and potassium alkyl Cg to C20 benzene sulphonates, particularly sodium linear secondary alkyl C10 to C15 benzene sulphonates; and sodium alkyl glyceryl ether sulphates, especially those ethers of the higher alcohols derived from tallow or coconut oil and synthetic alcohols derived from petroleum.
  • the anionic surfactant is preferably selected from: linear alkyl benzene sulphonate; alkyl sulphates; alkyl ether sulphates; soaps; alkyl (preferably methyl) ester sulphonates, and mixtures thereof.
  • the most preferred anionic surfactants are selected from: linear alkyl benzene sulphonate; alkyl sulphates; alkyl ether sulphates and mixtures thereof.
  • the alkyl ether sulphate is a C12-C14 n-alkyl ether sulphate with an average of 1 to 3EO (ethoxylate) units.
  • Sodium lauryl ether sulphate is particularly preferred (SLES).
  • the linear alkyl benzene sulphonate is a sodium Cn to C15 alkyl benzene sulphonates.
  • the alkyl sulphates is a linear or branched sodium C12 to Cis alkyl sulphates.
  • Sodium dodecyl sulphate is particularly preferred, (SDS, also known as primary alkyl sulphate).
  • liquid formulations preferably two or more anionic surfactant are present, for example linear alkyl benzene sulphonate together with an alkyl ether sulphate.
  • the laundry composition in addition to the anionic surfactant comprises alkyl exthoylated non-ionic surfactant, preferably from 2 to 8 wt.% of alkyl ethoxylated non-ionic surfactant.
  • Suitable nonionic detergent compounds which may be used include, in particular, the reaction products of compounds having an aliphatic hydrophobic group and a reactive hydrogen atom, for example, aliphatic alcohols, acids or amides, especially ethylene oxide either alone or with propylene oxide.
  • Preferred nonionic detergent compounds are the condensation products of aliphatic Cs to Cis primary or secondary linear or branched alcohols with ethylene oxide.
  • the nonionic detergent compound is the alkyl ethoxylated non-ionic surfactant is a Cs to Cie primary alcohol with an average ethoxylation of 7EO to 9EO units.
  • surfactants used are saturated.
  • the soil release polymer is preferably present at a level of from 0.1 to 10 wt.%. Preferred levels of inclusion of the soil release polymer are preferably from 0.2 to 9 wt.%, more preferably from 0.25 to 8 wt.%, even more preferably from 0.5 to 6 wt.%, most preferably from 1 to 5 wt.%.
  • the soil release polymer is a polyester based soil released polymer. More preferably the polyester soil release polymer is a polyethylene and/or polypropylene terephthalate based soil release polymer, most preferably a polypropylene terephthalate based soil release polymer.
  • Suitable polyester based soil release polymers are described in WO 2014/029479 and WO 2016/005338.
  • the detergent composition preferably comprises an alkoxylated polyamine. Especially when the detergent composition is in the form of a laundry composition, it is preferred that an alkoxylated polyamine is included.
  • Preferred levels of alkoxylated polyamine range from 0.1 to 8 wt.%, preferably from 0.2 to 6 wt.%, more preferably from 0.5 to 5 wt.%. Another preferred level is from 1 to 4 wt.%.
  • the alkoxylated polyamine may be linear or branched. It may be branched to the extent that it is a dendrimer.
  • the alkoxylation may typically be ethoxylation or propoxylation, or a mixture of both. Where a nitrogen atom is alkoxylated, a preferred average degree of alkoxylation is from 10 to 30, preferably from 15 to 25.
  • a preferred material is alkoxylated polyethylenimine, most preferably ethoxylated
  • Additional enzymes other than the specified lipase may be present in the detergent composition. It is preferred that additional enzymes are present in the preferred laundry detergent composition.
  • the level of each enzyme in the laundry composition of the invention is from 0.0001 wt.% to 0.1 wt.%.
  • Levels of enzyme present in the composition preferably relate to the level of enzyme as pure protein.
  • Preferred further enzymes include those in the group consisting of: lipases, proteases, cellulases, alpha-amylases, peroxidases/oxidases, pectate lyases, and/or mannanases.
  • Said preferred additional enzymes include a mixture of two or more of these enzymes.
  • the further enzyme is selected from: lipases, proteases, cellulases, and/or alpha- amylases.
  • Suitable lipases include those of bacterial or fungal origin. Chemically modified or protein engineered mutants are included. Examples of useful lipases include lipases from Humicola (synonym Thermomyces), e.g. from H. lanuginosa ( T . lanuginosus) as described in EP 258 068 and EP 305 216 or from H. insolens as described in WO 96/13580, a Pseudomonas lipase, e.g. from P. alcaligenes or P. pseudoalcaligenes (EP 218 272), P. cepacia (EP 331 376), P. stutzeri (GB 1 ,372,034), P.
  • lipase variants such as those described in WO 92/05249,
  • Preferred commercially available lipase enzymes include LipolaseTM and Lipolase UltraTM, LipexTM and LipocleanTM (Novozymes A/S).
  • the method of the invention may be carried out in the presence of phospholipase classified as EC 3.1.1.4 and/or EC 3.1.1.32.
  • phospholipase is an enzyme which has activity towards phospholipids.
  • Phospholipids such as lecithin or phosphatidylcholine, consist of glycerol esterified with two fatty acids in an outer (sn-1 ) and the middle (sn-2) positions and esterified with phosphoric acid in the third position; the phosphoric acid, in turn, may be esterified to an amino-alcohol.
  • Phospholipases are enzymes which participate in the hydrolysis of phospholipids.
  • phospholipases Ai and A2 which hydrolyze one fatty acyl group (in the sn-1 and sn-2 position, respectively) to form lysophospholipid
  • lysophospholipase or phospholipase B
  • Phospholipase C and phospholipase D release diacyl glycerol or phosphatidic acid respectively.
  • proteases hydrolyse bonds within peptides and proteins, in the laundry context this leads to enhanced removal of protein or peptide containing stains.
  • suitable proteases families include aspartic proteases; cysteine proteases; glutamic proteases; aspargine peptide lyase; serine proteases and threonine proteases.
  • Such protease families are described in the MEROPS peptidase database (httpi//merops. sanqer.ac.uk/). Serine proteases are preferred. Subtilase type serine proteases are more preferred.
  • subtilases refers to a sub-group of serine protease according to Siezen et al., Protein Engng. 4 (1991 ) 719-737 and Siezen et al. Protein Science 6 (1997) 501 -523.
  • Serine proteases are a subgroup of proteases characterized by having a serine in the active site, which forms a covalent adduct with the substrate.
  • the subtilases may be divided into 6 sub divisions, i.e. the Subtilisin family, the Thermitase family, the Proteinase K family, the Lantibiotic peptidase family, the Kexin family and the Pyrolysin family.
  • subtilases are those derived from Bacillus such as Bacillus lentus, B.
  • trypsin-like proteases examples include trypsin (e.g. of porcine or bovine origin) and the Fusarium protease described in WO 89/06270, WO 94/25583 and WO 05/040372, and the chymotrypsin proteases derived from Cellumonas described in WO 05/052161 and WO 05/052146.
  • protease is a subtilisins (EC 3.4.21.62).
  • subtilases are those derived from Bacillus such as Bacillus lentus, B.
  • subtilis alkalophilus, B. subtilis, B. amyloliquefaciens, Bacillus pumilus and Bacillus gibsonii described in; US7262042 and W009/021867, and subtilisin lentus, subtilisin Novo, subtilisin Carlsberg, Bacillus licheniformis, subtilisin BPN', subtilisin 309, subtilisin 147 and subtilisin 168 described in WO89/06279 and protease PD138 described in (WO93/18140).
  • the subsilisin is derived from Bacillus, preferably Bacillus lentus, B. alkalophilus, B. subtilis,
  • subtilisin is derived from Bacillus gibsonii or Bacillus Lentus.
  • Suitable commercially available protease enzymes include those sold under the trade names names Alcalase®, Blaze®; DuralaseTm, DurazymTm, Relase®, Relase® Ultra, Savinase®, Savinase® Ultra, Primase®, Polarzyme®, Kannase®, Liquanase®, Liquanase® Ultra, Ovozyme®, Coronase®, Coronase® Ultra, Neutrase®, Everlase® and Esperase® all could be sold as Ultra® or Evity® (Novozymes A/S).
  • the composition may use cutinase, classified in EC 3.1.1.74.
  • the cutinase used according to the invention may be of any origin.
  • Preferably cutinases are of microbial origin, in particular of bacterial, of fungal or of yeast origin.
  • Suitable amylases include those of bacterial or fungal origin. Chemically modified or protein engineered mutants are included. Amylases include, for example, alpha- amylases obtained from Bacillus, e.g. a special strain of B. licheniformis, described in more detail in GB 1 ,296,839, or the Bacillus sp. strains disclosed in WO 95/026397 or WO
  • amylases are DuramylTM, TermamylTM, Termamyl UltraTM, NatalaseTM, StainzymeTM, AmplifyTM, FungamylTM and BANTM (Novozymes A/S), RapidaseTM and PurastarTM (from Genencor International Inc.).
  • Suitable cellulases include those of bacterial or fungal origin. Chemically modified or protein engineered mutants are included. Suitable cellulases include cellulases from the genera Bacillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, e.g. the fungal cellulases produced from Humicola insolens, Thielavia terrestris, Myceliophthora
  • thermophila and Fusarium oxysporum disclosed in US 4,435,307, US 5,648,263, US 5,691 ,178, US 5,776,757, WO 89/09259, WO 96/029397, and WO 98/012307.
  • Commercially available cellulases include CelluzymeTM, CarezymeTM, CellucleanTM, EndolaseTM, RenozymeTM (Novozymes A/S), ClazinaseTM and Puradax HATM (Genencor International Inc.), and KAC-500(B)TM (Kao Corporation). CellucleanTM is preferred.
  • Suitable peroxidases/oxidases include those of plant, bacterial or fungal origin. Chemically modified or protein engineered mutants are included. Examples of useful peroxidases include peroxidases from Coprinus, e.g. from C. cinereus, and variants thereof as those described in WO 93/24618, WO 95/10602, and WO 98/15257. Commercially available peroxidases include GuardzymeTM and NovozymTM 51004 (Novozymes A/S).
  • the aqueous solution used in the method preferably has an enzyme present.
  • the enzyme is preferably present in the aqueous solution used in the method at a concentration in the range from 0.01 to 10ppm, preferably 0.05 to 1 ppm.
  • Any enzyme present in the composition may be stabilized using conventional stabilizing agents, e.g., a polyol such as propylene glycol or glycerol, a sugar or sugar alcohol, lactic acid, boric acid, or a boric acid derivative, e.g., an aromatic borate ester, or a phenyl boronic acid derivative such as 4-formylphenyl boronic acid, and the composition may be formulated as described in e.g. WO 92/19709 and WO 92/19708.
  • a polyol such as propylene glycol or glycerol
  • a sugar or sugar alcohol lactic acid, boric acid, or a boric acid derivative, e.g., an aromatic borate ester, or a phenyl boronic acid derivative such as 4-formylphenyl boronic acid
  • detergent compositions preferably laundry detergent compositions
  • materials that may be included in the detergent compositions include fluorescent agent, perfume, shading dyes, polymers and chelating agents.
  • the composition preferably comprises a fluorescent agent (optical brightener).
  • fluorescent agents are well known and many such fluorescent agents are available commercially.
  • these fluorescent agents are supplied and used in the form of their alkali metal salts, for example, the sodium salts.
  • the total amount of the fluorescent agent or agents used in the composition is generally from 0.0001 to 0.5 wt.%, preferably 0.005 to 2 wt.%, more preferably 0.01 to 0.1 wt.%.
  • Preferred classes of fluorescer are: Di-styryl biphenyl compounds, e.g. Tinopal (Trade Mark) CBS-X, Di-amine stilbene di-sulphonic acid compounds, e.g. Tinopal DMS pure Xtra and Blankophor (Trade Mark) HRH, and Pyrazoline compounds, e.g. Blankophor SN.
  • Di-styryl biphenyl compounds e.g. Tinopal (Trade Mark) CBS-X
  • Di-amine stilbene di-sulphonic acid compounds e.g. Tinopal DMS pure Xtra and Blankophor (Trade Mark) HRH
  • Pyrazoline compounds e.g. Blankophor SN.
  • Preferred fluorescers are fluorescers with CAS-No 3426-43-5; CAS-No 35632-99-6; CAS-No 24565-13-7; CAS-No 12224-16-7; CAS-No 13863-31-5; CAS-No 4193-55-9; CAS-No 16090- 02-1 ; CAS-No 133-66-4; CAS-No 68444-86-0; CAS-No 27344-41-8.
  • fluorescers are: sodium 2 (4-styryl-3-sulfophenyl)-2H-napthol[1 ,2-d]triazole, disodium 4,4'-bis ⁇ [(4-anilino-6-(N methyl-N-2 hydroxyethyl) amino 1 ,3,5-triazin-2- yl)]amino ⁇ stilbene-2-2' disulphonate, disodium 4,4'-bis ⁇ [(4-anilino-6-morpholino-1 ,3,5-triazin- 2-yl)]amino ⁇ stilbene-2-2' disulphonate, and disodium 4,4'-bis(2-sulphostyryl)biphenyl.
  • the aqueous solution used in the method has a fluorescer present.
  • the fluorescer is present in the aqueous solution used in the method preferably in the range from 0.0001 g/l to 0.1 g/l, more preferably 0.001 to 0.02 g/l.
  • the composition preferably comprises a perfume.
  • perfumes are provided in the CTFA (Cosmetic, Toiletry and Fragrance Association) 1992 International Buyers Guide, published by CFTA Publications and OPD 1993 Chemicals Buyers Directory 80th Annual Edition, published by Schnell Publishing Co.
  • the perfume comprises at least one note (compound) from: alpha-isomethyl ionone, benzyl salicylate; citronellol; coumarin; hexyl cinnamal; linalool; pentanoic acid, 2- methyl-, ethyl ester; octanal; benzyl acetate; 1 ,6-octadien-3-ol, 3,7-dimethyl-, 3-acetate; cyclohexanol, 2-(1 ,1-dimethylethyl)-, 1-acetate; delta-damascone; beta-ionone; verdyl acetate; dodecanal; hexyl cinnamic aldehyde; cyclopentadecanolide; benzeneacetic acid, 2- phenylethyl ester; amyl salicylate; beta-caryophyllene; ethyl undecylenate
  • Useful components of the perfume include materials of both natural and synthetic origin. They include single compounds and mixtures. Specific examples of such components may be found in the current literature, e.g., in Fenaroli's Handbook of Flavour Ingredients, 1975, CRC Press; Synthetic Food Adjuncts, 1947 by M. B. Jacobs, edited by Van Nostrand; or Perfume and Flavour Chemicals by S. Arctander 1969, Montclair, N.J. (USA).
  • compositions of the present invention it is envisaged that there will be four or more, preferably five or more, more preferably six or more or even seven or more different perfume components.
  • top notes are defined by Poucher (Journal of the Society of Cosmetic Chemists 6(2):80 [1955]).
  • Preferred top-notes are selected from citrus oils, linalool, linalyl acetate, lavender, dihydromyrcenol, rose oxide and cis-3-hexanol.
  • Perfume top note may be used to cue the whiteness and brightness benefit of the invention.
  • perfume may be encapsulated, typical perfume components which it is advantageous to encapsulate, include those with a relatively low boiling point, preferably those with a boiling point of less than 300, preferably 100-250 Celsius. It is also
  • perfume ingredients which have a low CLog P (ie. those which will have a greater tendency to be partitioned into water), preferably with a CLog P of less than 3.0.
  • These materials, of relatively low boiling point and relatively low CLog P have been called the "delayed blooming" perfume ingredients and include one or more of the following materials: allyl caproate, amyl acetate, amyl propionate, anisic aldehyde, anisole, benzaldehyde, benzyl acetate, benzyl acetone, benzyl alcohol, benzyl formate, benzyl iso valerate, benzyl propionate, beta gamma hexenol, camphor gum, laevo-carvone, d- carvone, cinnamic alcohol, cinamyl formate, cis-jasmone, cis-3-hexenyl acetate,
  • compositions of the present invention it is envisaged that there will be four or more, preferably five or more, more preferably six or more or even seven or more different perfume components from the list given of delayed blooming perfumes given above present in the perfume.
  • perfumes with which the present invention can be applied are the so-called aromatherapy' materials. These include many components also used in perfumery, including components of essential oils such as Clary Sage, Eucalyptus, Geranium,
  • laundry treatment composition does not contain a peroxygen bleach, e.g., sodium percarbonate, sodium perborate, and peracid.
  • a peroxygen bleach e.g., sodium percarbonate, sodium perborate, and peracid.
  • the composition is a laundry detergent composition
  • it comprises a shading dye.
  • the shading dye is present at from 0.0001 to 0.1 wt.% of the composition.
  • Dyes are described in Color Chemistry Synthesis, Properties and Applications of Organic Dyes and Pigments, (H Zollinger, Wiley VCH, Zurich, 2003) and, Industrial Dyes Chemistry, Properties Applications. (K Hunger (ed), Wiley-VCH Weinheim 2003).
  • Shading Dyes for use in laundry compositions preferably have an extinction coefficient at the maximum absorption in the visible range (400 to 700nm) of greater than
  • the dyes are blue or violet in colour.
  • Preferred shading dye chromophores are azo, azine, anthraquinone, and triphenylmethane.
  • Azo, anthraquinone, phthalocyanine and triphenylmethane dyes preferably carry a net anionic charged or are uncharged.
  • Azine preferably carry a net anionic or cationic charge.
  • Blue or violet shading dyes deposit to fabric during the wash or rinse step of the washing process providing a visible hue to the fabric. In this regard the dye gives a blue or violet colour to a white cloth with a hue angle of 240 to 345, more preferably 250 to 320, most preferably 250 to 280.
  • the white cloth used in this test is bleached non-mercerised woven cotton sheeting.
  • Mono-azo dyes preferably contain a heterocyclic ring and are most preferably thiophene dyes.
  • Preferred examples of sulphonated bis-azo compounds are direct violet 7, direct violet 9, direct violet 11 , direct violet 26, direct violet 31 , direct violet 35, direct violet 40, direct violet 41 , direct violet 51 , Direct Violet 66, direct violet 99 and alkoxylated versions thereof. Alkoxylated bis-azo dyes are discussed in WO2012/054058 and W02010/151906.
  • alkoxylated bis-azo dye is :
  • Thiophene dyes are available from Milliken under the tradenames of Liquitint Violet DD and Liquitint Violet ION.
  • Azine dye are preferably selected from sulphonated phenazine dyes and cationic phenazine dyes. Preferred examples are acid blue 98, acid violet 50, dye with CAS-No 72749-80-5, acid blue 59, and the phenazine dye selected from:
  • X3 is selected from: -H; -F; -CH3; -C2H5; -OCH3; and, -OC2H5;
  • X4 is selected from: -H; -CH3; -C2H5; -OCH3; and, -OC2H5;
  • Y 2 is selected from: -OH; -OCH 2 CH 2 OH; -CH(OH)CH 2 OH; -OC(0)CH 3 ; and, C(0)OCH 3.
  • the shading dye is present is present in the composition in range from 0.0001 to
  • the shading dye is a blue or violet shading dye.
  • a mixture of shading dyes may be used.
  • the shading dye is most preferably a reactive blue anthraquinone dye covalently linked to an alkoxylated polyethyleneimine.
  • the alkoxylation is preferably selected from ethoxylation and propoxylation, most preferably propoxylation.
  • the polyethylene imine before reaction with the dye and the propoxylation has a molecular weight of 600 to 1800.
  • composition may comprise one or more further polymers. Examples are:
  • carboxymethylcellulose poly (ethylene glycol), poly(vinyl alcohol), polycarboxylates such as polyacrylates, maleic/acrylic acid copolymers and lauryl methacrylate/acrylic acid copolymers.
  • Chelating agents may be present or absent from the detergent compositions.
  • Example phosphonic acid (or salt thereof) chelating agents are: 1-Hydroxyethylidene-1 ,1- diphosphonic acid (HEDP); Diethylenetriaminepenta(methylenephosphonic acid) (DTPMP); Hexamethylenediaminetetra(methylenephosphonic acid) (HDTMP);
  • AMP Aminotris(methylenephosphonic acid)
  • ETMP Ethylenediaminetetra(methylenephosphonic acid)
  • TTMP Tetramethylenediaminetetra(methylenephosphonic acid)
  • PBTC Phosphonobutanetricarboxylic acid
  • the DNA sequence encoding a protein with putative hydrolytic activity was identified using the ANASTASIA halaxy pipeline from the HotZyme database.
  • the gene was amplified from genomic DNA and cloning was performed using the aLICator LIC Cloning and Expression Kit for an N-terminal His 6 -tag (pLATE31 , E. coli ArcticExpress (DE3)RIL was transformed (heat- shock) and used as an expression strain for protein production.
  • TtEst mutants L37A and L251A were prepared using the QuikChange Lightning Site- Directed Mutagenesis Kit in accordance with the manufacturer’s instructions. The mutant constructs were over-expressed in the same way as the native protein.
  • AF-Est2 locus tag: AF1537; Uniprot accession number: 028735
  • the generated PCR product was digested by Nco ⁇ and Xho ⁇ and the product was purified and ligated into the protein expression vector pET24d digested with the same restriction enzymes, resulting in the plasmid pWUR365 for the expression of the C-terminal 6x-His-tag AF-Est2 protein.
  • E. coli strain BL21-CodonPlus (DE3)-RIPL was transformed with the expression plasmid.
  • AfEst2 (SEQ ID NO 4)
  • Protein production was performed in 2L Erlenmeyer flasks with 1 L LB-medium and the appropriate antibiotic for plasmid selection (Ampicillin, 100 pg/mL, Gentamycin 20 pg/mL).
  • the gene expression was induced by addition of IPTG to final 1 mM and carried out for 2d at 12 ° C and 180rpm. Cells were harvested by centrifugation (4750 x g, 20 min, 4 ° C) and stored at -80 ° C.
  • Cell lysis was performed by resuspension of the cell paste in equilibration buffer (25 mM Tris-HCI, pH 8.0, 500 mM NaCI, 20 mM Imidazole, 10mL buffer for 1g cell wet weight) and sonication on ice to break the cells.
  • the protein purification was performed using a 1 mL HisTrap FF (GE Healthcare) column and AKTA purifier system (GE Healthcare) for affinity chromatography via the poly Histidine-tag. Elution of the protein was performed via a linear gradient for 30 min using buffer with increased imidazole concentration (25 mM Tris-HCI, pH 8.0. 500 mM NaCI, 500 mM Imidazole).
  • Elution fractions were identified via absorbance (280nm) and applied to an SDS-PAGE. Fractions containing the protein of interest were pooled and dialysed overnight against 5 L of buffer without imidazole (25 mM Tris-HCI, pH 8.0, 500 mM NaCI). The dialysed protein was supplemented with 0.005% (v/v) sodium azide and 10% (v/v) glycerol for freezing and storage at -80 ° C.
  • AfEst2 Esterase from Archaeoalobus fulgidus:
  • Protein production was performed in Luria-Bertani (LB) medium containing 50 m g/ml each of kanamycin, chloramphenicol and streptomycin.
  • the LB-medium containing kanamycin and chloramphenicol with 1-3% (v/v) of preculture and incubated at 37 ° C and 180rpm until reaching O ⁇ boo 0.6.
  • the gene expression was induced by addition of IPTG to final 1 mM and carried out for overnight 30 ° C and 180rpm. Cells were harvested by centrifugation (4750 x g, 20 min, 4 ° C) and stored at -80 ° C.
  • Cell lysis was performed by resuspension of the cell paste in equilibration buffer (25 mM Tris-HCI, pH 8.0, 500 mM NaCI, 20 mM Imidazole, 10mL buffer for 1g cell wet weight) and sonication on ice to break the cells.
  • the protein purification was performed using a 1 mL HisTrap FF column using an AKTA purifier for affinity chromatography via the poly Histidine- tag. Elution of the protein was performed via a linear gradient for 30 min using buffer with increased imidazole concentration (25 mM Tris-HCI, pH 8.0. 500 mM NaCI, 500 mM
  • the total amount of protein of enzyme samples was estimated by using Sigma-Aldrich (bicinchoninic acid) BCA assay kit and the working reagent was prepared as instructed in the user’s manual.
  • BCA reagent was prepared by mixing solution A [1% ( w/v ) bicinchoninic acid in sodium salt form, 2% (w/v) sodium carbonate, 0.16% (w/v) sodium tartrate, 0.4% (w/v) sodium hydroxide, 0.95% (w/v) sodium hydrogen carbonate, pH 1 1.5] with solution B [4% (w/v) copper sulphate] at 50:1 (v/v) ratio.
  • a serial dilution of bovine serum albumin (2mg/mL) was carried out in deionised water to create 7 points of a standard curve.
  • BCA reagent 200pL was added into the wells of 96-well plate, followed by sample protein dilutions (20pL).
  • the microtitre plates (MTP) were sealed and incubated at 37°C for 30min. After incubation, the absorbance at 540nm was measured on a spectrophotometer. Determination of esterase purity
  • Esterase-containing protein samples (20mI_) were prepared with SDS-PAGE sample loading buffer and heated at 70°C for 10min before running on 4-12% NuPage Bis-Tris gels with MOPS buffer at 170V. PageRulerPlus molecular weight marker were run alongside samples for the determination of the molecular mass. Each gel was then stained using GelCode Blue Safe protein stain following the manufacturers protocol.
  • Esterase activity was determined by a colorimetric method using 4-nitrophenyl-valerate (C5) and 4-nitrophenyl-dodecanoate (C12) as substrates.
  • 4-nitrophenyl-dodecanoate (25mg) or 4-nitrophenyl-valerate (18mg) were dissolved in 10ml_ solvent (methanol) to prepare 8mM stock solutions.
  • 10ml_ solvent methanol
  • 1 ml. of stock solution was added in 7ml_ of acidified water (pH 4.5), to give a final concentration of 1 mM.
  • Table 1 A shows the composition of human-like sebum to be used in the wash studies, and which is comparable to human sebum analysed in the literature (table 1 B).
  • Macrolex violet dye (0.4% w/w) was added to the model sebum, and then 100mI_ applied to a 10x10cm swatch of polycotton which was pre-heated to 60°C. Wicking of the stain was facilitated by leaving the stain to dry o/n at 60°C. Uniformity of staining was confirmed by colourimetric determination of SRI values across the swatch which was subsequently cut into smaller 30 mm diameter circles, enabling a fit in 6-well microtitre plates for subsequent wash trials.
  • Table 1 (A) Composition of the human-like sebum tested. Shown in comparison (B) is the composition of human sebum as proposed by Nikkari 1974, In Ro 2005, Stefaniak 2010. Model human-like sebum was designed to mimic the literature description.
  • Pre-wash readings were taken for the 30 mm diameter sebum stains to measure stain intensity. Wash studies were conducted either in a 5 mL volume (within a 6 well plate, at 40 °C for 1 hour at 100 rpm) or in 10OmL (within glass bottles, at 40 °C for 1 hour at 100 rpm). Enzymes were present at 25 mg/L within 2 g/L of a 7.5% surfactancy formulation. The stains were then rinsed three times post wash to completely remove the wash liquor and any residual enzyme. After drying, the stain plates were digitally scanned and their deltaE measured. This value is used to express cleaning effect and is defined as the colour difference between a white cloth and that of the stained cloth after being washed.
  • the >3 units SRI increase for the lipase enzyme of the invention is a clearly visualised cleaning improvement compared to Cutinase and Lipex Evity (table 2).
  • Table 2 Cleaning performance of esterase enzymes of SEQ ID 1 to 4 (towards model human-like sebum) shown in comparison to controls of washes in either: water, or formulation plus benchmark commercial esterase (Cutinase) or formulation plus benchmark commercial laundry lipase (Lipex Evity)
  • the stain removal index (SRI) indicating wash performance was measured.
  • the ⁇ statistics relates to 95% confidence level. The test shows that the esterases of SEQ ID 1 to 4 had much better performance against sebum than the commercial enzymes esterase (Cutinase) and lipase (Lipex Evity).
  • Table 3 Cleaning performance of esterase enzyme of SEQ ID 4 (towards model human-like sebum) shown in comparison to controls of washes in either: water, or formulation plus benchmark commercial esterase (Cutinase) or formulation plus benchmark commercial laundry lipase (Lipex Evity)

Abstract

The invention provides a detergent composition comprising: (i) from 1 to 60 wt.% of a surfactant; and, (ii) from 0.0005 to 5 wt.% of an esterase enzyme of enzyme class EC 3.1.1.1, having at least 60% sequence identity to any one of SEQ ID NO: 1 to 4; to a method using the enzyme and to the use of the enzyme to improve cleaning of sebum stains on fabric.

Description

DETERGENT COMPOSITION
Field of Invention
The invention concerns a detergent composition, more specifically a laundry detergent composition, said composition comprising a novel esterase enzyme.
Background of the Invention
Sebum is an oily soil which has remained a difficult stain to remove from worn garments.
With a drive to encourage consumers to wash at lower temperatures, the challenge for effective removal of sebum remains demanding. Sebum consists of a number of fats and esters including wax esters, cholesterol esters, squalene and many free fatty acids/ alcohols. Sebum is liquid at body temperature, but solid at ambient temperature.
These properties are particularly important for collar/cuff soil removal because it is easier to remove a liquid body oil than solids from clothes. Current laundry enzymes are not able to degrade all the components of the sebum which makes removal from fabric difficult.
There is a problem with sebum removal in that detergents including current commercial enzymes do not remove sebum adequately.
Summary of the Invention
We have found that the incorporation of a novel esterase enzyme in detergent compositions improve the sebum removal from fabrics.
In one aspect the present invention provides a detergent composition comprising:
(i) from 1 to 60 wt.%, preferably from 2 to 50 wt.%, more preferably from 3 to 45 wt.%, even more preferably from 5 to 40 wt.%, most preferably from 6 to 40 wt.% of a surfactant; and,
(ii) from 0.0005 to 5 wt.%, preferably from 0.005 to 2.5 wt.%, more preferably from 0.01 to 1 wt.% of an esterase enzyme of enzyme class EC 3.1.1.1 , having at least 60% sequence identity to any one of SEQ ID NO: 1 to 4. Preferably the esterase enzyme has at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity to any one of SEQ ID NO: 1 to 4.
Most preferably the esterase enzyme has 100% sequence identity to any one of SEQ ID NO: 1 to 4.
Preferably the detergent composition comprises from 0.1 to 10 wt.%, preferably from 0.2 to 9 wt.%, more preferably from 0.25 to 8, even more preferably from 0.5 to 6 wt.%, most preferably from 1 to 5 wt.% of a soil release polymer, more preferably a polyester based soil released polymer.
Preferably the polyester soil release polymer is a polyethylene and/or polypropylene terephthalate based soil release polymer, preferably a polypropylene terephthalate based soil release polymer.
Preferably the detergent composition comprises an alkoxylated polyamine, preferably at a level of from 0.1 to 8 wt.%, more preferably from 0.2 to 6 wt.%, most preferably from 0.5 to 5 wt.%.
Preferably the detergent composition is a laundry detergent composition. Preferably the laundry detergent composition is a liquid or a powder, most preferably a liquid detergent.
Preferably the surfactant in the detergent composition comprises anionic and/or nonionic surfactant, in one case comprising both anionic and nonionic surfactant.
Preferred detergent compositions, particularly laundry detergent compositions additionally comprise a further enzyme selected from the group consisting of: lipases, proteases, cellulases, alpha-amylases, peroxidases/oxidases, pectate lyases, and/or mannanases.
Preferred detergent compositions, particularly laundry detergent compositions additionally comprise a further ingredient selected from fluorescent agent, perfume, shading dyes and polymers, and mixtures thereof. In another aspect the present invention provides a method of treatment of a fabric substrate with a sebum stain, said method comprising incorporation of an esterase enzyme of enzyme class EC 3.1.1.1 , having at least 60%, preferably at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity, most preferably 100%, sequence identity to any one of SEQ ID NO: 1 to 4 into a detergent composition comprising from 1 to 60 wt.% of a surfactant; and subsequent treatment of a fabric substrate with a sebum stain, with said composition.
In another aspect the present invention provides the use of an esterase enzyme of enzyme class EC 3.1.1.1 , having at least 60%, preferably at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity, most preferably 100%, sequence identity to any one of SEQ ID NO: 1 to 4, to improve cleaning of sebum stains on fabric.
Detailed Description of the Invention
The indefinite article“a” or“an” and its corresponding definite article“the” as used herein means at least one, or one or more, unless specified otherwise.
All % levels of ingredients in compositions (formulations) listed herein are in wt.% based on total formulation unless other stated.
It is understood that any reference to a preferred ingredient of the detergent composition is envisaged to be combinable subject matter with any other preferred ingredient of the detergent composition disclosed herein.
The detergent composition may take any suitable form, for example liquids, solids (including powders) or gels.
The detergent composition can be applied to any suitable substrate. Particularly preferred substrates are textiles. Particularly preferred detergent compositions are laundry detergent compositions. Laundry detergent compositions may take any suitable form. Preferred forms are liquid or powder, with liquid being most preferred.
Sequence Information
The sequences disclosed herein are SEQ ID NO 1 to 4.
SEQ ID 1 is from Thermogutta terrifontis
The sequence is:
maqrvkittt atpgeielaf edtgtglpvl Ivhgfpldrt mwkaqreelc defrvivpdl rgfgesqvip gvatmeamad dlaglcnhlg Itgkivlggl smggyvafaf arkyrdrlag lilcdtrarp dspeakenrr rvaervrreg pgfiaeemip rlccestfrn hpeviekirq milsappegv aaaalgmaer pdstdllpal scptlvlvgq fdaisppeem eamartipqs qfvvipdagh Ippmeqperv tqairewlrk vhte
SEQ ID 2 is from Thermogutta terrifontis
The sequence is:
maqrvkittt atpgeielaf edtgtglpvl IvhgfpAdrt mwkaqreelc defrvivpdl rgfgesqvip gvatmeamad dlaglcnhlg Itgkivlggl smggyvafaf arkyrdrlag lilcdtrarp dspeakenrr rvaervrreg pgfiaeemip rlccestfrn hpeviekirq milsappegv aaaalgmaer pdstdllpal scptlvlvgq fdaisppeem eamartipqs qfvvipdagh Ippmeqperv tqairewlrk vhte
This sequence is a mutant of SEQ ID 1 and differs at the 37 position.
SEQ ID 3 is from Thermogutta terrifontis
The sequence is:
maqrvkittt atpgeielaf edtgtglpvl Ivhgfpldrt mwkaqreelc defrvivpdl rgfgesqvip gvatmeamad dlaglcnhlg Itgkivlggl smggyvafaf arkyrdrlag lilcdtrarp dspeakenrr rvaervrreg pgfiaeemip rlccestfrn hpeviekirq milsappegv aaaalgmaer pdstdllpal scptlvlvgq fdaisppeem eamartipqs qfvvipdagh Appmeqperv tqairewlrk vhte
This sequence is a mutant of SEQ ID 1 and differs at the 251 position.
SEQ ID 4 is from Archaeoglobus fulgidus
The sequence is:
MLERVFIDVDGVKVSLLKGRERKVFYIHSSGSDATQWVNQLTAIGGYAIDLPNHGQSDTVE
VNSVDEYAYYASESLKKTVGKAVWGHSLGGAVAQKLYLRNPEICLALVLVGTGARLRVLP EILEGLKKEPEKAVDLMLSMAFASKGEEYEKKRREFLDRVDVLHLDLSLCDRFDLLEDYRN
GKLKIGVPTLVIVGEEDKLTPLKYHEFFHKHIPNSELWIPGASHMVMLEKHVEFNEALEKFL
KKVGV
Esterase enzyme
The esterase enzyme has at least 60% sequence identity to any one of SEQ ID NO: 1 to 4.
Preferably the esterase enzyme has at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity to any one of SEQ ID NO: 1 to 4.
Most preferably the esterase enzyme has 100% sequence identity to any one of SEQ ID NO: 1 to 4.
The esterase can be described as being of enzyme class EC 3.1.1.1 , known as
carboxylesterase.
Preferred esterases are from Thermogutta terrifontis or Archaeoglobus fulgidus.
Surfactant
The detergent composition comprises surfactant (which may include a single surfactant or a mixture of two or more surfactants). The composition comprises from 1 to 60 wt.%, preferably from 2 to 50 wt.%, more preferably from 3 to 45 wt.%, even more preferably from 5 to 40 wt.%, most preferably from 6 to 40 wt.% of surfactant.
The detergent composition (preferably a laundry detergent composition) comprises anionic and/or nonionic surfactant, preferably comprising both anionic and nonionic surfactant.
Suitable anionic detergent compounds which may be used are usually water-soluble alkali metal salts of organic sulphates and sulphonates having alkyl radicals containing from about 8 to about 22 carbon atoms, the term alkyl being used to include the alkyl portion of higher alkyl radicals. Examples of suitable synthetic anionic detergent compounds are sodium and potassium alkyl sulphates, especially those obtained by sulphating higher Cs to Cis alcohols, produced for example from tallow or coconut oil, sodium and potassium alkyl Cg to C20 benzene sulphonates, particularly sodium linear secondary alkyl C10 to C15 benzene sulphonates; and sodium alkyl glyceryl ether sulphates, especially those ethers of the higher alcohols derived from tallow or coconut oil and synthetic alcohols derived from petroleum.
The anionic surfactant is preferably selected from: linear alkyl benzene sulphonate; alkyl sulphates; alkyl ether sulphates; soaps; alkyl (preferably methyl) ester sulphonates, and mixtures thereof.
The most preferred anionic surfactants are selected from: linear alkyl benzene sulphonate; alkyl sulphates; alkyl ether sulphates and mixtures thereof. Preferably the alkyl ether sulphate is a C12-C14 n-alkyl ether sulphate with an average of 1 to 3EO (ethoxylate) units.
Sodium lauryl ether sulphate is particularly preferred (SLES). Preferably the linear alkyl benzene sulphonate is a sodium Cn to C15 alkyl benzene sulphonates. Preferably the alkyl sulphates is a linear or branched sodium C12 to Cis alkyl sulphates. Sodium dodecyl sulphate is particularly preferred, (SDS, also known as primary alkyl sulphate).
In liquid formulations preferably two or more anionic surfactant are present, for example linear alkyl benzene sulphonate together with an alkyl ether sulphate.
In liquid formulations, preferably the laundry composition in addition to the anionic surfactant comprises alkyl exthoylated non-ionic surfactant, preferably from 2 to 8 wt.% of alkyl ethoxylated non-ionic surfactant.
Suitable nonionic detergent compounds which may be used include, in particular, the reaction products of compounds having an aliphatic hydrophobic group and a reactive hydrogen atom, for example, aliphatic alcohols, acids or amides, especially ethylene oxide either alone or with propylene oxide. Preferred nonionic detergent compounds are the condensation products of aliphatic Cs to Cis primary or secondary linear or branched alcohols with ethylene oxide. Most preferably the nonionic detergent compound is the alkyl ethoxylated non-ionic surfactant is a Cs to Cie primary alcohol with an average ethoxylation of 7EO to 9EO units.
Preferably the surfactants used are saturated.
Soil release polymer
The soil release polymer is preferably present at a level of from 0.1 to 10 wt.%. Preferred levels of inclusion of the soil release polymer are preferably from 0.2 to 9 wt.%, more preferably from 0.25 to 8 wt.%, even more preferably from 0.5 to 6 wt.%, most preferably from 1 to 5 wt.%.
Preferably the soil release polymer is a polyester based soil released polymer. More preferably the polyester soil release polymer is a polyethylene and/or polypropylene terephthalate based soil release polymer, most preferably a polypropylene terephthalate based soil release polymer.
Suitable polyester based soil release polymers are described in WO 2014/029479 and WO 2016/005338.
Alkoxylated polvamine
The detergent composition preferably comprises an alkoxylated polyamine. Especially when the detergent composition is in the form of a laundry composition, it is preferred that an alkoxylated polyamine is included.
Preferred levels of alkoxylated polyamine range from 0.1 to 8 wt.%, preferably from 0.2 to 6 wt.%, more preferably from 0.5 to 5 wt.%. Another preferred level is from 1 to 4 wt.%.
The alkoxylated polyamine may be linear or branched. It may be branched to the extent that it is a dendrimer. The alkoxylation may typically be ethoxylation or propoxylation, or a mixture of both. Where a nitrogen atom is alkoxylated, a preferred average degree of alkoxylation is from 10 to 30, preferably from 15 to 25.
A preferred material is alkoxylated polyethylenimine, most preferably ethoxylated
polyethyleneimine, with an average degree of ethoxylation being from 10 to 30 preferably from 15 to 25, where a nitrogen atom is ethoxylated. Additional Enzymes
Additional enzymes, other than the specified lipase may be present in the detergent composition. It is preferred that additional enzymes are present in the preferred laundry detergent composition.
If present, then the level of each enzyme in the laundry composition of the invention is from 0.0001 wt.% to 0.1 wt.%.
Levels of enzyme present in the composition preferably relate to the level of enzyme as pure protein.
Preferred further enzymes include those in the group consisting of: lipases, proteases, cellulases, alpha-amylases, peroxidases/oxidases, pectate lyases, and/or mannanases.
Said preferred additional enzymes include a mixture of two or more of these enzymes.
Preferably the further enzyme is selected from: lipases, proteases, cellulases, and/or alpha- amylases.
Suitable lipases include those of bacterial or fungal origin. Chemically modified or protein engineered mutants are included. Examples of useful lipases include lipases from Humicola (synonym Thermomyces), e.g. from H. lanuginosa ( T . lanuginosus) as described in EP 258 068 and EP 305 216 or from H. insolens as described in WO 96/13580, a Pseudomonas lipase, e.g. from P. alcaligenes or P. pseudoalcaligenes (EP 218 272), P. cepacia (EP 331 376), P. stutzeri (GB 1 ,372,034), P. fluorescens, Pseudomonas sp. strain SD 705 (WO 95/06720 and WO 96/27002), P. wisconsinensis (WO 96/12012), a Bacillus lipase, e.g. from B. subtilis (Dartois et al. (1993), Biochemica et Biophysica Acta, 1131 , 253-360),
B. stearothermophilus (JP 64/744992) or B. pumilus (WO 91/16422).
Other examples are lipase variants such as those described in WO 92/05249,
WO 94/01541 , EP 407 225, EP 260 105, WO 95/35381 , WO 96/00292,
WO 95/30744, WO 94/25578, WO 95/14783, WO 95/22615, WO 97/04079 and
WO 97/07202, WO 00/60063.
Preferred commercially available lipase enzymes include Lipolase™ and Lipolase Ultra™, Lipex™ and Lipoclean™ (Novozymes A/S). The method of the invention may be carried out in the presence of phospholipase classified as EC 3.1.1.4 and/or EC 3.1.1.32. As used herein, the term phospholipase is an enzyme which has activity towards phospholipids.
Phospholipids, such as lecithin or phosphatidylcholine, consist of glycerol esterified with two fatty acids in an outer (sn-1 ) and the middle (sn-2) positions and esterified with phosphoric acid in the third position; the phosphoric acid, in turn, may be esterified to an amino-alcohol. Phospholipases are enzymes which participate in the hydrolysis of phospholipids. Several types of phospholipase activity can be distinguished, including phospholipases Ai and A2 which hydrolyze one fatty acyl group (in the sn-1 and sn-2 position, respectively) to form lysophospholipid; and lysophospholipase (or phospholipase B) which can hydrolyze the remaining fatty acyl group in lysophospholipid. Phospholipase C and phospholipase D (phosphodiesterases) release diacyl glycerol or phosphatidic acid respectively.
Protease enzymes hydrolyse bonds within peptides and proteins, in the laundry context this leads to enhanced removal of protein or peptide containing stains. Examples of suitable proteases families include aspartic proteases; cysteine proteases; glutamic proteases; aspargine peptide lyase; serine proteases and threonine proteases. Such protease families are described in the MEROPS peptidase database (httpi//merops. sanqer.ac.uk/). Serine proteases are preferred. Subtilase type serine proteases are more preferred. The term "subtilases" refers to a sub-group of serine protease according to Siezen et al., Protein Engng. 4 (1991 ) 719-737 and Siezen et al. Protein Science 6 (1997) 501 -523. Serine proteases are a subgroup of proteases characterized by having a serine in the active site, which forms a covalent adduct with the substrate. The subtilases may be divided into 6 sub divisions, i.e. the Subtilisin family, the Thermitase family, the Proteinase K family, the Lantibiotic peptidase family, the Kexin family and the Pyrolysin family.
Examples of subtilases are those derived from Bacillus such as Bacillus lentus, B.
alkalophilus, B. subtilis, B. amyloliquefaciens, Bacillus pumilus and Bacillus gibsonii described in; US7262042 and W009/021867, and subtilisin lentus, subtilisin Novo, subtilisin Carlsberg, Bacillus licheniformis, subtilisin BPN', subtilisin 309, subtilisin 147 and subtilisin 168 described in WO 89/06279 and protease PD138 described in (WO 93/18140). Other useful proteases may be those described in WO 92/175177, WO 01/016285, WO 02/026024 and WO 02/016547. Examples of trypsin-like proteases are trypsin (e.g. of porcine or bovine origin) and the Fusarium protease described in WO 89/06270, WO 94/25583 and WO 05/040372, and the chymotrypsin proteases derived from Cellumonas described in WO 05/052161 and WO 05/052146.
Most preferably the protease is a subtilisins (EC 3.4.21.62).
Examples of subtilases are those derived from Bacillus such as Bacillus lentus, B.
alkalophilus, B. subtilis, B. amyloliquefaciens, Bacillus pumilus and Bacillus gibsonii described in; US7262042 and W009/021867, and subtilisin lentus, subtilisin Novo, subtilisin Carlsberg, Bacillus licheniformis, subtilisin BPN', subtilisin 309, subtilisin 147 and subtilisin 168 described in WO89/06279 and protease PD138 described in (WO93/18140). Preferably the subsilisin is derived from Bacillus, preferably Bacillus lentus, B. alkalophilus, B. subtilis,
B. amyloliquefaciens, Bacillus pumilus and Bacillus gibsonii as described in US 6,312,936 Bl, US 5,679,630, US 4,760,025, US7,262,042 and WO 09/021867. Most preferably the subtilisin is derived from Bacillus gibsonii or Bacillus Lentus.
Suitable commercially available protease enzymes include those sold under the trade names names Alcalase®, Blaze®; DuralaseTm, DurazymTm, Relase®, Relase® Ultra, Savinase®, Savinase® Ultra, Primase®, Polarzyme®, Kannase®, Liquanase®, Liquanase® Ultra, Ovozyme®, Coronase®, Coronase® Ultra, Neutrase®, Everlase® and Esperase® all could be sold as Ultra® or Evity® (Novozymes A/S).
The composition may use cutinase, classified in EC 3.1.1.74. The cutinase used according to the invention may be of any origin. Preferably cutinases are of microbial origin, in particular of bacterial, of fungal or of yeast origin.
Suitable amylases (alpha and/or beta) include those of bacterial or fungal origin. Chemically modified or protein engineered mutants are included. Amylases include, for example, alpha- amylases obtained from Bacillus, e.g. a special strain of B. licheniformis, described in more detail in GB 1 ,296,839, or the Bacillus sp. strains disclosed in WO 95/026397 or WO
00/060060. Commercially available amylases are Duramyl™, Termamyl™, Termamyl Ultra™, Natalase™, Stainzyme™, Amplify™, Fungamyl™ and BAN™ (Novozymes A/S), Rapidase™ and Purastar™ (from Genencor International Inc.).
Suitable cellulases include those of bacterial or fungal origin. Chemically modified or protein engineered mutants are included. Suitable cellulases include cellulases from the genera Bacillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, e.g. the fungal cellulases produced from Humicola insolens, Thielavia terrestris, Myceliophthora
thermophila, and Fusarium oxysporum disclosed in US 4,435,307, US 5,648,263, US 5,691 ,178, US 5,776,757, WO 89/09259, WO 96/029397, and WO 98/012307. Commercially available cellulases include Celluzyme™, Carezyme™, Celluclean™, Endolase™, Renozyme™ (Novozymes A/S), Clazinase™ and Puradax HA™ (Genencor International Inc.), and KAC-500(B)™ (Kao Corporation). Celluclean™ is preferred.
Suitable peroxidases/oxidases include those of plant, bacterial or fungal origin. Chemically modified or protein engineered mutants are included. Examples of useful peroxidases include peroxidases from Coprinus, e.g. from C. cinereus, and variants thereof as those described in WO 93/24618, WO 95/10602, and WO 98/15257. Commercially available peroxidases include Guardzyme™ and Novozym™ 51004 (Novozymes A/S).
Further enzymes suitable for use are discussed in WO 2009/087524, WO 2009/090576, WO 2009/107091 , WO 2009/1 11258 and WO 2009/148983.
The aqueous solution used in the method preferably has an enzyme present. The enzyme is preferably present in the aqueous solution used in the method at a concentration in the range from 0.01 to 10ppm, preferably 0.05 to 1 ppm.
Enzyme Stabilizers
Any enzyme present in the composition may be stabilized using conventional stabilizing agents, e.g., a polyol such as propylene glycol or glycerol, a sugar or sugar alcohol, lactic acid, boric acid, or a boric acid derivative, e.g., an aromatic borate ester, or a phenyl boronic acid derivative such as 4-formylphenyl boronic acid, and the composition may be formulated as described in e.g. WO 92/19709 and WO 92/19708.
Further materials
Further optional but preferred materials that may be included in the detergent compositions (preferably laundry detergent compositions) include fluorescent agent, perfume, shading dyes, polymers and chelating agents. Fluorescent Agent
The composition preferably comprises a fluorescent agent (optical brightener). Fluorescent agents are well known and many such fluorescent agents are available commercially.
Usually, these fluorescent agents are supplied and used in the form of their alkali metal salts, for example, the sodium salts.
The total amount of the fluorescent agent or agents used in the composition is generally from 0.0001 to 0.5 wt.%, preferably 0.005 to 2 wt.%, more preferably 0.01 to 0.1 wt.%.
Preferred classes of fluorescer are: Di-styryl biphenyl compounds, e.g. Tinopal (Trade Mark) CBS-X, Di-amine stilbene di-sulphonic acid compounds, e.g. Tinopal DMS pure Xtra and Blankophor (Trade Mark) HRH, and Pyrazoline compounds, e.g. Blankophor SN.
Preferred fluorescers are fluorescers with CAS-No 3426-43-5; CAS-No 35632-99-6; CAS-No 24565-13-7; CAS-No 12224-16-7; CAS-No 13863-31-5; CAS-No 4193-55-9; CAS-No 16090- 02-1 ; CAS-No 133-66-4; CAS-No 68444-86-0; CAS-No 27344-41-8.
Most preferred fluorescers are: sodium 2 (4-styryl-3-sulfophenyl)-2H-napthol[1 ,2-d]triazole, disodium 4,4'-bis{[(4-anilino-6-(N methyl-N-2 hydroxyethyl) amino 1 ,3,5-triazin-2- yl)]amino}stilbene-2-2' disulphonate, disodium 4,4'-bis{[(4-anilino-6-morpholino-1 ,3,5-triazin- 2-yl)]amino} stilbene-2-2' disulphonate, and disodium 4,4'-bis(2-sulphostyryl)biphenyl.
The aqueous solution used in the method has a fluorescer present. The fluorescer is present in the aqueous solution used in the method preferably in the range from 0.0001 g/l to 0.1 g/l, more preferably 0.001 to 0.02 g/l.
Perfume
The composition preferably comprises a perfume. Many suitable examples of perfumes are provided in the CTFA (Cosmetic, Toiletry and Fragrance Association) 1992 International Buyers Guide, published by CFTA Publications and OPD 1993 Chemicals Buyers Directory 80th Annual Edition, published by Schnell Publishing Co.
Preferably the perfume comprises at least one note (compound) from: alpha-isomethyl ionone, benzyl salicylate; citronellol; coumarin; hexyl cinnamal; linalool; pentanoic acid, 2- methyl-, ethyl ester; octanal; benzyl acetate; 1 ,6-octadien-3-ol, 3,7-dimethyl-, 3-acetate; cyclohexanol, 2-(1 ,1-dimethylethyl)-, 1-acetate; delta-damascone; beta-ionone; verdyl acetate; dodecanal; hexyl cinnamic aldehyde; cyclopentadecanolide; benzeneacetic acid, 2- phenylethyl ester; amyl salicylate; beta-caryophyllene; ethyl undecylenate; geranyl anthranilate; alpha-irone; beta-phenyl ethyl benzoate; alpa-santalol; cedrol; cedryl acetate; cedry formate; cyclohexyl salicyate; gamma-dodecalactone; and, beta phenylethyl phenyl acetate.
Useful components of the perfume include materials of both natural and synthetic origin. They include single compounds and mixtures. Specific examples of such components may be found in the current literature, e.g., in Fenaroli's Handbook of Flavour Ingredients, 1975, CRC Press; Synthetic Food Adjuncts, 1947 by M. B. Jacobs, edited by Van Nostrand; or Perfume and Flavour Chemicals by S. Arctander 1969, Montclair, N.J. (USA).
It is commonplace for a plurality of perfume components to be present in a formulation. In the compositions of the present invention it is envisaged that there will be four or more, preferably five or more, more preferably six or more or even seven or more different perfume components.
In perfume mixtures preferably 15 to 25 wt% are top notes. Top notes are defined by Poucher (Journal of the Society of Cosmetic Chemists 6(2):80 [1955]). Preferred top-notes are selected from citrus oils, linalool, linalyl acetate, lavender, dihydromyrcenol, rose oxide and cis-3-hexanol.
The International Fragrance Association has published a list of fragrance ingredients (perfumes) in 2011. (http://www.ifraorq.Org/en-us/inqredients#.U7Z4hPldWzk)
The Research Institute for Fragrance Materials provides a database of perfumes
(fragrances) with safety information.
Perfume top note may be used to cue the whiteness and brightness benefit of the invention.
Some or all of the perfume may be encapsulated, typical perfume components which it is advantageous to encapsulate, include those with a relatively low boiling point, preferably those with a boiling point of less than 300, preferably 100-250 Celsius. It is also
advantageous to encapsulate perfume components which have a low CLog P (ie. those which will have a greater tendency to be partitioned into water), preferably with a CLog P of less than 3.0. These materials, of relatively low boiling point and relatively low CLog P have been called the "delayed blooming" perfume ingredients and include one or more of the following materials: allyl caproate, amyl acetate, amyl propionate, anisic aldehyde, anisole, benzaldehyde, benzyl acetate, benzyl acetone, benzyl alcohol, benzyl formate, benzyl iso valerate, benzyl propionate, beta gamma hexenol, camphor gum, laevo-carvone, d- carvone, cinnamic alcohol, cinamyl formate, cis-jasmone, cis-3-hexenyl acetate,
cuminic alcohol, cyclal c, dimethyl benzyl carbinol, dimethyl benzyl carbinol acetate, ethyl acetate, ethyl aceto acetate, ethyl amyl ketone, ethyl benzoate, ethyl butyrate, ethyl hexyl ketone, ethyl phenyl acetate, eucalyptol, eugenol, fenchyl acetate, flor acetate (tricyclo decenyl acetate) , frutene (tricyclco decenyl propionate) , geraniol, hexenol, hexenyl acetate, hexyl acetate, hexyl formate, hydratropic alcohol, hydroxycitronellal, indone, isoamyl alcohol, iso menthone, isopulegyl acetate, isoquinolone, ligustral, linalool, linalool oxide, linalyl formate, menthone, menthyl acetphenone, methyl amyl ketone, methyl anthranilate, methyl benzoate, methyl benyl acetate, methyl eugenol, methyl heptenone, methyl heptine carbonate, methyl heptyl ketone, methyl hexyl ketone, methyl phenyl carbinyl acetate, methyl salicylate, methyl-n-methyl anthranilate, nerol, octalactone, octyl alcohol, p-cresol, p- cresol methyl ether, p-methoxy acetophenone, p-methyl acetophenone, phenoxy ethanol, phenyl acetaldehyde, phenyl ethyl acetate, phenyl ethyl alcohol, phenyl ethyl dimethyl carbinol, prenyl acetate, propyl bornate, pulegone, rose oxide, safrole, 4-terpinenol, alpha- terpinenol, and /or viridine. It is commonplace for a plurality of perfume components to be present in a formulation. In the compositions of the present invention it is envisaged that there will be four or more, preferably five or more, more preferably six or more or even seven or more different perfume components from the list given of delayed blooming perfumes given above present in the perfume.
Another group of perfumes with which the present invention can be applied are the so- called aromatherapy' materials. These include many components also used in perfumery, including components of essential oils such as Clary Sage, Eucalyptus, Geranium,
Lavender, Mace Extract, Neroli, Nutmeg, Spearmint, Sweet Violet Leaf and Valerian.
It is preferred that the laundry treatment composition does not contain a peroxygen bleach, e.g., sodium percarbonate, sodium perborate, and peracid. Shading Dye
Preferably when the composition is a laundry detergent composition, then it comprises a shading dye. Preferably the shading dye is present at from 0.0001 to 0.1 wt.% of the composition.
Dyes are described in Color Chemistry Synthesis, Properties and Applications of Organic Dyes and Pigments, (H Zollinger, Wiley VCH, Zurich, 2003) and, Industrial Dyes Chemistry, Properties Applications. (K Hunger (ed), Wiley-VCH Weinheim 2003).
Shading Dyes for use in laundry compositions preferably have an extinction coefficient at the maximum absorption in the visible range (400 to 700nm) of greater than
5000 L mol 1 cm 1, preferably greater than 10000 L mol 1 cm 1. The dyes are blue or violet in colour.
Preferred shading dye chromophores are azo, azine, anthraquinone, and triphenylmethane.
Azo, anthraquinone, phthalocyanine and triphenylmethane dyes preferably carry a net anionic charged or are uncharged. Azine preferably carry a net anionic or cationic charge. Blue or violet shading dyes deposit to fabric during the wash or rinse step of the washing process providing a visible hue to the fabric. In this regard the dye gives a blue or violet colour to a white cloth with a hue angle of 240 to 345, more preferably 250 to 320, most preferably 250 to 280. The white cloth used in this test is bleached non-mercerised woven cotton sheeting.
Shading dyes are discussed in WO 2005/003274, WO 2006/032327(Unilever),
WO 2006/032397(Unilever), WO 2006/045275(Unilever), WO 2006/027086(Unilever),
WO 2008/017570(Unilever), WO 2008/141880 (Unilever), WO 2009/132870(Unilever), WO 2009/141 173 (Unilever), WO 2010/099997(Unilever), WO 2010/102861 (Unilever), WO 2010/148624(Unilever), WO 2008/087497 (P&G), WO 201 1/01 1799 (P&G), WO
2012/054820 (P&G), WO 2013/142495 (P&G) and WO 2013/151970 (P&G).
Mono-azo dyes preferably contain a heterocyclic ring and are most preferably thiophene dyes. The mono-azo dyes are preferably alkoxylated and are preferably uncharged or anionically charged at pH=7. Alkoxylated thiophene dyes are discussed in WO/2013/142495 and WO/2008/087497. Preferred examples of thiophene dyes are shown below: Bis-azo dyes are preferably sulphonated bis-azo dyes. Preferred examples of sulphonated bis-azo compounds are direct violet 7, direct violet 9, direct violet 11 , direct violet 26, direct violet 31 , direct violet 35, direct violet 40, direct violet 41 , direct violet 51 , Direct Violet 66, direct violet 99 and alkoxylated versions thereof. Alkoxylated bis-azo dyes are discussed in WO2012/054058 and W02010/151906.
An example of an alkoxylated bis-azo dye is :
Figure imgf000017_0001
Thiophene dyes are available from Milliken under the tradenames of Liquitint Violet DD and Liquitint Violet ION. Azine dye are preferably selected from sulphonated phenazine dyes and cationic phenazine dyes. Preferred examples are acid blue 98, acid violet 50, dye with CAS-No 72749-80-5, acid blue 59, and the phenazine dye selected from:
Figure imgf000018_0001
wherein:
X3 is selected from: -H; -F; -CH3; -C2H5; -OCH3; and, -OC2H5;
X4 is selected from: -H; -CH3; -C2H5; -OCH3; and, -OC2H5;
Y2 is selected from: -OH; -OCH2CH2OH; -CH(OH)CH2OH; -OC(0)CH3; and, C(0)OCH3.
The shading dye is present is present in the composition in range from 0.0001 to
0.5 wt %, preferably 0.001 to 0.1 wt%. Depending upon the nature of the shading dye there are preferred ranges depending upon the efficacy of the shading dye which is dependent on class and particular efficacy within any particular class. As stated above the shading dye is a blue or violet shading dye.
A mixture of shading dyes may be used. The shading dye is most preferably a reactive blue anthraquinone dye covalently linked to an alkoxylated polyethyleneimine. The alkoxylation is preferably selected from ethoxylation and propoxylation, most preferably propoxylation. Preferably 80 to 95 mol% of the N-H groups in the polyethylene imine are replaced with iso-propyl alcohol groups by propoxylation.
Preferably the polyethylene imine before reaction with the dye and the propoxylation has a molecular weight of 600 to 1800.
An example structure of a preferred reactive anthraquinone covalently attached to a propoxylated polyethylene imine is: (Structure I).
Polymers
The composition may comprise one or more further polymers. Examples are
carboxymethylcellulose, poly (ethylene glycol), poly(vinyl alcohol), polycarboxylates such as polyacrylates, maleic/acrylic acid copolymers and lauryl methacrylate/acrylic acid copolymers. Chelating Agent
Chelating agents may be present or absent from the detergent compositions.
If present, then the chelating agent is present at a level of from 0.01 to 5 wt.%. Example phosphonic acid (or salt thereof) chelating agents are: 1-Hydroxyethylidene-1 ,1- diphosphonic acid (HEDP); Diethylenetriaminepenta(methylenephosphonic acid) (DTPMP); Hexamethylenediaminetetra(methylenephosphonic acid) (HDTMP);
Aminotris(methylenephosphonic acid) (ATMP); Ethylenediaminetetra(methylenephosphonic acid) (EDTMP); Tetramethylenediaminetetra(methylenephosphonic acid) (TDTMP); and, Phosphonobutanetricarboxylic acid (PBTC). Examples
The invention will be demonstrated by the following non-limiting examples.
Examples
Cloning & expression including sequence information
TtEst Thermoautta terrifontis :
The DNA sequence encoding a protein with putative hydrolytic activity was identified using the ANASTASIA halaxy pipeline from the HotZyme database. The gene was amplified from genomic DNA and cloning was performed using the aLICator LIC Cloning and Expression Kit for an N-terminal His6-tag (pLATE31 , E. coli ArcticExpress (DE3)RIL was transformed (heat- shock) and used as an expression strain for protein production.
TtEst mutants L37A and L251A were prepared using the QuikChange Lightning Site- Directed Mutagenesis Kit in accordance with the manufacturer’s instructions. The mutant constructs were over-expressed in the same way as the native protein.
TtEst (SEQ ID NO 1)
maqrvkittt atpgeielaf edtgtglpvl Ivhgfpldrt mwkaqreelc defrvivpdl rgfgesqvip gvatmeamad dlaglcnhlg Itgkivlggl smggyvafaf arkyrdrlag lilcdtrarp dspeakenrr rvaervrreg pgfiaeemip rlccestfrn hpeviekirq milsappegv aaaalgmaer pdstdllpal scptlvlvgq fdaisppeem eamartipqs qfvvipdagh Ippmeqperv tqairewlrk vhte
TtEst L37A (SEQ ID NO 2)
maqrvkittt atpgeielaf edtgtglpvl IvhgfpAdrt mwkaqreelc defrvivpdl rgfgesqvip gvatmeamad dlaglcnhlg Itgkivlggl smggyvafaf arkyrdrlag lilcdtrarp dspeakenrr rvaervrreg pgfiaeemip rlccestfrn hpeviekirq milsappegv aaaalgmaer pdstdllpal scptlvlvgq fdaisppeem eamartipqs qfvvipdagh Ippmeqperv tqairewlrk vhte
TtEst L251A (SEQ ID NO 3)
maqrvkittt atpgeielaf edtgtglpvl Ivhgfpldrt mwkaqreelc defrvivpdl rgfgesqvip gvatmeamad dlaglcnhlg Itgkivlggl smggyvafaf arkyrdrlag lilcdtrarp dspeakenrr rvaervrreg pgfiaeemip rlccestfrn hpeviekirq milsappegv aaaalgmaer pdstdllpal scptlvlvgq fdaisppeem eamartipqs qfvvipdagh Appmeqperv tqairewlrk vhte AfEst2: Esterase from Archaeoalobus fulgidus-.
The gene encoding AF-Est2 (locus tag: AF1537; Uniprot accession number: 028735) was PCR-amplified, without its stop codon, using chromosomal DNA of A. fulgidus as a template and introducing respectively a Nco\ and Xho\ restriction site. The generated PCR product was digested by Nco\ and Xho\ and the product was purified and ligated into the protein expression vector pET24d digested with the same restriction enzymes, resulting in the plasmid pWUR365 for the expression of the C-terminal 6x-His-tag AF-Est2 protein. E. coli strain BL21-CodonPlus (DE3)-RIPL was transformed with the expression plasmid.
AfEst2 (SEQ ID NO 4)
MLERVFIDVDGVKVSLLKGRERKVFYIHSSGSDATQWVNQLTAIGGYAIDLPNHGQSDTVE
VNSVDEYAYYASESLKKTVGKAVWGHSLGGAVAQKLYLRNPEICLALVLVGTGARLRVLP
EILEGLKKEPEKAVDLMLSMAFASKGEEYEKKRREFLDRVDVLHLDLSLCDRFDLLEDYRN
GKLKIGVPTLVIVGEEDKLTPLKYHEFFHKHIPNSELWIPGASHMVMLEKHVEFNEALEKFL
KKVGV
Fermentation (harvest) & purification
TtEst Thermoautta terrifontis :
Protein production was performed in 2L Erlenmeyer flasks with 1 L LB-medium and the appropriate antibiotic for plasmid selection (Ampicillin, 100 pg/mL, Gentamycin 20 pg/mL). The LB-medium containing only Ampicillin was inoculated with 1-3% (v/v) of preculture and incubated at 37°C and 180rpm until reaching Oϋboo = 0.4. Subsequent the incubation temperature was lowered to 12 °C for 1 h. The gene expression was induced by addition of IPTG to final 1 mM and carried out for 2d at 12°C and 180rpm. Cells were harvested by centrifugation (4750 x g, 20 min, 4 °C) and stored at -80°C.
Cell lysis was performed by resuspension of the cell paste in equilibration buffer (25 mM Tris-HCI, pH 8.0, 500 mM NaCI, 20 mM Imidazole, 10mL buffer for 1g cell wet weight) and sonication on ice to break the cells. The protein purification was performed using a 1 mL HisTrap FF (GE Healthcare) column and AKTA purifier system (GE Healthcare) for affinity chromatography via the poly Histidine-tag. Elution of the protein was performed via a linear gradient for 30 min using buffer with increased imidazole concentration (25 mM Tris-HCI, pH 8.0. 500 mM NaCI, 500 mM Imidazole). Elution fractions were identified via absorbance (280nm) and applied to an SDS-PAGE. Fractions containing the protein of interest were pooled and dialysed overnight against 5 L of buffer without imidazole (25 mM Tris-HCI, pH 8.0, 500 mM NaCI). The dialysed protein was supplemented with 0.005% (v/v) sodium azide and 10% (v/v) glycerol for freezing and storage at -80 °C.
AfEst2: Esterase from Archaeoalobus fulgidus:
Protein production was performed in Luria-Bertani (LB) medium containing 50 m g/ml each of kanamycin, chloramphenicol and streptomycin. The LB-medium containing kanamycin and chloramphenicol with 1-3% (v/v) of preculture and incubated at 37°C and 180rpm until reaching Oϋboo = 0.6. The gene expression was induced by addition of IPTG to final 1 mM and carried out for overnight 30°C and 180rpm. Cells were harvested by centrifugation (4750 x g, 20 min, 4 °C) and stored at -80°C.
Cell lysis was performed by resuspension of the cell paste in equilibration buffer (25 mM Tris-HCI, pH 8.0, 500 mM NaCI, 20 mM Imidazole, 10mL buffer for 1g cell wet weight) and sonication on ice to break the cells. The protein purification was performed using a 1 mL HisTrap FF column using an AKTA purifier for affinity chromatography via the poly Histidine- tag. Elution of the protein was performed via a linear gradient for 30 min using buffer with increased imidazole concentration (25 mM Tris-HCI, pH 8.0. 500 mM NaCI, 500 mM
Imidazole). Elution fractions were identified via absorbance (280nm) and applied to an SDS- PAGE. Fractions containing the protein of interest were pooled and dialysed overnight against 5 L of buffer without imidazole (25 mM Tris-HCI, pH 8.0, 500 mM NaCI). The dialysed protein was supplemented with 0.005% (v/v) sodium azide and 10% (v/v) glycerol for freezing and storage at -80 °C.
Bioanalytics
Determination of protein concentration
The total amount of protein of enzyme samples was estimated by using Sigma-Aldrich (bicinchoninic acid) BCA assay kit and the working reagent was prepared as instructed in the user’s manual. BCA reagent was prepared by mixing solution A [1% ( w/v ) bicinchoninic acid in sodium salt form, 2% (w/v) sodium carbonate, 0.16% (w/v) sodium tartrate, 0.4% (w/v) sodium hydroxide, 0.95% (w/v) sodium hydrogen carbonate, pH 1 1.5] with solution B [4% (w/v) copper sulphate] at 50:1 (v/v) ratio. A serial dilution of bovine serum albumin (2mg/mL) was carried out in deionised water to create 7 points of a standard curve. To perform the assay, BCA reagent (200pL) was added into the wells of 96-well plate, followed by sample protein dilutions (20pL). The microtitre plates (MTP) were sealed and incubated at 37°C for 30min. After incubation, the absorbance at 540nm was measured on a spectrophotometer. Determination of esterase purity
Esterase-containing protein samples (20mI_) were prepared with SDS-PAGE sample loading buffer and heated at 70°C for 10min before running on 4-12% NuPage Bis-Tris gels with MOPS buffer at 170V. PageRulerPlus molecular weight marker were run alongside samples for the determination of the molecular mass. Each gel was then stained using GelCode Blue Safe protein stain following the manufacturers protocol.
Biochemical determination of esterase activity
Esterase activity was determined by a colorimetric method using 4-nitrophenyl-valerate (C5) and 4-nitrophenyl-dodecanoate (C12) as substrates. 4-nitrophenyl-dodecanoate (25mg) or 4-nitrophenyl-valerate (18mg) were dissolved in 10ml_ solvent (methanol) to prepare 8mM stock solutions. Before carrying out the assay, 1 ml. of stock solution was added in 7ml_ of acidified water (pH 4.5), to give a final concentration of 1 mM. In 96-well microtitre plates, 60mI_ dH20, 1 15mI_ Tris-HCI buffer (pH 8.5, 50mM), 5mI_ of diluted enzyme solution and 20mI_ substrate (multi-channel at the end) were added. For blanks, enzyme solution was replaced with dH20. Following the addition of reagents, the release of product (4-nitrophenol) was monitored at 405nm for 15min at ambient temperature.
APPLICATION TESTING
Composition of model human-like sebum and application to fabric
Table 1 A shows the composition of human-like sebum to be used in the wash studies, and which is comparable to human sebum analysed in the literature (table 1 B). Macrolex violet dye (0.4% w/w) was added to the model sebum, and then 100mI_ applied to a 10x10cm swatch of polycotton which was pre-heated to 60°C. Wicking of the stain was facilitated by leaving the stain to dry o/n at 60°C. Uniformity of staining was confirmed by colourimetric determination of SRI values across the swatch which was subsequently cut into smaller 30 mm diameter circles, enabling a fit in 6-well microtitre plates for subsequent wash trials.
Table 1 : (A) Composition of the human-like sebum tested. Shown in comparison (B) is the composition of human sebum as proposed by Nikkari 1974, In Ro 2005, Stefaniak 2010. Model human-like sebum was designed to mimic the literature description.
Figure imgf000024_0001
Figure imgf000024_0002
Wash studies for enzymatic cleaning performance against human-like sebum
Pre-wash readings were taken for the 30 mm diameter sebum stains to measure stain intensity. Wash studies were conducted either in a 5 mL volume (within a 6 well plate, at 40 °C for 1 hour at 100 rpm) or in 10OmL (within glass bottles, at 40 °C for 1 hour at 100 rpm). Enzymes were present at 25 mg/L within 2 g/L of a 7.5% surfactancy formulation. The stains were then rinsed three times post wash to completely remove the wash liquor and any residual enzyme. After drying, the stain plates were digitally scanned and their deltaE measured. This value is used to express cleaning effect and is defined as the colour difference between a white cloth and that of the stained cloth after being washed.
Mathematically, the definition of deltaE is:
deltaE = [ (AL) 2 + (Aa) 2 + (Ab) 2 ] 1/2 wherein AL is a measure of the difference in darkness between the washed and white cloth; Aa and Ab are measures for the difference in redness and yellowness respectively between both cloths. From this equation, it is clear that the lower the value of deltaE, the whiter the cloth will be. With regard to this colour measurement technique, reference is made to Commission International de I'Eclairage (CIE); Recommendation on Uniform Colour Spaces, colour difference equations, psychometric colour terms, supplement no. 2 to CIE Publication, no. 15, Colormetry, Bureau Central de la CIE, Paris 1978. Herein the cleaning effect is expressed in the form of a stain removal index (SRI):
SRI = 100 - deltaE.
The higher the SRI the cleaner the cloth, SRI = 100 (white).
Enzymatic cleaning performance against human-like sebum
Wash studies in a 5ml_ wash volume identified that the esterase enzymes of SEQ ID 1 to 4 the enzymes denoted TtEst, TtEst37, TtEstl 51 , AfEst2, all show improved performance towards removal of the human-like sebum than the control samples with includes the laundry esterase benchmark (Cutinase) and the laundry lipase benchmark (Lipase Evity). The 3-5 units SRI increase for the experimental enzymes shown is a clearly visualised cleaning improvement above that of the control enzyme cutinase and the laundry lipase benchmark (Lipase Evity). Test was carried out in triplicate at 40°C for 1 h. Formulation applied contains 7.5% total surfactant.
The >3 units SRI increase for the lipase enzyme of the invention is a clearly visualised cleaning improvement compared to Cutinase and Lipex Evity (table 2).
Figure imgf000025_0001
Table 2: Cleaning performance of esterase enzymes of SEQ ID 1 to 4 (towards model human-like sebum) shown in comparison to controls of washes in either: water, or formulation plus benchmark commercial esterase (Cutinase) or formulation plus benchmark commercial laundry lipase (Lipex Evity)
The stain removal index (SRI) indicating wash performance was measured. The ± statistics relates to 95% confidence level. The test shows that the esterases of SEQ ID 1 to 4 had much better performance against sebum than the commercial enzymes esterase (Cutinase) and lipase (Lipex Evity).
Enzymatic cleaning performance against human-like sebum
Wash studies in a 100mL volume confirm that the lipase of SEQ ID 4 shows improved performance towards removal of the human-like sebum than the control samples which includes the current commercial enzymes esterase (Cutinase) and lipase (Lipex Evity) (Table 3). Test was carried out in triplicate at 40°C for 1 h. Formulation applied contains 7.5% total surfactant.
Figure imgf000026_0001
Table 3: Cleaning performance of esterase enzyme of SEQ ID 4 (towards model human-like sebum) shown in comparison to controls of washes in either: water, or formulation plus benchmark commercial esterase (Cutinase) or formulation plus benchmark commercial laundry lipase (Lipex Evity)

Claims

1. A detergent composition comprising:
(i) from 1 to 60 wt.%, preferably from 2 to 50 wt.%, more preferably from 3 to 45 wt.%, even more preferably from 5 to 40 wt.%, most preferably from 6 to 40 wt.% of a surfactant; and,
(ii) from 0.0005 to 5 wt.%, preferably from 0.005 to 2.5 wt.%, more preferably from 0.01 to 1 wt.% of an esterase enzyme of enzyme class EC 3.1.1.1 , having at least 60% sequence identity to any one of SEQ ID NO: 1 to 4.
2. A detergent composition according to claim 1 , wherein the esterase enzyme has at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity to any one of SEQ ID NO: 1 to 4.
3. A detergent composition according to claim 1 or claim 2, wherein the esterase enzyme has 100% sequence identity to any one of SEQ ID NO: 1 to 4.
4. A detergent composition according to any preceding claim, comprising from 0.1 to 10 wt.%, preferably from 0.2 to 9 wt.%, more preferably from 0.25 to 8, even more preferably from 0.5 to 6 wt.%, most preferably from 1 to 5 wt.% of a soil release polymer, more preferably a polyester based soil released polymer.
5. A detergent composition according to claim 4, wherein the polyester soil release
polymer is a polyethylene and/or polypropylene terephthalate based soil release polymer, preferably a polypropylene terephthalate based soil release polymer.
6. A detergent composition according to any preceding claim, wherein the detergent composition comprises an alkoxylated polyamine, preferably at a level of from 0.1 to 8 wt.%, more preferably from 0.2 to 6 wt.%, most preferably from 0.5 to 5 wt.%.
7. A detergent composition according to any preceding claim, wherein the detergent composition is a laundry detergent composition, preferably the laundry detergent composition is a liquid or a powder, most preferably a liquid detergent.
8. A laundry detergent composition according to claim 7, wherein the surfactant comprises anionic and/or nonionic surfactant, preferably comprising both anionic and nonionic surfactant.
9. A detergent composition according to any preceding claim, preferably a laundry
detergent composition, additionally comprising a further enzyme selected from the group consisting of: lipases, proteases, cellulases, alpha-amylases,
peroxidases/oxidases, pectate lyases, and/or mannanases.
10. A detergent composition according to any preceding claim, preferably a laundry
detergent composition, additionally comprising a further ingredient selected from fluorescent agent, perfume, shading dyes and polymers, and mixtures thereof.
1 1. A method of treatment of a fabric substrate with a sebum stain, said method
comprising incorporation of an esterase enzyme of enzyme class EC 3.1.1.1 , having at least 60%, preferably at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity, most preferably 100%, sequence identity to any one of SEQ ID NO: 1 to 4 into a detergent composition comprising from 1 to 60 wt.% of a surfactant; and subsequent treatment of a fabric substrate with a sebum stain, with said composition.
12. Use of an esterase enzyme of enzyme class EC 3.1.1.1 , having at least 60%,
preferably at least 70%, more preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, even more preferably at least 95%, most preferably at least 97%, at least 98% or even at least 99% sequence identity, most preferably 100%, sequence identity to any one of SEQ ID NO: 1 to 4 to improve cleaning of sebum stains on fabric.
PCT/EP2019/079656 2018-11-20 2019-10-30 Detergent composition WO2020104157A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CN201980076305.1A CN113056548B (en) 2018-11-20 2019-10-30 Detergent composition
BR112021009789-9A BR112021009789A2 (en) 2018-11-20 2019-10-30 detergent composition, method of treating a fabric substrate and use of an esterase enzyme
EP19798034.5A EP3884025B1 (en) 2018-11-20 2019-10-30 Detergent composition
ZA2021/02551A ZA202102551B (en) 2018-11-20 2021-04-16 Detergent composition

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP18207282.7 2018-11-20
EP18207282 2018-11-20

Publications (1)

Publication Number Publication Date
WO2020104157A1 true WO2020104157A1 (en) 2020-05-28

Family

ID=64402102

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2019/079656 WO2020104157A1 (en) 2018-11-20 2019-10-30 Detergent composition

Country Status (5)

Country Link
EP (1) EP3884025B1 (en)
CN (1) CN113056548B (en)
BR (1) BR112021009789A2 (en)
WO (1) WO2020104157A1 (en)
ZA (1) ZA202102551B (en)

Citations (81)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1296839A (en) 1969-05-29 1972-11-22
GB1372034A (en) 1970-12-31 1974-10-30 Unilever Ltd Detergent compositions
US4435307A (en) 1980-04-30 1984-03-06 Novo Industri A/S Detergent cellulase
EP0218272A1 (en) 1985-08-09 1987-04-15 Gist-Brocades N.V. Novel lipolytic enzymes and their use in detergent compositions
EP0258068A2 (en) 1986-08-29 1988-03-02 Novo Nordisk A/S Enzymatic detergent additive
EP0260105A2 (en) 1986-09-09 1988-03-16 Genencor, Inc. Preparation of enzymes having altered activity
US4760025A (en) 1984-05-29 1988-07-26 Genencor, Inc. Modified enzymes and methods for making same
EP0305216A1 (en) 1987-08-28 1989-03-01 Novo Nordisk A/S Recombinant Humicola lipase and process for the production of recombinant humicola lipases
JPS6474992A (en) 1987-09-16 1989-03-20 Fuji Oil Co Ltd Dna sequence, plasmid and production of lipase
WO1989006270A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Enzymatic detergent
WO1989006279A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Mutated subtilisin genes
EP0331376A2 (en) 1988-02-28 1989-09-06 Amano Pharmaceutical Co., Ltd. Recombinant DNA, bacterium of the genus pseudomonas containing it, and process for preparing lipase by using it
WO1989009259A1 (en) 1988-03-24 1989-10-05 Novo-Nordisk A/S A cellulase preparation
EP0399681A2 (en) * 1989-05-15 1990-11-28 The Clorox Company Lipase and cutinase surfactant systems and method useful in laundering
EP0407225A1 (en) 1989-07-07 1991-01-09 Unilever Plc Enzymes and enzymatic detergent compositions
WO1991016422A1 (en) 1990-04-14 1991-10-31 Kali-Chemie Aktiengesellschaft Alkaline bacillus lipases, coding dna sequences therefor and bacilli which produce these lipases
WO1992005249A1 (en) 1990-09-13 1992-04-02 Novo Nordisk A/S Lipase variants
WO1992017517A1 (en) 1991-04-02 1992-10-15 Minnesota Mining And Manufacturing Company Urea-aldehyde condensates and melamine derivatives comprising fluorochemical oligomers
WO1992019709A1 (en) 1991-04-30 1992-11-12 The Procter & Gamble Company Built liquid detergents with boric-polyol complex to inhibit proteolytic enzyme
WO1992019708A1 (en) 1991-04-30 1992-11-12 The Procter & Gamble Company Liquid detergents with aromatic borate ester to inhibit proteolytic enzyme
WO1993018140A1 (en) 1992-03-04 1993-09-16 Novo Nordisk A/S Novel proteases
WO1993024618A1 (en) 1992-06-01 1993-12-09 Novo Nordisk A/S Peroxidase variants with improved hydrogen peroxide stability
WO1994001541A1 (en) 1992-07-06 1994-01-20 Novo Nordisk A/S C. antarctica lipase and lipase variants
WO1994025583A1 (en) 1993-05-05 1994-11-10 Novo Nordisk A/S A recombinant trypsin-like protease
WO1994025578A1 (en) 1993-04-27 1994-11-10 Gist-Brocades N.V. New lipase variants for use in detergent applications
WO1995006720A1 (en) 1993-08-30 1995-03-09 Showa Denko K.K. Novel lipase, microorganism producing the lipase, process for producing the lipase, and use of the lipase
WO1995010602A1 (en) 1993-10-13 1995-04-20 Novo Nordisk A/S H2o2-stable peroxidase variants
WO1995014783A1 (en) 1993-11-24 1995-06-01 Showa Denko K.K. Lipase gene and variant lipase
WO1995022615A1 (en) 1994-02-22 1995-08-24 Novo Nordisk A/S A method of preparing a variant of a lipolytic enzyme
WO1995026397A1 (en) 1994-03-29 1995-10-05 Novo Nordisk A/S Alkaline bacillus amylase
WO1995030744A2 (en) 1994-05-04 1995-11-16 Genencor International Inc. Lipases with improved surfactant resistance
WO1995035381A1 (en) 1994-06-20 1995-12-28 Unilever N.V. Modified pseudomonas lipases and their use
WO1996000292A1 (en) 1994-06-23 1996-01-04 Unilever N.V. Modified pseudomonas lipases and their use
WO1996012012A1 (en) 1994-10-14 1996-04-25 Solvay S.A. Lipase, microorganism producing same, method for preparing said lipase and uses thereof
WO1996013580A1 (en) 1994-10-26 1996-05-09 Novo Nordisk A/S An enzyme with lipolytic activity
WO1996027002A1 (en) 1995-02-27 1996-09-06 Novo Nordisk A/S Novel lipase gene and process for the production of lipase with the use of the same
WO1996029397A1 (en) 1995-03-17 1996-09-26 Novo Nordisk A/S Novel endoglucanases
WO1997004079A1 (en) 1995-07-14 1997-02-06 Novo Nordisk A/S A modified enzyme with lipolytic activity
WO1997007202A1 (en) 1995-08-11 1997-02-27 Novo Nordisk A/S Novel lipolytic enzymes
US5648263A (en) 1988-03-24 1997-07-15 Novo Nordisk A/S Methods for reducing the harshness of a cotton-containing fabric
US5679630A (en) 1993-10-14 1997-10-21 The Procter & Gamble Company Protease-containing cleaning compositions
US5698508A (en) * 1994-12-22 1997-12-16 Kao Corporation Powdered detergent composition
WO1998012307A1 (en) 1996-09-17 1998-03-26 Novo Nordisk A/S Cellulase variants
WO1998015257A1 (en) 1996-10-08 1998-04-16 Novo Nordisk A/S Diaminobenzoic acid derivatives as dye precursors
WO2000060060A2 (en) 1999-03-31 2000-10-12 Novozymes A/S Polypeptides having alkaline alpha-amylase activity and nucleic acids encoding same
WO2000060063A1 (en) 1999-03-31 2000-10-12 Novozymes A/S Lipase variant
WO2001016285A2 (en) 1999-08-31 2001-03-08 Novozymes A/S Novel proteases and variants thereof
US6312936B1 (en) 1997-10-23 2001-11-06 Genencor International, Inc. Multiply-substituted protease variants
WO2002016547A2 (en) 2000-08-21 2002-02-28 Novozymes A/S Subtilase enzymes
WO2002026024A1 (en) 2000-08-05 2002-04-04 Haiquan Li An apparatus using recyclable resource
WO2005003274A1 (en) 2003-06-18 2005-01-13 Unilever Plc Laundry treatment compositions
WO2005040372A1 (en) 2003-10-23 2005-05-06 Novozymes A/S Protease with improved stability in detergents
WO2005052161A2 (en) 2003-11-19 2005-06-09 Genencor International, Inc. Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same
WO2006027086A1 (en) 2004-09-11 2006-03-16 Unilever Plc Laundry treatment compositions
WO2006032397A1 (en) 2004-09-23 2006-03-30 Unilever Plc Laundry treatment compositions
WO2006032327A1 (en) 2004-09-23 2006-03-30 Unilever Plc Laundry treatment compositions
WO2006045275A2 (en) 2004-10-25 2006-05-04 Müller Weingarten AG Drive system for a forming press
US7262042B2 (en) 2001-12-20 2007-08-28 Henkel Kommanditgesellschaft Auf Aktien (Henkel Kgaa) Alkaline protease from Bacillus gibsonii (DSM 14393) and washing and cleaning products comprising said alkaline protease
WO2008017570A1 (en) 2006-08-10 2008-02-14 Unilever Plc Shading composition
WO2008087497A1 (en) 2007-01-19 2008-07-24 The Procter & Gamble Company Laundry care composition comprising a whitening agent for cellulosic substrates
WO2008141880A1 (en) 2007-05-18 2008-11-27 Unilever Plc Triphenodioxazine dyes
WO2009021867A2 (en) 2007-08-10 2009-02-19 Henkel Ag & Co. Kgaa Agents containing proteases
WO2009087524A1 (en) 2008-01-04 2009-07-16 The Procter & Gamble Company Enzyme and fabric hueing agent containing compositions
WO2009090576A2 (en) 2008-01-11 2009-07-23 Procter & Gamble International Operations Sa Cleaning and/or treatment compositions
WO2009107091A2 (en) 2008-02-29 2009-09-03 The Procter & Gamble Company Detergent composition comprising lipase
WO2009111258A2 (en) 2008-02-29 2009-09-11 The Procter & Gamble Company Detergent composition comprising lipase
WO2009132870A1 (en) 2008-05-02 2009-11-05 Unilever Plc Reduced spotting granules
WO2009141173A1 (en) 2008-05-20 2009-11-26 Unilever Plc Shading composition
WO2009148983A1 (en) 2008-06-06 2009-12-10 The Procter & Gamble Company Detergent composition comprising a variant of a family 44 xyloglucanase
WO2010099997A1 (en) 2009-03-05 2010-09-10 Unilever Plc Dye radical initiators
WO2010102861A1 (en) 2009-03-12 2010-09-16 Unilever Plc Dye-polymers formulations
WO2010148624A1 (en) 2009-06-26 2010-12-29 Unilever Plc Dye polymers
WO2010151906A2 (en) 2010-10-22 2010-12-29 Milliken & Company Bis-azo colorants for use as bluing agents
WO2011011799A2 (en) 2010-11-12 2011-01-27 The Procter & Gamble Company Thiophene azo dyes and laundry care compositions containing the same
WO2012054058A1 (en) 2010-10-22 2012-04-26 The Procter & Gamble Company Bis-azo colorants for use as bluing agents
WO2012054820A1 (en) 2010-10-22 2012-04-26 The Procter & Gamble Company Detergent composition comprising bluing agent and rapidly water-soluble brightener
WO2013142495A1 (en) 2012-03-19 2013-09-26 Milliken & Company Carboxylate dyes
WO2013151970A1 (en) 2012-04-03 2013-10-10 The Procter & Gamble Company Laundry detergent composition comprising water-soluble phthalocyanine compound
WO2014029479A1 (en) 2012-08-18 2014-02-27 Clariant International Ltd Use of polyesters in washing and cleaning agents
WO2014130508A1 (en) * 2013-02-19 2014-08-28 The Procter & Gamble Company Method of laundering a fabric
WO2016005338A1 (en) 2014-07-09 2016-01-14 Clariant International Ltd Storage-stable compositions comprising soil release polymers

Patent Citations (84)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1296839A (en) 1969-05-29 1972-11-22
GB1372034A (en) 1970-12-31 1974-10-30 Unilever Ltd Detergent compositions
US4435307A (en) 1980-04-30 1984-03-06 Novo Industri A/S Detergent cellulase
US4760025A (en) 1984-05-29 1988-07-26 Genencor, Inc. Modified enzymes and methods for making same
EP0218272A1 (en) 1985-08-09 1987-04-15 Gist-Brocades N.V. Novel lipolytic enzymes and their use in detergent compositions
EP0258068A2 (en) 1986-08-29 1988-03-02 Novo Nordisk A/S Enzymatic detergent additive
EP0260105A2 (en) 1986-09-09 1988-03-16 Genencor, Inc. Preparation of enzymes having altered activity
EP0305216A1 (en) 1987-08-28 1989-03-01 Novo Nordisk A/S Recombinant Humicola lipase and process for the production of recombinant humicola lipases
JPS6474992A (en) 1987-09-16 1989-03-20 Fuji Oil Co Ltd Dna sequence, plasmid and production of lipase
WO1989006279A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Mutated subtilisin genes
WO1989006270A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Enzymatic detergent
EP0331376A2 (en) 1988-02-28 1989-09-06 Amano Pharmaceutical Co., Ltd. Recombinant DNA, bacterium of the genus pseudomonas containing it, and process for preparing lipase by using it
US5691178A (en) 1988-03-22 1997-11-25 Novo Nordisk A/S Fungal cellulase composition containing alkaline CMC-endoglucanase and essentially no cellobiohydrolase
WO1989009259A1 (en) 1988-03-24 1989-10-05 Novo-Nordisk A/S A cellulase preparation
US5648263A (en) 1988-03-24 1997-07-15 Novo Nordisk A/S Methods for reducing the harshness of a cotton-containing fabric
US5776757A (en) 1988-03-24 1998-07-07 Novo Nordisk A/S Fungal cellulase composition containing alkaline CMC-endoglucanase and essentially no cellobiohydrolase and method of making thereof
EP0399681A2 (en) * 1989-05-15 1990-11-28 The Clorox Company Lipase and cutinase surfactant systems and method useful in laundering
EP0407225A1 (en) 1989-07-07 1991-01-09 Unilever Plc Enzymes and enzymatic detergent compositions
WO1991016422A1 (en) 1990-04-14 1991-10-31 Kali-Chemie Aktiengesellschaft Alkaline bacillus lipases, coding dna sequences therefor and bacilli which produce these lipases
WO1992005249A1 (en) 1990-09-13 1992-04-02 Novo Nordisk A/S Lipase variants
WO1992017517A1 (en) 1991-04-02 1992-10-15 Minnesota Mining And Manufacturing Company Urea-aldehyde condensates and melamine derivatives comprising fluorochemical oligomers
WO1992019709A1 (en) 1991-04-30 1992-11-12 The Procter & Gamble Company Built liquid detergents with boric-polyol complex to inhibit proteolytic enzyme
WO1992019708A1 (en) 1991-04-30 1992-11-12 The Procter & Gamble Company Liquid detergents with aromatic borate ester to inhibit proteolytic enzyme
WO1993018140A1 (en) 1992-03-04 1993-09-16 Novo Nordisk A/S Novel proteases
WO1993024618A1 (en) 1992-06-01 1993-12-09 Novo Nordisk A/S Peroxidase variants with improved hydrogen peroxide stability
WO1994001541A1 (en) 1992-07-06 1994-01-20 Novo Nordisk A/S C. antarctica lipase and lipase variants
WO1994025578A1 (en) 1993-04-27 1994-11-10 Gist-Brocades N.V. New lipase variants for use in detergent applications
WO1994025583A1 (en) 1993-05-05 1994-11-10 Novo Nordisk A/S A recombinant trypsin-like protease
WO1995006720A1 (en) 1993-08-30 1995-03-09 Showa Denko K.K. Novel lipase, microorganism producing the lipase, process for producing the lipase, and use of the lipase
WO1995010602A1 (en) 1993-10-13 1995-04-20 Novo Nordisk A/S H2o2-stable peroxidase variants
US5679630A (en) 1993-10-14 1997-10-21 The Procter & Gamble Company Protease-containing cleaning compositions
WO1995014783A1 (en) 1993-11-24 1995-06-01 Showa Denko K.K. Lipase gene and variant lipase
WO1995022615A1 (en) 1994-02-22 1995-08-24 Novo Nordisk A/S A method of preparing a variant of a lipolytic enzyme
WO1995026397A1 (en) 1994-03-29 1995-10-05 Novo Nordisk A/S Alkaline bacillus amylase
WO1995030744A2 (en) 1994-05-04 1995-11-16 Genencor International Inc. Lipases with improved surfactant resistance
WO1995035381A1 (en) 1994-06-20 1995-12-28 Unilever N.V. Modified pseudomonas lipases and their use
WO1996000292A1 (en) 1994-06-23 1996-01-04 Unilever N.V. Modified pseudomonas lipases and their use
WO1996012012A1 (en) 1994-10-14 1996-04-25 Solvay S.A. Lipase, microorganism producing same, method for preparing said lipase and uses thereof
WO1996013580A1 (en) 1994-10-26 1996-05-09 Novo Nordisk A/S An enzyme with lipolytic activity
US5698508A (en) * 1994-12-22 1997-12-16 Kao Corporation Powdered detergent composition
WO1996027002A1 (en) 1995-02-27 1996-09-06 Novo Nordisk A/S Novel lipase gene and process for the production of lipase with the use of the same
WO1996029397A1 (en) 1995-03-17 1996-09-26 Novo Nordisk A/S Novel endoglucanases
WO1997004079A1 (en) 1995-07-14 1997-02-06 Novo Nordisk A/S A modified enzyme with lipolytic activity
WO1997007202A1 (en) 1995-08-11 1997-02-27 Novo Nordisk A/S Novel lipolytic enzymes
WO1998012307A1 (en) 1996-09-17 1998-03-26 Novo Nordisk A/S Cellulase variants
WO1998015257A1 (en) 1996-10-08 1998-04-16 Novo Nordisk A/S Diaminobenzoic acid derivatives as dye precursors
US6312936B1 (en) 1997-10-23 2001-11-06 Genencor International, Inc. Multiply-substituted protease variants
WO2000060060A2 (en) 1999-03-31 2000-10-12 Novozymes A/S Polypeptides having alkaline alpha-amylase activity and nucleic acids encoding same
WO2000060063A1 (en) 1999-03-31 2000-10-12 Novozymes A/S Lipase variant
WO2001016285A2 (en) 1999-08-31 2001-03-08 Novozymes A/S Novel proteases and variants thereof
WO2002026024A1 (en) 2000-08-05 2002-04-04 Haiquan Li An apparatus using recyclable resource
WO2002016547A2 (en) 2000-08-21 2002-02-28 Novozymes A/S Subtilase enzymes
US7262042B2 (en) 2001-12-20 2007-08-28 Henkel Kommanditgesellschaft Auf Aktien (Henkel Kgaa) Alkaline protease from Bacillus gibsonii (DSM 14393) and washing and cleaning products comprising said alkaline protease
WO2005003274A1 (en) 2003-06-18 2005-01-13 Unilever Plc Laundry treatment compositions
WO2005040372A1 (en) 2003-10-23 2005-05-06 Novozymes A/S Protease with improved stability in detergents
WO2005052161A2 (en) 2003-11-19 2005-06-09 Genencor International, Inc. Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same
WO2005052146A2 (en) 2003-11-19 2005-06-09 Genencor International, Inc. Serine proteases, nucleic acids encoding serine enzymes and vectors and host cells incorporating same
WO2006027086A1 (en) 2004-09-11 2006-03-16 Unilever Plc Laundry treatment compositions
WO2006032397A1 (en) 2004-09-23 2006-03-30 Unilever Plc Laundry treatment compositions
WO2006032327A1 (en) 2004-09-23 2006-03-30 Unilever Plc Laundry treatment compositions
WO2006045275A2 (en) 2004-10-25 2006-05-04 Müller Weingarten AG Drive system for a forming press
WO2008017570A1 (en) 2006-08-10 2008-02-14 Unilever Plc Shading composition
WO2008087497A1 (en) 2007-01-19 2008-07-24 The Procter & Gamble Company Laundry care composition comprising a whitening agent for cellulosic substrates
WO2008141880A1 (en) 2007-05-18 2008-11-27 Unilever Plc Triphenodioxazine dyes
WO2009021867A2 (en) 2007-08-10 2009-02-19 Henkel Ag & Co. Kgaa Agents containing proteases
WO2009087524A1 (en) 2008-01-04 2009-07-16 The Procter & Gamble Company Enzyme and fabric hueing agent containing compositions
WO2009090576A2 (en) 2008-01-11 2009-07-23 Procter & Gamble International Operations Sa Cleaning and/or treatment compositions
WO2009107091A2 (en) 2008-02-29 2009-09-03 The Procter & Gamble Company Detergent composition comprising lipase
WO2009111258A2 (en) 2008-02-29 2009-09-11 The Procter & Gamble Company Detergent composition comprising lipase
WO2009132870A1 (en) 2008-05-02 2009-11-05 Unilever Plc Reduced spotting granules
WO2009141173A1 (en) 2008-05-20 2009-11-26 Unilever Plc Shading composition
WO2009148983A1 (en) 2008-06-06 2009-12-10 The Procter & Gamble Company Detergent composition comprising a variant of a family 44 xyloglucanase
WO2010099997A1 (en) 2009-03-05 2010-09-10 Unilever Plc Dye radical initiators
WO2010102861A1 (en) 2009-03-12 2010-09-16 Unilever Plc Dye-polymers formulations
WO2010148624A1 (en) 2009-06-26 2010-12-29 Unilever Plc Dye polymers
WO2010151906A2 (en) 2010-10-22 2010-12-29 Milliken & Company Bis-azo colorants for use as bluing agents
WO2012054058A1 (en) 2010-10-22 2012-04-26 The Procter & Gamble Company Bis-azo colorants for use as bluing agents
WO2012054820A1 (en) 2010-10-22 2012-04-26 The Procter & Gamble Company Detergent composition comprising bluing agent and rapidly water-soluble brightener
WO2011011799A2 (en) 2010-11-12 2011-01-27 The Procter & Gamble Company Thiophene azo dyes and laundry care compositions containing the same
WO2013142495A1 (en) 2012-03-19 2013-09-26 Milliken & Company Carboxylate dyes
WO2013151970A1 (en) 2012-04-03 2013-10-10 The Procter & Gamble Company Laundry detergent composition comprising water-soluble phthalocyanine compound
WO2014029479A1 (en) 2012-08-18 2014-02-27 Clariant International Ltd Use of polyesters in washing and cleaning agents
WO2014130508A1 (en) * 2013-02-19 2014-08-28 The Procter & Gamble Company Method of laundering a fabric
WO2016005338A1 (en) 2014-07-09 2016-01-14 Clariant International Ltd Storage-stable compositions comprising soil release polymers

Non-Patent Citations (12)

* Cited by examiner, † Cited by third party
Title
"Fenaroli's Handbook of Flavour Ingredients", 1975, CRC PRESS
"Uniprot", Database accession no. 028735
ANONYMOUS: "Hit details for UNIPARC:UPI0000056CAF", 1 January 1998 (1998-01-01), XP055578804, Retrieved from the Internet <URL:http://ibis.internal.epo.org/exam/hitDetails.jsp?id=213062836> [retrieved on 20190408] *
ANONYMOUS: "Hit details for UNIPARC:UPI00064188EC", 5 June 2015 (2015-06-05), XP055578607, Retrieved from the Internet <URL:http://ibis.internal.epo.org/exam/hitDetails.jsp?id=212988675> [retrieved on 20190408] *
CHEMICAL ABSTRACTS, Columbus, Ohio, US; abstract no. 72749-80-5
DARTOIS ET AL., BIOCHEMICA ET BIOPHYSICA ACTA, vol. 1131, 1993, pages 253 - 360
H ZOLLINGER: "Color Chemistry Synthesis, Properties and Applications of Organic Dyes and Pigments", 2003, WILEY-VCH
M. B. JACOBS: "Synthetic Food Adjuncts", 1947, VAN NOSTRAND
POUCHER, JOURNAL OF THE SOCIETY OF COSMETIC CHEMISTS, vol. 6, no. 2, 1955, pages 80
S. ARCTANDER, PERFUME AND FLAVOUR CHEMICALS, 1969
SIEZEN ET AL., PROTEIN ENGNG., vol. 4, 1991, pages 719 - 737
SIEZEN ET AL., PROTEIN SCIENCE, vol. 6, 1997, pages 501 - 523

Also Published As

Publication number Publication date
BR112021009789A2 (en) 2021-08-17
EP3884025A1 (en) 2021-09-29
CN113056548A (en) 2021-06-29
EP3884025B1 (en) 2022-06-08
CN113056548B (en) 2023-05-02
ZA202102551B (en) 2023-01-25

Similar Documents

Publication Publication Date Title
EP3649222B1 (en) Whitening composition
WO2017174252A1 (en) Laundry detergent composition
EP3433346B1 (en) Laundry detergent composition
US20220364022A1 (en) Detergent composition
EP3717616B1 (en) Detergent composition comprising protease
EP3990603B1 (en) Detergent composition
EP3884025B1 (en) Detergent composition
US20220372400A1 (en) Detergent composition
EP3884024A1 (en) Detergent composition
EP3884022A1 (en) Detergent composition
WO2020104156A1 (en) Detergent composition
CN113015781B (en) Detergent composition
EP3853330B1 (en) Detergent composition
EP3649221B1 (en) Laundry cleaning composition
EP3417039B1 (en) Whitening composition
US20220372397A1 (en) Detergent composition

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19798034

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021009789

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019798034

Country of ref document: EP

Effective date: 20210621

ENP Entry into the national phase

Ref document number: 112021009789

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210520