WO2020081920A1 - Compositions and methods for treatment of liver disease - Google Patents
Compositions and methods for treatment of liver disease Download PDFInfo
- Publication number
- WO2020081920A1 WO2020081920A1 PCT/US2019/056910 US2019056910W WO2020081920A1 WO 2020081920 A1 WO2020081920 A1 WO 2020081920A1 US 2019056910 W US2019056910 W US 2019056910W WO 2020081920 A1 WO2020081920 A1 WO 2020081920A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- wisp1
- antibody
- subject
- cell
- liver disease
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7105—Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/37—Digestive system
- A61K35/407—Liver; Hepatocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1136—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against growth factors, growth regulators, cytokines, lymphokines or hormones
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/067—Hepatocytes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
- C12N2310/141—MicroRNAs, miRNAs
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/02—Screening involving studying the effect of compounds C on the interaction between interacting molecules A and B (e.g. A = enzyme and B = substrate for A, or A = receptor and B = ligand for the receptor)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/08—Hepato-biliairy disorders other than hepatitis
- G01N2800/085—Liver diseases, e.g. portal hypertension, fibrosis, cirrhosis, bilirubin
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- the field of the invention relates to a treatment for liver disease.
- the liver is a highly important organ that filters metabolites, synthesizes proteins, and can produce biochemicals needed for digestion. Specifically, the liver produces bile to breakdown fats and emulsify lipids. Chronic and progressive liver diseases can result in the progressive destruction of the bile ducts in the liver that can lead to a buildup of bile, severe inflammation, scarring, and fibrosis. When scar tissue replaces healthy liver tissue, the liver function becomes increasingly impaired. For some liver diseases, (e.g. primary biliary cholangitis (PBC)), there is only one drug, ursodeoxycholic acid (UDCA), that can improve survival. Unfortunately, approximately 40% of UDCA-treated patients show an inadequate response to the therapy. Therefore, more effective therapeutics are needed for the treatment of liver diseases such as PBC and others.
- PBC primary biliary cholangitis
- UDCA ursodeoxycholic acid
- the invention described herein relates to, in part, the finding that inhibition of WISP1 by miRNA-15a, miRNA-412, and anti-WISP1 antibodies induced quiescence in an activated hepatic stellate cells (HSCs), the cell type that plays a central role in fibrotic progression of the liver. It is further shown herein that miR-15a and WISP1 IgG can directly target WISP1 to repress the protein’s pro-fibrotic function in activated HSCs.
- HSCs hepatic stellate cells
- one aspect described herein is a method for treating or preventing a liver disease, comprising administering to a subject in need thereof an antibody or antibody reagent that inhibits WISP1.
- the liver disease is selected from the group consisting of: Alagille Syndrome; Alcohol-Related Liver Disease; Alpha-1 Antitrypsin Deficiency; Autoimmune Hepatitis; Benign Liver Tumors; Biliary Atresia; Cirrhosis; Crigler-Najjar Syndrome; Galactosemia; Gilbert Syndrome; Hemochromatosis; Hepatic Encephalopathy; Hepatitis A; Hepatitis B; Hepatitis C; Hepatorenal Syndrome; Intrahepatic Cholestasis of Pregnancy (ICP); Lysosomal Acid Lipase Deficiency (LAL-D); Liver Cysts; Liver Cancer; Newborn Jaundice; Non- Alcoholic Fatty Liver Disease; Non-Alcoholic Steatohepatitis; Primary Biliary Cholangitis (PBC); Primary Sclerosing Cholangitis (PSC); Progressive Familial Intrahepatic Chole
- WISP1v WISP1vx, and WISP1delta exon 3-4.
- the antibody or antibody reagent that inhibits WISP1 is selected from the group consisting of: mab1680, AF1680, SAB2501114, ab60114, and ab65943.
- the antibody or antibody reagent amino acid sequence comprises at least 70% homology to any one of SEQ ID NOs: 1-4, 6, or 12-120.
- the subject is a mammal.
- WISP1 is inhibited in a target cell.
- the target cell is a mammalian cell.
- the target cell is a hepatic stellate cell, a fibroblast, or a myofibroblast.
- the hepatic stellate cell is quiescent.
- the antibody or antibody reagent is administered by direct injection, subcutaneous injection, muscular injection, oral, transdermal or nasal administration.
- inhibiting WISP1 is inhibiting WISP1 activity or reducing WISP1 protein levels.
- the activity of WISP1 is inhibited by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or more as compared to an appropriate control.
- the level of WISP1 is reduced by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or more as compared to an appropriate control.
- composition comprising an antibody or antibody reagent that inhibits WISP1 and a pharmaceutically acceptable carrier.
- the composition is formulated for treating or preventing a liver disease.
- Another aspect described herein provides a method of treating a liver disease in a subject, the method comprising: (a) detecting the level of WISP1 and/or Yap, Col1a1, Acta2 in a biological sample of a subject; (b) comparing the measurement of (a) to a reference level; (c) identifying a subject with increased WISP1 and/or Yap, Col1a1, Acta2 in (a) as compared to a reference level as having a liver disease; and (d) administering to the subject having liver disease an antibody or antibody reagent that inhibits WISP1.
- the method further comprises, prior to (a), obtaining a biological sample from the subject.
- the biological sample is a blood sample, tissue, buffy coat, serum, or tissue.
- Yet another aspect described herein provides a method for treating or preventing a liver disease comprising administering to a subject in need thereof an agent that inhibits WISP1.
- the agent that inhibits WISP1 is selected from the group consisting of: a small molecule, an antibody or antibody reagent, a peptide, a genome editing system, a viral vector, a miRNA, a lncRNA, a mRNA and a siRNA.
- the microRNA is miRNA15a or miRNA412.
- the agent is administered by direct injection, subcutaneous injection, muscular injection, oral, transdermal or nasal administration.
- composition comprising an agent that inhibits WISP1 and a pharmaceutically acceptable carrier.
- Another aspect described herein provides a method of treating a liver disease in a subject, comprising (a) detecting the level of WISP1 and/or Acta2 in a biological sample of a subject; (b) comparing the measurement of (a) to a reference level; (c) identifying a subject with increased WISP1 and/or Acta2 in (a) as compared to a reference level as having a liver disease; and (d) administering to the subject having liver disease an agent that inhibits WISP1.
- Yet another aspect described herein provides a method of generating an engineered hepatic stellate cell, or population thereof, that expresses an agent that inhibits WISP1 comprising contacting the cell with an agent that inhibits WISP1, and culturing the cell for a sufficient time to allow for expression of the agent.
- the contacting comprises contacting the cell with an agent or a vector that encodes the agent. In one embodiment of any aspect, the contacting comprises transduction, nucleofection,
- Another aspect described herein provides a cell line comprising hepatic stellate cells generated by any of the methods described herein.
- Another aspect described herein provides a pharmaceutical composition
- a pharmaceutical composition comprising a hepatic stellate cell, or population thereof, generated by any of the methods described herein, and a pharmaceutically acceptable carrier.
- Another aspect described herein provides a method of treating or preventing a liver disease comprising administering to a subject in need thereof the cells generated by any of the methods described herein, any of the generated cells described herein, or any of the pharmaceutical composition comprising a generated cell described herein.
- Another aspect described herein provides a method of reducing fibrosis in a subject, the method comprising: administering to a subject in need thereof the cells generated by any of the methods described herein, any of the generated cells described herein, or any of the pharmaceutical composition comprising a generated cell described herein.
- Another aspect provided herein is a method of treating a liver disease in a subject comprising (a) receiving the results of an assay that identifies a subject as having increased WISP1 and/or Acta2 levels (e.g., mRNA, miRNA, protein levels, etc.) as compared to a reference level as having a liver disease; and (b) administering to the subject having liver disease an antibody or antibody reagent that inhibits WISP1.
- WISP1 and/or Acta2 levels e.g., mRNA, miRNA, protein levels, etc.
- Another aspect provided herein is a method of treating a liver disease in a subject comprising (a) receiving the results of an assay that identifies a subject as having increased WISP1 and/or Acta2 levels as compared to a reference level as having a liver disease; and (b) administering to the subject having liver disease an agent reagent that inhibits WISP1. Definitions
- the terms “treat,” “treatment,” “treating,” or“amelioration” refer to therapeutic treatments, wherein the object is to reverse, alleviate, ameliorate, inhibit, slow down or stop the progression or severity of a condition associated with liver disease, e.g., hepatic fibrosis.
- the term“treating” includes reducing or alleviating at least one adverse effect or symptom of liver disease, for example, jaundice, variceal bleeding, reduction in fibrosis, scarring and ascites.
- Treatment is generally“effective” if one or more symptoms or clinical markers are reduced. Alternatively, treatment is“effective” if the progression of a disease is reduced or halted.
- treatment includes not just the improvement of symptoms or markers, but also a cessation of, or at least slowing or reversal of, progress or worsening of symptoms compared to what would be expected in the absence of treatment.
- Beneficial or desired clinical results include, but are not limited to, alleviation of one or more symptom(s), diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, remission (whether partial or total), and/or decreased mortality, whether detectable or undetectable.
- treatment also includes providing relief from the symptoms or side-effects of the disease (including palliative treatment).
- prevention refers to any methodology where the disease state does not occur due to the actions of the methodology (such as, for example, administration of a composition as described herein). In one aspect, it is understood that prevention can also mean that the disease is not established to the extent that occurs in untreated controls. Accordingly, prevention of a disease encompasses a reduction in the likelihood that a subject can develop the disease, relative to an untreated subject (e.g. a subject who is not treated with the methods or compositions described herein).
- administering and “injecting” are used interchangeably in the context of the placement of cells, e.g., a hepatic stellate cells or an agent described herein, into a subject, by a method or route which results in at least partial localization of the introduced cells or agent at a desired site, such as the liver or a region thereof, such that a desired effect(s) is produced (e.g., decreased WISP1 level or activity).
- the agent or cells described herein can be administered by any appropriate route which results in delivery to a desired location in the subject where at least a portion of the delivered agent, cells, or components of the cells remain viable.
- the period of viability of the cells after administration to a subject can be as short as a few hours, e.g., twenty-four hours, to a few days, to as long as several years, i.e., long-term.
- the term“administering” refers to the administration of a pharmaceutical composition comprising one or more agents or cells.
- the administering can be done by direct injection (e.g., directly administered to a target cell), subcutaneous injection, muscular injection, oral, or nasal delivery to the subject in need thereof.
- Administering can be local or systemic.
- the terms“patient”,“subject” and“individual” are used interchangeably herein, and refer to an animal, particularly a human, to whom treatment, including prophylactic treatment is provided.
- the term“subject” as used herein refers to human and non-human animals.
- the term“non-human animals” and“non-human mammals” are used interchangeably herein includes all vertebrates, e.g., mammals, such as non-human primates, (particularly higher primates), sheep, dog, rodent (e.g. mouse or rat), guinea pig, goat, pig, cat, rabbits, cows, and non-mammals such as chickens, amphibians, reptiles etc.
- the subject is human.
- the subject is an experimental animal or animal substitute as a disease model.
- the subject is a domesticated animal including companion animals (e.g., dogs, cats, rats, guinea pigs, hamsters etc.).
- companion animals e.g., dogs, cats, rats, guinea pigs, hamsters etc.
- a subject can have previously received a treatment for a liver disease, or has never received treatment for a liver disease.
- a subject can have previously been diagnosed with having a liver disease, or has never been diagnosed with a liver disease.
- “decrease”,“reduced”,“reduction”, or“inhibit” are all used herein to mean a decrease or lessening of a property, level, or other parameter by a statistically significant amount.
- “reduce,”“reduction” or“decrease” or“inhibit” typically means a decrease by at least 10% as compared to a reference level (e.g., the absence of a given treatment) and can include, for example, a decrease by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99% , or more.
- “reduction” or “inhibition” does not encompass a complete inhibition or reduction as compared to a reference level.“Complete inhibition” is a 100% inhibition as compared to a reference level. A decrease can be preferably down to a level accepted as within the range of normal for an individual without a given disorder. For example, inhibiting WISP1 is inhibiting WISP1 activity or reducing WISP1 protein levels.
- the terms“increased,”“increase” or“enhance” or“activate” are all used herein to generally mean an increase of a property, level, or other parameter by a statistically significant amount; for the avoidance of any doubt, the terms “increased”,“increase” or“enhance” or“activate” means an increase of at least 10% as compared to a reference level, for example an increase of at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% increase or any increase between 10-100% as compared to a reference level, or at least about a 2-fold, or at least about a 3-fold, or at least about a 4-fold, or at least about a 5-fold or at least about a 10-fold increase, at least about a 20-fold increase, at least about a 50-fold increase, at least about a 100-fold increase, at least about
- a“reference level” refers to a normal, otherwise unaffected cell population or tissue (e.g., a biological sample obtained from a healthy subject, or a biological sample obtained from the subject at a prior time point, e.g., a biological sample obtained from a patient prior to being diagnosed with a liver disease, or a biological sample that has not been contacted with an agent or composition disclosed herein).
- an“appropriate control” refers to an untreated, otherwise identical cell or population (e.g., a biological sample that was not contacted by an agent or composition described herein, or not contacted in the same manner, e.g., for a different duration, as compared to a non-control cell).
- pharmaceutically acceptable can refer to compounds and compositions which can be administered to a subject (e.g., a mammal or a human) without undue toxicity.
- the term "pharmaceutically acceptable carrier” can include any material or substance that, when combined with an active ingredient, allows the ingredient to retain biological activity and is non-reactive with the subject's immune system. Examples include, but are not limited to, any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, emulsions such as oil/water emulsion, and various types of wetting agents.
- pharmaceutically acceptable carriers excludes tissue culture media.
- Non limiting examples of pharmaceutical carriers include particle or polymer-based vehicles such as nanoparticles, microparticles, liposomes, polymer microspheres, or polymer-drug conjugates.
- WISP1-inducible-signaling pathway protein 1 or“WISP1” or“CCN4” is a matricellular protein that is encoded by the WISP1 gene that has many diverse cellular functions, including cell adhesion, migration, proliferation, differentiation, and survival.
- WISP1 is secreted by hepatic stellate cells (HSCs) as they become activated toward myofibroblasts.
- HSCs hepatic stellate cells
- WISP1 also affects HSCs by accelerating activation and secretion of collagen to promote fibrosis.
- WISP1 also known as CCN4, WISP1c, WISP1i, WISP1tc, WISP1-OT1, and WISP1-UT1, are known for a number of species, e.g., human WISP1 (NCBI Gene ID: 8840) polypeptide (e.g., NCBI Ref Sequence: NP_001191798.1) and mRNA (e.g., NCBI Ref Sequence: NM_001204869.1).
- WISP1 can refer to human WISP1, including naturally occurring variants, molecules, and alleles thereof.
- WISP1 refers to the mammalian WISP1 of, e.g., mouse, rat, rabbit, dog, cat, cow, horse, pig, and the like.
- the nucleic sequence of SEQ ID NO: 5 comprises the nucleic sequence which encodes WISP1.
- WISP1 activity refers to the cellular functions of WISP1, for example, WISP1 accelerates activation and secretion of collagen to promote fibrosis in HSCs, and attenuates p53-mediated apoptosis and WISP1 can inhibit TNF-induced cell death in other cell types.
- an increase in WISP1 activity can refer to the increase in collagen deposition by a cell.
- WISP1 activity can refer to the induction of alpha smooth muscle actin expression or the expression of some pro-inflammatory cytokines, like IL-6.
- nucleic acid or“nucleic acid sequence” refers to any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof.
- the nucleic acid can be either single-stranded or double-stranded.
- a single-stranded nucleic acid can be one nucleic acid strand of a denatured double- stranded DNA. Alternatively, it can be a single-stranded nucleic acid not derived from any double- stranded DNA.
- the nucleic acid can be DNA.
- nucleic acid can be RNA.
- Suitable DNA can include, e.g., genomic DNA or cDNA.
- Suitable RNA can include, e.g., mRNA.
- agent means any compound or substance such as, but not limited to, a small molecule, nucleic acid, polypeptide, peptide, drug, ion, etc.
- An“agent” can be any chemical, entity or moiety, including without limitation synthetic and naturally-occurring proteinaceous and non-proteinaceous entities.
- an agent is nucleic acid, nucleic acid analogues, proteins, antibodies, peptides, aptamers, oligomer of nucleic acids, amino acids, or carbohydrates including without limitation proteins, oligonucleotides, ribozymes, DNAzymes, glycoproteins, siRNAs, lipoproteins, aptamers, and modifications and combinations thereof etc.
- agents are small molecule having a chemical moiety.
- chemical moieties included unsubstituted or substituted alkyl, aromatic, or heterocyclyl moieties including macrolides, leptomycins and related natural products or analogues thereof.
- Compounds can be known to have a desired activity and/or property, or can be selected from a library of diverse compounds.
- the agent can be a molecule from one or more chemical classes, e.g., organic molecules, which may include organometallic molecules, inorganic molecules, genetic sequences, etc. Agents may also be fusion proteins from one or more proteins, chimeric proteins (for example domain switching or homologous recombination of functionally significant regions of related or different molecules), synthetic proteins or other protein variations including substitutions, deletions, insertion and other variants.
- chemical classes e.g., organic molecules, which may include organometallic molecules, inorganic molecules, genetic sequences, etc.
- Agents may also be fusion proteins from one or more proteins, chimeric proteins (for example domain switching or homologous recombination of functionally significant regions of related or different molecules), synthetic proteins or other protein variations including substitutions, deletions, insertion and other variants.
- an“antibody” refers to IgG, IgM, IgA, IgD or IgE molecules or antigen-specific antibody fragments thereof (including, but not limited to, a Fab, F(ab') 2 , Fv, disulphide linked Fv, scFv, single domain antibody, closed conformation multispecific antibody, disulphide-linked scfv, diabody), whether derived from any species that naturally produces an antibody, or created by recombinant DNA technology; whether isolated from serum, B-cells, hybridomas, transfectomas, yeast or bacteria.
- an antibody in another example, includes two heavy (H) chain variable regions and two light (L) chain variable regions.
- a V H region e.g. a portion of an immunglobin polypeptide is not the same as a V H segment, which is described elsewhere herein.
- the V H and V L regions can be further subdivided into regions of hypervariability, termed “complementarity determining regions” ("CDR"), interspersed with regions that are more conserved, termed “framework regions" (“FR").
- CDR complementarity determining regions
- FR framework regions
- Each V H and V L is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 As used herein, the terms“protein” and“polypeptide” are used interchangeably herein to designate a series of amino acid residues, connected to each other by peptide bonds between the alpha-amino and carboxy groups of adjacent residues.
- an antibody reagent refers to a polypeptide that includes at least one immunoglobulin variable domain or immunoglobulin variable domain sequence and which specifically binds a given antigen.
- An antibody reagent can comprise an antibody or a polypeptide comprising an antigen-binding domain of an antibody.
- an antibody reagent can comprise a monoclonal antibody or a polypeptide comprising an antigen-binding domain of a monoclonal antibody.
- an antibody can include a heavy (H) chain variable region (abbreviated herein as VH), and a light (L) chain variable region (abbreviated herein as VL).
- an antibody in another example, includes two heavy (H) chain variable regions and two light (L) chain variable regions.
- antibody reagent encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab')2, Fd fragments, Fv fragments, scFv, CDRs, and domain antibody (dAb) fragments (see, e.g. de Wildt et al., Eur J. Immunol.1996; 26(3):629-39; which is incorporated by reference herein in its entirety)) as well as complete antibodies.
- antibodies e.g., single chain antibodies, Fab and sFab fragments, F(ab')2, Fd fragments, Fv fragments, scFv, CDRs, and domain antibody (dAb) fragments (see, e.g. de Wildt et al., Eur J. Immunol.1996; 26(3):629-39; which is incorporated by reference here
- An antibody can have the structural features of IgA, IgG, IgE, IgD, or IgM (as well as subtypes and combinations thereof).
- Antibodies can be from any source, including mouse, rabbit, pig, rat, and primate (human and non-human primate) and primatized antibodies.
- Antibodies also include midibodies, nanobodies, humanized antibodies, chimeric antibodies, and the like.
- An antibody reagent can be an antibody fragment.
- protein refers to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function.
- modified amino acids e.g., phosphorylated, glycated, glycosylated, etc.
- amino acid analogs regardless of its size or function.
- Protein and polypeptide are often used in reference to relatively large polypeptides, whereas the term “peptide” is often used in reference to small polypeptides, but usage of these terms in the art overlaps.
- protein and “polypeptide” are used interchangeably herein when referring to a gene product and fragments thereof.
- exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.
- variants naturally occurring or otherwise
- alleles homologs
- conservatively modified variants conservative substitution variants of any of the particular polypeptides described are encompassed.
- amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage of amino acids in the encoded sequence is a“conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid and retains the desired activity of the polypeptide.
- conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles consistent with the disclosure.
- an "antigen” is a molecule that is bound by a binding site on an antibody.
- antigens are bound by antibody ligands and are capable of raising an antibody response in vivo.
- An antigen can be a polypeptide, protein, nucleic acid or other molecule or portion thereof.
- antigenic determinant refers to an epitope on the antigen recognized by an antigen-binding molecule, and more particularly, by the antigen-binding site of said molecule.
- affinity refers to the strength of an interaction, e.g. the binding of an antibody for an antigen and can be expressed quantitatively as a dissociation constant (K D ).
- Avidity is the measure of the strength of binding between an antigen-binding molecule (such as an antibody reagent described herein) and the pertinent antigen. Avidity is related to both the affinity between an antigenic determinant and its antigen binding site on the antigen-binding molecule, and the number of pertinent binding sites present on the antigen-binding molecule.
- antigen-binding proteins such as an antibody reagent described herein
- K D dissociation constant
- K A association constant
- the K D for biological interactions which are considered meaningful are typically in the range of 10 -10 M (0.1 nM) to 10 -5 M (10000 nM). The stronger an interaction is, the lower is its K D .
- a binding site on an antibody reagent described herein will bind to the desired antigen with an affinity less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM.
- Specific binding of an antibody reagent to an antigen or antigenic determinant can be determined in any suitable manner known per se, including, for example, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known per se in the art; as well as other techniques as mentioned herein.
- RIA radioimmunoassays
- EIA enzyme immunoassays
- sandwich competition assays sandwich competition assays, and the different variants thereof known per se in the art; as well as other techniques as mentioned herein.
- the term“specific binding” or“specificity” refers to a chemical interaction between two molecules, compounds, cells and/or particles wherein the first entity binds to the second, target entity with greater specificity and affinity than it binds to a third entity which is a non-target.
- specific binding can refer to an affinity of the first entity for the second target entity which is at least 10 times, at least 50 times, at least 100 times, at least 500 times, at least 1000 times or greater than the affinity for the third nontarget entity.
- selective binds or“specifically binds” refers to the ability of an agent (e.g. an antibody reagent) described herein to bind to a target, such a peptide comprising, e.g.
- the amino acid sequence of a given antigen with a K D 10 -5 M (10000 nM) or less, e.g., 10 -6 M or less, 10 -7 M or less, 10 -8 M or less, 10 -9 M or less, 10 -10 M or less, 10- 11 M or less, or 10 -12 M or less.
- a K D 10 -5 M 10000 nM
- an agent described herein binds to a first peptide comprising the antigen with a K D of 10 -5 M or lower, but not to another randomly selected peptide, then the agent is said to specifically bind the first peptide.
- Specific binding can be influenced by, for example, the affinity and avidity of the agent and the
- concentration of the agent can be determined appropriate conditions under which an agent selectively bind the targets using any suitable methods, such as titration of an agent in a suitable cell and/or a peptide binding assay.
- RNA transcribed from a gene, and polypeptides obtained by translation of mRNA transcribed from a gene.
- gene means the nucleic acid sequence which is transcribed (DNA) to RNA in vitro or in vivo when operably linked to appropriate regulatory sequences.
- the gene may or may not include regions preceding and following the coding region, e.g.5’ untranslated (5’UTR) or “leader” sequences and 3’ UTR or “trailer” sequences, as well as intervening sequences (introns) between individual coding segments (exons).
- regions preceding and following the coding region e.g.5’ untranslated (5’UTR) or “leader” sequences and 3’ UTR or “trailer” sequences, as well as intervening sequences (introns) between individual coding segments (exons).
- the term“contacting” when used in reference to a cell or organ encompasses both introducing an agent, surface, hormone, etc. to the cell in a manner that permits physical contact of the cell with the agent, surface, hormone etc., and introducing an element, such as a genetic construct or vector, that permits the expression of an agent, such as a miRNA, polypeptide, or other expression product in the cell. It should be understood that a cell genetically modified to express an agent, is“contacted” with the agent, as are the cell’s progeny that express the agent.
- the term“statistically significant” or“significantly” refers to statistical significance and generally means a two standard deviation (2SD) or greater difference.
- consisting essentially of refers to those elements required for a given embodiment. The term permits the presence of additional elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the invention.
- the term“about,” as used herein when referring to a measurable value such as an amount of a composition of this invention, dose, time, temperature, and the like, is meant to encompass variations of ⁇ 20%, ⁇ 10%, ⁇ 5%, ⁇ 1%, ⁇ 0.5%, or even ⁇ 0.1% of the specified amount.
- all numbers expressing quantities of ingredients or reaction conditions used herein should be understood as modified in all instances by the term“about.”
- the term“about” when used in connection with percentages can mean ⁇ 1%.
- Fig.1 shows schematic of research plan: Aims 1 probes miR-15a's and miR-412's mechanism and function, Aim 2 tests their treatment potential, and Aim 3 elucidates the function of miR-15a's known target WISP1.
- HSC is a term for Hepatic stellate cell.
- Fig.2 shows schematic of flow of the experiment that screened a full genome microRNA mimic library to identify candidates that revert activated hepatic stellate cells toward quiescence.
- Fig.3 shows activated mouse hepatic stellate cells (HSCs) reverted toward quiescence, demonstrated by re- formation of Nile Red stain-positive lipid droplets, when miR-15a or miR-412 were overexpressed (top row).
- Fig.3 also shows activated human HSCs reverted toward quiescence, demonstrated by re-formation of lipid droplets, when human orthologues of miR-15a or miR-412 were overexpressed (bottom row).
- Figs 4A and 4B show miR-15a or miR-412 delivery to activated hepatic stellate cells (HSCs) caused changes in morphology toward that of quiescence.
- Fig.4A shows the size of the HSCs decreased by 10-100 folds as all of the photos were taken with the same magnification (same scale bar for all panels).
- Fig.4B. shows that forced expression of miR-15a or miR-412 in initially activated HSCs downregulated alpha smooth muscle actin (Acta2) and alpha-1 type I collagen (Col1a1) measured with qPCR. Data are presented as mean +/- SD.
- Fig.5 shows that miR-15a or miR-412-transfected hepatic stellate cells (HSCs) have a functional phenotype.
- HSCs hepatic stellate cells
- Activated HSCs treated with miR-15a or miR-412 did not cause steatosis in cocultured hepatocytes.
- Activated HSCs treated with negative control microRNA induced steatosis in cocultured hepatocytes.
- qHSC quiescent hepatic stellate cell
- Ac-HSC activated hepatic stellate cell
- miR-Neg microRNA negative control.
- Fig.6 shows that HepG2 cells cocultured with activated human HSCs that received miR-15a or miR-412 have decreased expression of pro-inflammatory cytokines (left panel).
- Data are presented as mean +1- SD.
- Fig.7 shows endogenous miR-15a and miR-412 had decreased expression levels in activated primary HSCs compared to quiescent HSCs, although not significantly for miR-15a. Data are presented as mean +1- SD.
- Fig.8 shows schematic of schedule for CCl 4 challenge and cell therapy injection (diagram). Top row:
- Fig.9 shows cell therapy with reprogrammed quiescent-like HSCs caused mice challenged with CCl 4 to have decreased expression of alpha-1 type I collagen (Col1a1) in the whole liver measured by qPCR. Data are presented as mean +1- SD.
- Fig.10 shows hepatic stellate cells in human primary biliary cholangitis expressed WISP1 which co-localized with alpha smooth muscle actin (Acta2).
- Fig.11 shows that miR-15a mimic co-transfected with a reporter containing either one of the two predicted WISP1 target sequences decreased luciferase expression while it did not affect the reporters containing mutated sequences, indicating that miR-15a binds to both WISP1 target sequences. Data are presented as mean +1- SD (**P ⁇ 0.01; ***P ⁇ 0.001).
- Fig.12 shows that quiescent HSCs in low and high magnification (left column).
- the high magnification view clearly shows several lipid droplets that fluoresce green with BODIPY stain (inset).
- Fig.13 shows that comparison of mice fed with standard diet (left column) and with CDAHFD (right column). Mice fed with CDAHFD developed early NASH in three weeks, showing increased body size, steatotic liver grossly and microscopically, and trace fibrosis by Sirius Red stain. CDAHFD, choline-deficient L-amino acid defined high fat diet.
- Fig.14 shows the schematic of the experiment showing coculture of healthy hepatocytes (Hep) with either control hepatic stellate cells (HSC) from unchallenged mice or HSCs from CDAHFD challenged NASH mice.
- Hep healthy hepatocytes
- HSC control hepatic stellate cells
- Top row Hepatocytes cocultured with HSCs from control mice showed very few lipid droplets stained with BODIPY.
- Bottom row Hepatocytes cocultured with HSCs from NASH mice showed significantly more lipid droplets.
- CDAHFD choline- deficient L-amino acid defined high fat diet.
- Fig.15 shows hepatocytes cocultured with hepatic stellate cells (HSC) from NASH mice expressed higher levels of several inflammatory cytokines and chemoattractants than when they were cocultured with control HSCs, measured with qPCR. Data are presented as mean +/- SD.
- Fig.16 shows induction of fatty accumulation in hepatocytes (Hep) can be achieved when the conditioned media from NASH-hepatic stellate cells (HSC) is applied to normal hepatocytes.
- HSC NASH-hepatic stellate cells
- Top row When quiescent HSC (qHSC) media was applied to healthy hepatocytes, steatosis was not induced.
- Bottom row NASH-HSC media induced steatosis in initially healthy hepatocytes. Lipid droplets stained with BODIPY.
- Fig.17 shows that delivering miR-15a or miR-412 into activated hepatic stellate cells (AcHSC) induced re- formation of lipid droplets that are retinoid positive evidenced by fluorescence under ultraviolet light, consistent with those in quiescent hepatic stellate cells (qHSC).
- Fig.18 shows RNA sequencing data analyzed with multi-dimensional scaling demonstrated that the quiescent-like HSCs that received miR-15a or miR-412 had a global transcriptional profile 4D-50% closer to quiescent HSCs than activated cells. HSC, hepatic stellate cell.
- Fig.19 shows that miR-15a or miR-412-transfected hepatic stellate cells (HSC) have a functional phenotype.
- Top row Activated HSCs treated with miR-15a or miR-412 did not cause steatosis in cocultured hepatocytes.
- qHSC quiescent hepatic stellate cell: Ac-HSC, activated hepatic stellate cell; miR-Neg, microRNA negative control.
- HSCs harvested from CDAHFD model of NASH induced steatosis in cocultured hepatocytes These same HSCs infected with lentivirus expressing miR-15a or miR-412 bet their ability to induce steatosis in adjacent hepatocytes.
- Fig.20 shows overlaying the set of genes with decreased mRNA level in hepatic stellate cells after receiving either miR-15a or miR-412 with the set of potential direct targets based on a prediction algorithm produced the target candidate sets that are more likely to include true miRNA targets.
- the genes in the target candidate sets were further filtered by choosing those that are part of the Tgf-beta or Pdgf signaling pathway.
- Fig.21 shows CRISPR technology can be used in primary hepatic stellate cells. The viability of using this technology on primary cells was verified by delivering long noncoding RNA Digit deletion vectors. Homozygous knock- in is confirmed with the appearance of new PCR bands, one allele with puromycin construct and another with neomycin construct. Ctl, control construct; KI, knock-in construct.
- Fig.22 shows a protein blot of >100 cytokines, chemokines, and extracellular matrix proteins showed that HSCs from mice with CDAHFD induced NASH up-secreted WISP1 compared to those from healthy mice.
- CM conditioned media.
- Fig.23 shows activated hepatic stellate cells (AcHSC) expressed WISP1 nearly 30 times higher than quiescent hepatic stellate cells (qHSC). Hepatocytes (Hep) also expressed WISP1, but significantly less than activated hepatic stellate cells. Lv, whole liver. Data are presented as mean +/- SD.
- Fig.24 shows conditioned media from hepatic stellate cells overexpressing WISP1 induced steatosis in hepatocytes harvested from healthy mice.
- CM conditioned media.
- Fig.25 is a schematic showing WISP1 is involved in human disease.
- Fig.26 is a schematic showing WISP 1 is a member of the CCN family of secreted matricellular proteins.
- Fig.27 is a schematic showing that hepatic stellate cells are key drivers of liver fibrosis.
- Fig.28 is a schematic showing hepatic stellate cell (HSC) activation.
- Figs 29A and 29B show WISP1 is highly upregulated in activated HSCs and is a direct target of miR-15a.
- FIG.29A WISP1 secreted by activated hepatic stellate cells in NASH mice.
- FIG.29B mrR-15a mimic co-transfected with a reported containing predicted WISP1 target sequences decreased luciferase expression.
- Figs 30A-30C show WISP1 and Yap 1 mutually activate each other.
- FIG.30A WISP1 and YAP mRNA increased by rc-WISP1 treatment in qHSC.
- FIG.30B YAP1 activation induced by rc-WISP1 treatment in qHSC.
- FIG. 30C WISP1 expression increased by YAP1 overexpression in reprogrammed HSC by miRNA.
- FIG. 31A and 31B show existing literature supporting role of WISP inhibition in liver and lung fibrosis.
- FIG. 31A Anti-WISP1 mAb attenuated CCl 4 -induced liver fibrosis.
- FIG.31B Anti-WISP1 mAb attenuated bleomycin- induced lung fibrosis
- FIGs 32A and 32B show WISP1 neutralizing antibodies attenuate biliary fibrosis.
- FIG.32A In vivo treatment with neutralizing antibody to WISP1 decreased bile duct ligation (BDL) induced liver fibrosis.
- FIG.32B Collagen expression in indicated conditions.
- FIGs 33A and 33B shows WISP1 is secreted in common and rare human fibrotic liver diseases.
- FIG.33A WISP1 upregulated in HSCs of NASH.
- FIG.33B WISP1 upregulated in HSCs of several rare fibrotic liver diseases.
- FIGs 34A and 34B show WISP1 is a novel secreted fibrotic driver for liver inflammation and fibrosis.
- FIG. 34A Activated HSCs from NAFLD mice secrete WISP1.
- FIG.34B WISP1 overexpressing-HSCs induce steatosis in healthy co-cultured primary hepatocytes (BODIPY stain).
- Fig.35 shows Rc WISP1 treatment accelerates HSC proliferation measured by ki67.
- Fig.36 shows sequence alignment of human and mouse miR-15a and miR-412.
- Fig.37A and 37B shows WISP1 expressed by HSCs have self-activating autocrine and pro-steatotic paracrine effects.
- Fig.37A shows that HSC proliferation and activation induced by recombinant WISP1 treatment in mice.
- Fig.37B shows immunohistochemistry of Control and RcWisp1.
- Figs 38A-38F show that Rc WISP1 and Wisp IgG treat NASH-HSCs from choline deficient, L-amino acid defined, high fat diet model-induced steatosis (CDAHFD) and prevent fibrosis.1 ⁇ g/ml WISP1 antibody was incubated with conditioned media for 1 hour at 37 o C before applying to HSCs.
- Fig.38A shows the timeline of treatment and sampling.
- Fig.38B shows cell number of control, Rc WISP1 treated, and Ab WISP1 treated cells.
- Fig.38C shows Acta2 mRNA expression of qHSCs, control, Rc WISP1 treated, and Ab WISP1 treated cells.
- Fig.38D shows Col1a1 mRNA expression of qHSCs, control, Rc WISP1 treated, and Ab WISP1 treated cells.
- Fig.38E shows immunohistochemistry of control, Rc WISP1 treated, and Ab WISP1 treated cells.
- Fig.38F shows the quantification of BODIPY stained area fraction of control, Rc WISP1 treated, and Ab WISP1 treated cells.
- Figs 39A and 39B demonstrate that WISP1 modulates HSC migration.
- Fig.39A shows images of HSC migration in the presence and absence of Rc-WISP1 and WISP1 IgG.
- Fig.39B shows relative wound area of HSCs treated with Rc-WISP1 and WISP1 IgG compared to control HSCs.
- HSCs treated with WISP1 IgG exhibited a relative wound area that was similar to control HSCs within 24 hours, confirming that WISP1 IgG can prevent HSC activation and migration.
- Liver disease e.g., primary biliary cholangitis (PBC)
- PBC primary biliary cholangitis
- biliary fibrosis that ends as cirrhotic end-stage liver disease.
- Liver diseases, such as PBC can manifest as an autoimmune disorder with unclear pathogenesis although both genetic and environmental factors likely cause the liver disease.
- WISP1 is a protein that is secreted by hepatic stellate cells (HSCs) of the liver as they become activated toward myofibroblasts. Through the autocrine system, WISP1 also affects HSCs by accelerating activation and secretion of collagen to promote fibrosis.
- HSCs hepatic stellate cells
- WISP1 also affects HSCs by accelerating activation and secretion of collagen to promote fibrosis.
- fibroblasts in liver disease e.g. primary biliary cholangitis, autoimmune hepatitis, alpha1-antitrypsin deficiency, non-human diseases, myoalcholic steatohepatitis, and scleroderma
- Hepatic stellate cells are fat-storing pericytes of the liver that are found in the perisinusoidal space (also known as the space of Disse).
- Quiescent HSCs are distinguished by the presence of lipid droplets within the cytoplasm.
- stellate cells can become activated.
- Activated HSCs proliferate and have reduced lipid droplets within the cytoplasm.
- Activated HSCs become pro-fibrotic myofibroblasts that secrete collagen and mediators that promote scar formation.
- WISP1 is upregulated in HSCs.
- HSCs activated hepatic stellate cells
- miR-15a directly targets WISP1 to repress the protein’s pro-fibrotic function in activated HSCs.
- the WISP1 inhibitor is a useful therapy to control progressive hepatic fibrosis in liver diseases such as PBC. Treating and/or preventing liver disease
- liver diseases include, but are not limited to, Alagille Syndrome; Alcohol-Related Liver Disease; Alpha-1 Antitrypsin Deficiency; Autoimmune Hepatitis; Benign Liver Tumors; Biliary Atresia; Cirrhosis; Crigler-Najjar
- the liver disease is primary biliary cholangitis, autoimmune hepatitis, alpha 1 antitrypsin deficiency, non-alcoholic steatohepatitis, and scleroderma.
- the methods described herein are used to treat a subject having liver failure, e.g., failure of hepatic synthetic and metabolic function.
- the methods described herein are used to treat a subject having fulminant or severe acute hepatic failure (e.g., liver failure with encephalopathy developing over ⁇ 8 weeks in previously healthy individuals); Hyperacute liver failure (e.g., liver failure with encephalopathy developing over ⁇ 14 days in previously healthy individuals); Acute liver failure (e.g., liver failure with encephalopathy developing over ⁇ 26 weeks in previously healthy individuals); Chronic liver failure (e.g., liver failure without encephalopathy); or Acute on chronic liver failure (e.g., chronic liver failure with the development of encephalopathy).
- a skilled practitioner can assess the severity of the liver disease (e.g., liver failure) using standard methods, for example, Child-Pugh Score (which is a composite of Total bilirubin, albumin, INR, ascites and hepatic encephalopathy), MELD Score (which uses the serum bilirubin, creatinine and INR), or PELD Score (similar to MELD but for pediatric patients), or METAVIR Score (which assesses the level of fibrosis is a sample.
- Child-Pugh Score which is a composite of Total bilirubin, albumin, INR, ascites and hepatic encephalopathy
- MELD Score which uses the serum bilirubin, creatinine and INR
- PELD Score similar to MELD but for pediatric patients
- METAVIR Score which assesses the level of fibrosis is a sample.
- the methods described herein are used to treat a subject having liver fibrosis.
- Liver fibrosis can be diagnosed by a skilled clinician using, e.g., METAVIR Score.
- the METAVIR Score provides two scores, a fibrosis score and an activity score.
- the fibrosis score is used to describe the amount of inflammation (the intensity of inflammation/breakdown of tissue) in the liver, e.g., F0: No fibrosis; F1: Portal fibrosis without septa; F2: Portal fibrosis with few septa; F3: Numerous septa without cirrhosis; F4: Cirrhosis.
- the activity score is a prediction about how rapidly the degree of fibrosis is progressing, e.g., A0: No activity; A1: Mild activity; A2: Moderate activity; and A3: Severe activity.
- a subject treated with methods described herein has a METAVIR Score of F1, F2, F3, or F4 and/or A1, A2, A3.
- a method for treating or preventing a liver disease comprises: administering to a subject in need thereof an antibody or antibody reagent that inhibits WISP1.
- described herein is a method for treating or preventing a liver disease comprising administering to a subject in need thereof an agent that inhibits WISP1.
- WISP1 is inhibited in a target cell.
- the target cell is a liver cell that highly expresses WISP1 and results in a disease state, e.g., a liver disease.
- an appropriate control e.g., a healthy, non-diseased liver cell.
- One skilled in the art can assess the mRNA or protein levels of WISP1 in a cell using PCR-based assays or western-blotting, respectively, using standard techniques.
- a target cell is a hepatic stellate cell (HSC).
- HSCs are pericytes found in the perisinusoidal space of the liver.
- One skilled in the art can determine if a cell is an HSC using, e.g., selective staining for gold chloride or visualization of lipid droplets in the cytoplasm.
- the HSC is quiescent.
- a quiescent HSC can be identified by one skilled in the art by the presence of lipid droplets in the cytoplasm in a non-proliferating cell.
- An active HSC can be identified by one skilled in the art by assessing proliferation of the cell, reduced lipid droplets within the cytoplasm, and/or secretion of collagen and mediators that promote scar formation.
- a target cell is a fibroblast, e.g., a liver fibroblast.
- a target cell is a myofibroblast.
- a myofibroblast cell has characteristics of both a fibroblast cell and a smooth muscle cell. Fibroblasts and myofibroblasts can readily be identified by one skilled in the art, e.g., by selecting for fibroblast or fibroblast and smooth muscle cell markers, respectively, e.g., via microscopy.
- a target cell is a mammalian cell, preferably a human cell.
- a method of treating a liver disease comprising (a) measuring the level of WISP1 and/or Yap, Col1a1, Acta2 in a biological sample of a subject; (b) comparing the measurement of (a) to a reference level; (c) identifying a subject with increased WISP1 and/or Yap, Col1a1, Acta2 in (a) as compared to a reference level as having a liver disease; and (d) administering to the subject having liver disease an antibody or antibody reagent that inhibits WISP1.
- a method of treating a liver disease comprising (a) measuring the level of WISP1 and/or Yap, Col1a1, Acta2 in a biological sample of a subject; (b) comparing the measurement of (a) to a reference level; (c) identifying a subject with increased WISP1 and/or Yap, Col1a1, Acta2 levels in (a) as compared to a reference level as having a liver disease; and (d) administering to the subject having liver disease an agent that inhibits WISP1.
- Assays for measuring WISP1 and/or Yap, Col1a1, Acta2 levels include, but are not limited to, PCR-based assays to assess WISP1 and/or Yap, Col1a1, Acta2 mRNA levels, or western-blotting to assess WISP1 and/or Yap, Col1a1, Acta2 protein levels.
- WISP1 and/or Yap, Col1a1, Acta2 levels are increased by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%,
- WISP1 and/or Yap, Col1a1, Acta2 levels are WISP1 and/or Yap, Col1a1, Acta2 mRNA levels.
- WISP1 and/or Yap, Col1a1, Acta2 levels are WISP1 and/or Yap, Col1a1, Acta2 protein levels.
- a“reference level” refers to an otherwise identical biological sample of a healthy subject, e.g., a subject that does not have a liver disease.
- the method described herein further comprises, prior to (a) obtaining a biological sample from the subject.
- biological sample refers to a blood sample, a tissue sample, a buffy coat sample (e.g., the fraction of an anticoagulated blood sample that contains a high level of white blood cells and platelets following centrifugation, a serum sample, or a liver biopsy sample.
- a biological sample can be obtained using common, appropriate techniques known in the art. For example, tissue samples can be obtained via biopsy, and blood samples can be obtained from finger prick or intravenous blood draw.
- biological samples are taken from a subject that has previously or not previously been diagnosed with a liver disease.
- the biological sample is taken from a subject that is suspected of having a liver disease, e.g., a subject how has at least one risk factor for liver disease, e.g., increased alcohol intake as compared to normal intake.
- Another aspect provided herein is a method of treating a liver disease in a subject comprising (a) receiving the results of an assay that identifies a subject as having increased WISP1 and/or Acta2 levels as compared to a reference level as having a liver disease; and (b) administering to the subject having liver disease an antibody or antibody reagent that inhibits WISP1.
- Another aspect provided herein is a method of treating a liver disease in a subject comprising (a) receiving the results of an assay that identifies a subject as having increased WISP1, Yap, Col1a1 and/or Acta2 levels as compared to a reference level as having a liver disease; and (b) administering to the subject having liver disease an agent reagent that inhibits WISP1.
- Assays for measuring WISP1, Yap (NCBI Gene ID 10413), Col1a1 (NCBI Gene ID 1277) and/or Acta2 (NCBI Gene ID 59) levels include, but are not limited to, PCR-based assays to assess WISP1 and/or Yap, Col1a1, Acta2 mRNA levels, or western-blotting to assess WISP1 and/or Yap, Col1a1, Acta2 protein levels.
- An assay e.g., a PCR-based assay to assess WISP1 and/or Yap, Col1a1, Acta2 mRNA levels, or western-blotting to assess WISP1 and/or Yap, Col1a1, Acta2 protein levels
- the agent e.g., an antibody or antibody reagent
- the assay can be performed by another individual (i.e., not by the practitioner administering the agent (e.g., an antibody or antibody reagent) that inhibits WISP1).
- Results of an assay can be received by any means, e.g., via mail courier, telephonic transmission (e.g., facsimile), electronic transmission (e.g., electronic medical records, electronic mail (email), or the like.
- treatment is administered to the subject at any time (e.g., at least 1 second, 1 min, 1 hour, 1 day, 1 week, 1 month, 1 year, or longer) after receiving the results of the assay.
- WISP1 and/or Yap, Col1a1, Acta2 levels are increased by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%,
- WISP1 and/or Yap, Col1a1, Acta2 levels are WISP1 and/or Yap, Col1a1, Acta2 mRNA levels.
- WISP1 and/or Yap, Col1a1, Acta2 levels are WISP1 and/or Yap, Col1a1, Acta2 protein levels.
- described herein is a method for treating or preventing a liver disease comprising administering to a subject in need thereof any of the cells generated using methods described herein, or any of the pharmaceutical composition comprising cells generated using methods described herein.
- any of the antibodies or antibody reagents, agents, cells generated using methods described herein, compositions, of pharmaceutical compositions described herein can be used to treat or reduce fibrosis of the liver in a subject.
- a method for reducing fibrosis, e.g., liver fibrosis comprising administering to a subject in need thereof any of the cells generated using methods described herein, or any of the pharmaceutical composition comprising cells generated using methods described herein.
- the subject has previously been diagnosed with having a liver disease.
- the subject is diagnosed with a liver disease prior to the administering of the agent.
- One skilled in the art can diagnose a subject of having a liver disease, e.g., using standard techniques in the art. For example, blood tests referred to as liver function tests; non-invasive imaging such as CT-scan, ultrasound, or MRI scan; or tissue biopsy. Liver function tests refer to blood tests that assess levels of liver-specific enzymes, e.g., alanine transaminase (ALT), aspartate aminotransferase (AST), alkaline phosphatase (ALP), albumin, or bilirubin.
- ALT alanine transaminase
- AST aspartate aminotransferase
- ALP alkaline phosphatase
- albumin or bilirubin.
- liver disease Even mildly elevated levels of ALT, AST, ALP, albumin, or bilirubin can indicate a liver disease. Further tests for assessing liver disease are described herein (e.g., Child-Pugh Score. METAVIR Score, and PELD and MELD Score.
- the agents described herein inhibit a WISP1 splice variant in a target cell.
- exemplary WISP1 splice variants include, but are not limited to, WISP1v, WISP1vx, and WISP1delta exon 3-4.
- inhibiting WISP1 is inhibiting WISP1 activity.
- the WISP1 activity can be any currently known, or yet to be discovered activity of function of the WISP1 gene or gene product.
- WISP1 accelerates activation and secretion of collagen to promote fibrosis in HSCs, and attenuates p53-mediated apoptosis and inhibit TNF-induced cell death in other cell types.
- the WISP1 activity is inhibited by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or more as compared to an appropriate control.
- an“appropriate control” refers to the level of WISP1 activity is an otherwise identical sample that is not contacted by an agent or composition described herein, or is the level of WISP1 activity in a subject prior to administration of an agent or composition.
- an appropriate control can be the level of WISP1 activity in a healthy subject, e.g., an individual that does not have a liver disease.
- One skilled in the art can determine the activity of WISP1 using functional readouts of WISP1’s activity, for example, by measuring/assessing/quantifying the activation and secretion of collagen in HSCs.
- inhibiting WISP1 is inhibiting WISP1 levels in the cell, e.g, gene expression levels or gene product levels.
- WISP1 levels are inhibited by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or more as compared to an appropriate control.
- an“appropriate control” would be the level of WISP1 is an otherwise identical sample that is not contacted by an agent or composition described herein, or is the level of WISP1 in a subject prior to administration of an agent or composition.
- an appropriate control can be the level of WISP1 in a healthy subject, e.g., an individual that does not have a liver disease.
- One skilled in the art can determine the activity of WISP1 using functional readouts of WISP1’s activity, for example, by measuring/assessing the activation and secretion of collagen in HSCs.
- One skilled in the art can assess/measure the protein and mRNA levels of WISP1, e.g., using western blotting or PCR-based assays, respectively.
- an agent that inhibits WISP1 is administered to a subject having or at risk of having a liver disease.
- the agent is a small molecule, an antibody, a peptide, a genome editing system, a viral vector, a miRNA, and a siRNA.
- An agent described herein is considered effective for inhibiting WISP1 if, for example, upon administration, it inhibits the presence, amount, activity and/or level of WISP1 in the cell.
- An agent can inhibit e.g., the transcription, or the translation of WISP1 in the cell.
- An agent can inhibit the activity or alter the activity (e.g., such that the activity no longer occurs, no longer occurs properly (e.g., as compared to wild-type WISP1 activity), or occurs at a reduced rate) of WISP1 in the cell (e.g., WISP1’s expression).
- the agent excludes miRNA 412 and miRNA 15a. In another embodiment, the agent excludes any miRNA 412 or miRNA 15a mimics.
- the agent may function directly in the form in which it is administered.
- the agent can be modified or utilized intracellularly to produce something which inhibits WISP1, such as introduction of a nucleic acid sequence into the cell and its transcription resulting in the production of the nucleic acid and/or protein inhibitor of WISP1 within the cell.
- the agent is any chemical, entity or moiety, including without limitation synthetic and naturally-occurring non-proteinaceous entities.
- the agent is a small molecule having a chemical moiety.
- chemical moieties included unsubstituted or substituted alkyl, aromatic, or heterocyclyl moieties including macrolides, leptomycins and related natural products or analogues thereof.
- Agents can be known to have a desired activity and/or property, or can be identified from a library of diverse compounds.
- the agent is a small molecule that inhibits WISP1.
- the term“small molecule” refers to a chemical agent which can include, but is not limited to, a peptide, a peptidomimetic, an amino acid, an amino acid analog, a polynucleotide, a polynucleotide analog, an aptamer, a nucleotide, a nucleotide analog, an organic or inorganic compound (e.g., including heterorganic and organometallic compounds) having a molecular weight less than about 10,000 grams per mole, organic or inorganic compounds having a molecular weight less than about 5,000 grams per mole, organic or inorganic compounds having a molecular weight less than about 1,000 grams per mole, organic or inorganic compounds having a molecular weight less than about 500 grams per mole, and salts, esters, and other pharmaceutically acceptable forms of such compounds.
- Methods for screening small molecules e.g., heterorganic and
- compositions comprising any of agents that inhibit WISP1 described herein.
- the composition further comprises a pharmaceutically acceptable carrier.
- the composition is a pharmaceutical composition.
- described herein is a method treating or preventing a liver disease comprising administering to a subject in need thereof a polypeptide or a nucleic acid encoding such polypeptide that inhibits WISP1 in a target cell.
- WISP1-binding polypeptide refers to a polypeptide that specifically binds to a desired antigen of interest (e.g., WISP1 polypeptide) and that is an Ig-like protein comprising one or more of the antigen binding domains described herein linked to a linker or an immunoglobulin constant domain.
- a binding protein can be, in some embodiments, a dual variable domain (DVD-Ig) binding protein.
- a "linker polypeptide” comprises two or more amino acid residues joined by peptide bonds and are used to link one or more antigen binding portions. Such linker polypeptides are well known in the art (see e.g., Holliger et al. (1993) Proc. Natl.
- An immunoglobulin constant domain refers to a heavy or light chain constant domain.
- Human IgG heavy chain and light chain constant domain amino acid sequences are known in the art, (e.g., see SEQ ID NO: 197, 198, 199 and 200 of US Application 2016/0200813, which is incorporated herein in its entirety by reference for representative examples).
- the polypeptide that inhibits WISP1 is heterologous.
- heterologous refers to a polypeptide which is not ordinarily produced by a host cell, e.g., the cell expressing the heterologous polypeptide, but rather, is derived from an organism different from the host cell.
- the WISP1 inhibitor used herein is derived, for example, from a bacterial cell and expressed in, for example, a mammalian cell.
- the polypeptide that inhibits WISP1 is at least 50% , at least 60%, at least 70%, at least 80%, at least 90%, or 100% homologous to SEQ ID NOs 1-4 or 6.
- homologous as used herein is defined as the percentage of nucleotide or amino acid residues that are identical to the nucleotide or amino acid residues in the corresponding sequence on the target chromosome or polypeptide, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent nucleotide or amino acid sequence homology can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ClustalW2 or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- a nucleic acid or amino acid sequence (e.g., DNA, RNA, or amino acid sequence), for example of, a WISP1-binding fragment or polypeptide, is considered“homologous” when the sequence is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more, identical to the corresponding native or unedited nucleic acid sequence (e.g., genomic sequence) or amino acid sequence of WISP1.
- a native or unedited nucleic acid sequence e.g., genomic sequence
- WISP1-binding fragment or polypeptide is considered“homologous” when the sequence is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
- variants naturally occurring or otherwise
- alleles homologs
- conservatively modified variants conservative substitution variants of any of the particular polypeptides described are encompassed.
- amino acid sequences one of ordinary skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage of amino acids in the encoded sequence is a“conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid and retains the desired activity of the polypeptide.
- conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles consistent with the disclosure.
- a given amino acid can be replaced by a residue having similar physiochemical characteristics, e.g., substituting one aliphatic residue for another (such as Ile, Val, Leu, or Ala for one another), or substitution of one polar residue for another (such as between Lys and Arg; Glu and Asp; or Gln and Asn).
- Other such conservative substitutions e.g., substitutions of entire regions having similar hydrophobicity characteristics, are well known.
- Polypeptides comprising conservative amino acid substitutions can be tested in any one of the assays described herein to confirm that a desired activity, e.g. ligand-mediated receptor activity and specificity of a native or reference polypeptide is retained.
- Amino acids can be grouped according to similarities in the properties of their side chains (in A. L.
- Naturally occurring residues can be divided into groups based on common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe.
- Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
- Particular conservative substitutions include, for example; Ala into Gly or into Ser; Arg into Lys; Asn into Gln or into His; Asp into Glu; Cys into Ser; Gln into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gln; Ile into Leu or into Val; Leu into Ile or into Val; Lys into Arg, into Gln or into Glu; Met into Leu, into Tyr or into Ile; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr; Tyr into Trp; and/or Phe into Val, into Ile or into Leu.
- a polypeptide described herein can be a functional fragment of one of the amino acid sequences described herein.
- a“functional fragment” is a fragment or segment of a peptide which retains at least 50% of the wildtype reference polypeptide’s activity according to an assay known in the art or described below herein.
- a functional fragment can comprise conservative substitutions of the sequences disclosed herein.
- a polypeptide described herein can be a variant of a polypeptide or molecule as described herein.
- the variant is a conservatively modified variant.
- Conservative substitution variants can be obtained by mutations of native nucleotide sequences, for example.
- A“variant,” as referred to herein, is a polypeptide substantially homologous to a native or reference polypeptide, but which has an amino acid sequence different from that of the native or reference polypeptide because of one or a plurality of deletions, insertions or substitutions.
- Variant polypeptide-encoding DNA sequences encompass sequences that comprise one or more additions, deletions, or substitutions of nucleotides when compared to a native or reference DNA sequence, but that encode a variant protein or fragment thereof that retains activity of the non-variant polypeptide.
- a wide variety of PCR-based site-specific mutagenesis approaches are known in the art and can be applied by the ordinarily skilled artisan.
- a variant amino acid or DNA sequence can be at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, identical to a native or reference sequence.
- the degree of homology (percent identity) between a native and a mutant sequence can be determined, for example, by comparing the two sequences using freely available computer programs commonly employed for this purpose on the world wide web (e.g., BLASTp or BLASTn with default settings).
- Alterations of the native amino acid sequence can be accomplished by any of a number of techniques known in the art. Mutations can be introduced, for example, at particular loci by synthesizing oligonucleotides containing a mutant sequence, flanked by restriction sites permitting ligation to fragments of the native sequence. Following ligation, the resulting reconstructed sequence encodes an analog having the desired amino acid insertion, substitution, or deletion. Alternatively, oligonucleotide-directed site-specific mutagenesis procedures can be employed to provide an altered nucleotide sequence having particular codons altered according to the substitution, deletion, or insertion required.
- described herein is a method treating or preventing a liver disease, the method comprising administering to a subject in need thereof an antibody or antibody reagent that inhibits WISP1 in a target cell.
- the agent described herein is an antibody or antigen-binding fragment thereof, or an antibody reagent that is specific for WISP1.
- the antibody or antibody reagent that inhibits WISP1 specifically binds to WISP1 polypeptide.
- the antibody or antibody reagent specifically binds to amino acid sequences SEQ ID NO: 1-4, or SEQ ID NO: 6.
- an antibody reagent refers to a polypeptide that includes at least one immunoglobulin variable domain or immunoglobulin variable domain sequence and which specifically binds a given antigen.
- An antibody reagent can comprise an antibody or a polypeptide comprising an antigen-binding domain of an antibody.
- an antibody reagent can comprise a monoclonal antibody or a polypeptide comprising an antigen-binding domain of a monoclonal antibody.
- an antibody can include a heavy (H) chain variable region (abbreviated herein as V H ), and a light (L) chain variable region (abbreviated herein as V L ).
- an antibody in another example, includes two heavy (H) chain variable regions and two light (L) chain variable regions.
- antibody reagent encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab')2, Fd fragments, Fv fragments, scFv, CDRs, and domain antibody (dAb) fragments (see, e.g. de Wildt et al., Eur J. Immunol.1996; 26(3):629-39; which is incorporated by reference herein in its entirety)) as well as complete antibodies.
- antibodies e.g., single chain antibodies, Fab and sFab fragments, F(ab')2, Fd fragments, Fv fragments, scFv, CDRs, and domain antibody (dAb) fragments (see, e.g. de Wildt et al., Eur J. Immunol.1996; 26(3):629-39; which is incorporated by reference here
- An antibody can have the structural features of IgA, IgG, IgE, IgD, or IgM (as well as subtypes and combinations thereof).
- Antibodies can be from any source, including mouse, rabbit, pig, sheep, goat, rat, and primate (human and non-human primate) and primatized antibodies.
- Antibodies also include midibodies, nanobodies, intrabodies, humanized antibodies, chimeric antibodies, and the like.
- the antibody described herein is a humanized, monoclonal antibody or antigen-binding fragment thereof, or an antibody reagent.
- the humanized antibody is a humanized monoclonal antibody.
- the humanized antibody is a humanized polyclonal antibody.
- the humanized antibody is for therapeutic use.
- the anti-WISP1 antibody described herein can be a monospecific antibody or a monoclonal antibody.
- the term "monospecific antibody” refers to an antibody that displays a single binding specificity and affinity for a particular target, e.g., epitope. This term includes a "monoclonal antibody” or “monoclonal antibody composition,” which as used herein refer to a preparation of antibodies or fragments thereof of single molecular composition, irrespective of how the antibody was generated.
- humanized antibody refers to antibodies that comprise heavy and light chain variable domain sequences from a non-human species (e.g., a mouse, rat, sheep, or goat) but in which at least a portion of the V H and/or V L sequence has been altered to be more "human-like", i.e., more similar to human germline variable sequences. Accordingly, “humanized” antibodies are a form of a chimeric antibody, that are engineered or designed to comprise minimal sequence derived from non-human immunoglobulin.
- humanized antibodies are human immunoglobulins (recipient or acceptor antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- humanized antibodies can comprise residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
- the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- a“composite human antibody” or“deimmunized antibody” are specific types of engineered or humanized antibodies designed to reduce or eliminate T cell epitopes from the variable domains.
- a humanized antibody has one or more amino acid residues introduced into it from a source which is non- human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import” variable domain. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric antibodies (U.S. Pat.
- humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- the anti-WISP1 antibody is an intrabody.
- An intrabody is an intracellular antibody that functionally binds a target within a cell (See, generally, Hood et al., Immunology, Benjamin, N.Y., 2ND ed. (1984), Harlow and Lane, Antibodies. A Laboratory Manual, Cold Spring Harbor Laboratory (1988); Hunkapiller and Hood, Nature, 323, 15-16 (1986); and Rondon and Marasco, Annu Rev Microbiol, 51:257-83 (1997); U.S. Patent Number 6,004, 940; and U.S. Patent Number 5,581,829; which are incorporated herein by reference in their entireties).
- Methods for intrabody production are well known to those of skill in the art, e.g.
- Antibodies will usually bind with at least nectin D of about 1 mM, more usually at least about 300 ⁇ M, typically at l Canal Naturallyst about 10 ⁇ M, more typically at least about 30 ⁇ M, preferably at least about 10 ⁇ M, and more preferably at least about 3 ⁇ M or better.
- the anti-WISP1 antibody is a neutralizing antibody. In one embodiment, the anti-WISP1 antibody is a non-neutralizing antibody.
- the anti-WISP1 antibody is chimeric.
- the term“chimeric”, as used in the context of an antibody, or sequence encoding an antibody refers to immunoglobin molecules characterized by two or more segments or portions derived from different animal species.
- the variable region of the chimeric antibody is derived from a non-human mammalian antibody, such as murine monoclonal antibody, and the immunoglobin constant region is derived from a human immunoglobin molecule.
- the variable segments of chimeric antibodies are typically linked to at least a portion of an immunoglobulin constant region (Fc), typically that of a human
- Human constant region DNA sequences can be isolated in accordance with well-known procedures from a variety of human cells, such as immortalized B-cells (WO 87/02671; which is incorporated by reference herein in its entirety).
- the antibody can contain both light chain and heavy chain constant regions.
- the heavy chain constant region can include CH1, hinge, CH2, CH3, and, sometimes, CH4 regions.
- the CH2 domain can be deleted or omitted.
- the WISP1-binding domain comprises a variable light chain sequence, a variable heavy chain sequence, or both.
- each heavy chain is comprised of a heavy chain variable domain (abbreviated herein as HCVR or V H ) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains: C H 1, C H 2, and C H 3.
- Each light chain is comprised of a light chain variable domain (abbreviated herein LCVR as V L ) and a light chain constant region.
- the light chain constant region is comprised of one domain, C L .
- the V H and V L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR).
- CDRs complementarity determining regions
- Each V H and V L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. This structure is well-known to those skilled in the art. The chains are usually linked to one another via disulfide bonds.
- CDRs Complementarity Determining Regions
- CDR1, CDR2, and CDR3 refers to the amino acid residues of a heavy or light chain variable domain the presence of which are necessary for specific antigen binding.
- Each variable domain typically has three CDR regions identified as CDR1, CDR2 and CDR3.
- Each complementarity determining region can comprise amino acid residues from a "complementarity determining region" as defined by Kabat (i.e., about residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain; Kabat et al., Sequences of Proteins of
- a complementarity determining region can include amino acids from both a CDR region defined according to Kabat and a hypervariable loop.
- CDR set refers to a group of three CDRs that occur in a single heavy or light chain variable region capable of binding the antigen.
- the exact boundaries of these CDRs have been defined differently according to different systems.
- the system described by Kabat Kabat (Kabat et al, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987) and (1991)) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs.
- These CDRs may be referred to as Kabat CDRs. Chothia and coworkers (Chothia & Lesk, J. Mol.
- CDRs can also be described as comprising amino acid residues from a "complementarity determining region" as defined by the IMGT, in some embodiments.
- the compositions and methods used herein may utilize CDRs defined according to any of these systems, although preferred embodiments use IMGT or Abysis defined CDRs.
- An immunoglobulin constant (C) domain refers to a heavy (C H ) or light (C L ) chain constant domain.
- Murine and human IgG heavy chain and light chain constant domain amino acid sequences are known in the art.
- the heavy chain of an antibody described herein can be an alpha (a), delta ( ⁇ ), epsilon ( ⁇ ), gamma (g) or mu ( ⁇ ) heavy chain.
- the heavy chain of an antibody described can comprise a human alpha (a), delta ( ⁇ ), epsilon ( ⁇ ), gamma (g) or mu ( ⁇ ) heavy chain.
- Non-limiting examples of human constant region sequences have been described in the art, e.g., see U.S. Pat. No.5,693,780 and Kabat E A et al., (1991) supra.
- the anti-WISP1 is comprised of a non-IgG framework.
- the terms "donor” and “donor antibody” refer to an antibody providing one or more CDRs.
- the donor antibody is an antibody from a species different from the antibody from which the framework regions are obtained or derived.
- the donor antibody is of a different isotype than the acceptor antibody.
- the term "donor antibody” refers to a non-human antibody providing one or more CDRs.
- the terms “acceptor” and “acceptor antibody” refer to the antibody providing or nucleic acid sequence encoding at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% of the amino acid sequences of one or more of the framework regions.
- the term “acceptor” refers to the antibody amino acid providing or nucleic acid sequence encoding the constant region(s).
- the term “acceptor” refers to the antibody amino acid providing or nucleic acid sequence encoding one or more of the framework regions and the constant region(s).
- the term "acceptor” refers to a human antibody amino acid or nucleic acid sequence that provides or encodes at least 80%, preferably, at least 85%, at least 90%, at least 95%, at least 98%, or 100% of the amino acid sequences of one or more of the framework regions.
- an acceptor may contain at least 1, at least 2, at least 3, least 4, at least 5, or at least 10 amino acid residues that does (do) not occur at one or more specific positions of a human antibody.
- An acceptor framework region and/or acceptor constant region(s) may be, e.g., derived or obtained from a germline antibody gene, a mature antibody gene, a functional antibody (e.g., antibodies well known in the art, antibodies in development, or antibodies commercially available).
- Human heavy chain and light chain acceptor sequences are known in the art.
- the human heavy chain and light chain acceptor sequences are selected from the sequences listed from V-base (found on the worldwide web at vbase.mrc-cpe.cam.ac.uk/) or from IMGT TM the international IMMUNOGENETICS INFORMATION SYSTEM TM (found on the worldwide web at imgt.cines.fr/textes/IMGTrepertoire/LocusGenes/).
- the human heavy chain and light chain acceptor sequences are selected from the sequences described in Table 3 and Table 4 of U.S. Patent Publication No.2011/0280800, incorporated by reference herein in their entireties.
- compositions and methods described herein can, in some embodiments, comprise“antigen-binding fragments” or“antigen-binding portions” of an antibody.
- antigen-binding fragment or“WISP1-binding fragment” of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., WISP1).
- Antigen-binding functions of an antibody can be performed by fragments of a full-length antibody. Such antibody fragment embodiments may also be incorporated in bispecific, dual specific, or multi-specific formats such as a dual variable domain (DVD-Ig) format; specifically binding to two or more different antigens.
- DVD-Ig dual variable domain
- Non-limiting examples of antigen-binding fragments encompassed within the term "antigen-binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L , and C H 1 domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H 1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al.
- V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see, for example, Bird et al. (1988) Science 242: 423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85: 5879-5883).
- scFv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody.
- Other forms of single chain antibodies, such as diabodies are also encompassed.
- the antibody reagent is a bispecific monoclonal antibody.
- Diabodies are bivalent, bispecific antibodies in which V H and V L domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see, for example, Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448; Poljak (1994) Structure 2: 1121- 1123); Kontermann and Dubel eds., Antibody Engineering, Springer-Verlag, N.Y. (2001), p.790 (ISBN 3-540-41354-5).
- single chain antibodies also include "linear antibodies” comprising a pair of tandem Fv segments (V H -C H 1- V H -C H 1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al. (1995) Protein Eng.8(10): 1057-1062; and U.S. Pat. No.5,641,870).
- Fc region is used to define the C-terminal region of an immunoglobulin heavy chain, which may be generated by papain digestion of an intact antibody.
- the Fc region may be a native sequence Fc region or a variant Fc region.
- the Fc region of an immunoglobulin generally comprises two constant domains, a C H 2 domain, and a C H 3 domain, and optionally comprises a C H 4 domain. Replacements of amino acid residues in the Fc portion to alter antibody effector function are known in the art (U.S. Pat. Nos.5,648,260 and 5,624,821).
- the Fc portion of an antibody mediates several important effector functions, for example, cytokine induction, antibody-dependent cell cytotoxicity (ADCC), phagocytosis, complement dependent cytotoxicity (CDC), and half-life/clearance rate of antibody and antigen-antibody complexes. In some cases, these effector functions are desirable for therapeutic antibody but in other cases might be unnecessary or even deleterious, depending on the therapeutic objectives.
- Certain human IgG isotypes, particularly IgG1 and IgG3, mediate ADCC and CDC via binding to Fc ⁇ receptors and complement C1q, respectively.
- Neonatal Fc receptors (FcRn) are the critical components determining the circulating half-life of antibodies.
- at least one amino acid residue is replaced in the constant region of the antibody, for example the Fc region of the antibody, such that effector functions of the antibody are altered.
- the nucleic acid sequences can also be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains or framework regions in place of the homologous mammalian (e.g., murine) sequences (U.S. Pat. No. 4,816,567; Morrison, et al., Proc. Natl. Acad. Sci. USA, 81:6851 (1984)), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide, as also described elsewhere herein.
- the homologous mammalian sequences U.S. Pat. No. 4,816,567; Morrison, et al., Proc. Natl. Acad. Sci. USA, 81:6851 (1984)
- non-immunoglobulin polypeptides can be substituted for the constant domains of an antibody, or they can be substituted for the variable domains of one antigen-binding site of an antibody to create a chimeric bivalent antibody comprising one antigen- binding site having specificity for one antigen of interest and another antigen- binding site having specificity for a different antigen of interest.
- the antibody or WISP1-binding fragment thereof comprises one, two, three, or four of the framework regions of a heavy chain variable region sequence which is at least 75%, 80%, 85%, 90%, 95% or 100% identical to one, two, three or four of the framework regions of the heavy chain variable region sequence from which it is derived.
- the heavy chain variable framework region that is derived from said amino acid sequence consists of said amino acid sequence but for the presence of up to 10 amino acid substitutions, deletions, and/or insertions, preferably up to 10 amino acid substitutions.
- the heavy chain variable framework region that is derived from said amino acid sequence consists of said amino acid sequence with 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid residues being substituted for an amino acid found in an analogous position in a corresponding non-human, primate, or human heavy chain variable framework region.
- the antibody or antigen-binding fragment further comprises one, two, three or all four V H framework regions derived from the V H of a human or primate antibody.
- the primate or human heavy chain framework region of the antibody selected for use with the heavy chain CDR sequences described herein can have, for example, at least 70% identity with a heavy chain framework region of the non- human parent antibody.
- the primate or human heavy chain framework region amino acid residues are from a natural primate or human antibody heavy chain framework region having at least 75% identity, at least 80% identity, at least 85% identity (or more) with the heavy chain framework regions of any of the antibodies described herein.
- the antibody or antigen-binding fragment further comprises one, two, three or all four V H framework regions derived from a human heavy chain variable subfamily (e.g., one of subfamilies 1 to 7).
- the antibody or WISP1-binding fragment thereof comprises one, two, three or four of the framework regions of a light chain variable region sequence which is at least 75%, 80%, 85%, 90%, 95%, or 100% identical to one, two, three or four of the framework regions of the light chain variable region sequence from which it is derived.
- the light chain variable framework region that is derived from said amino acid sequence consists of said amino acid sequence but for the presence of up to 10 amino acid substitutions, deletions, and/or insertions, preferably up to 10 amino acid substitutions.
- the light chain variable framework region that is derived from said amino acid sequence consists of said amino acid sequence with 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid residues being substituted for an amino acid found in an analogous position in a corresponding non-human, primate, or human light chain variable framework region.
- the antibody or antigen-binding fragment further comprises one, two, three or all four V L framework regions derived from the V L of a human or primate antibody.
- the primate or human light chain framework region of the antibody selected for use with the light chain CDR sequences described herein can have, for example, at least 70% identity with a light chain framework region of the non- human parent antibody.
- the primate or human light chain framework region amino acid residues are from a natural primate or human antibody light chain framework region having at least 75% identity, at least 80% identity, at least 85% identity (or more) with the light chain framework regions of any of the antibodies described herein.
- the antibody or antigen-binding fragment further comprises one, two, three or all four V L framework regions derived from a human light chain variable kappa subfamily.
- the antibody or antigen-binding fragment further comprises one, two, three or all four VL framework regions derived from a human light chain variable lambda subfamily.
- the position of one or more CDRs along the V H (e.g., CDR1, CDR2, or CDR3) and/or V L (e.g., CDR1, CDR2, or CDR3) region of an antibody described herein can vary, i.e., be shorter or longer, by one, two, three, four, five, or six amino acid positions so long as immunospecific binding to the antigen of interest is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).
- the position defining a CDR can vary, i.e., be shorter or longer, by shifting the N-terminal and/or C- terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the CDR position of any one of the antibodies described herein, so long as immunospecific binding to the antigen of interest is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).
- the length of one or more CDRs along the V H (e.g., CDR1, CDR2, or CDR3) and/or V L (e.g., CDR1, CDR2, or CDR3) region of an antibody described herein can vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as immunospecific binding to the antigen of interest is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).
- one, two or more mutations are introduced into the Fc region of any of the antibodies described herein or a fragment thereof (e.g., CH2 domain (residues 231-340 of human IgG1) and/or CH3 domain (residues 341-447 of human IgG1) and/or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding and/or antigen- dependent cellular cytotoxicity.
- a fragment thereof e.g., CH2 domain (residues 231-340 of human IgG1) and/or CH3 domain (residues 341-447 of human IgG1) and/or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)
- the Kabat numbering system e.g., the EU index in Kabat
- one, two or more mutations are introduced into the hinge region of the Fc region (C H 1 domain) such that the number of cysteine residues in the hinge region are altered (e.g., increased or decreased) as described in, e.g., U.S. Pat. No.5,677,425.
- the number of cysteine residues in the hinge region of the C H 1 domain can be altered to, e.g., facilitate assembly of the light and heavy chains, or to alter (e.g., increase or decrease) the stability of the antibody.
- one, two or more mutations are introduced into the Fc region of an antibody described herein or an antigen-binding fragment thereof (e.g., C H 2 domain (residues 231-340 of human IgG1) and/or C H 3 domain (residues 341-447 of human IgG1) and/or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to increase or decrease the affinity of the antibody for an Fc receptor (e.g., an activated Fc receptor) on the surface of an effector cell.
- an Fc receptor e.g., an activated Fc receptor
- Mutations in the Fc region of an antibody or fragment thereof that decrease or increase the affinity of an antibody for an Fc receptor and techniques for introducing such mutations into the Fc receptor or fragment thereof are known to one of skill in the art. Examples of mutations in the Fc receptor of an antibody that can be made to alter the affinity of the antibody for an Fc receptor are described in, e.g., Smith P et al., (2012) PNAS 109: 6181-6186, U.S. Pat. No.6,737,056, and International Publication Nos. WO 02/060919; WO 98/23289; and WO 97/34631, which are incorporated herein by reference.
- CDR-grafted antibody refers to antibodies which comprise heavy and light chain variable region sequences from one species, but in which the sequences of one or more of the CDR regions of V H and/or V L are replaced with CDR sequences of another species, such as antibodies having human heavy and light chain variable regions in which one or more of the human CDRs (e.g., CDR3) has been replaced with mouse CDR sequences.
- CDR-grafted antibodies described herein comprise heavy and light chain variable region sequences from a human antibody wherein one or more of the CDR regions of V H and/or V L are replaced with CDR sequences of the non-human antibodies described herein.
- the anti-WISP1 antibody described herein can be engineered for improved binding specificity or pharmacokinetic properties for therapeutic use. Specificity of binding can be assayed, for example, by competition assays using the antigen (e.g., WISP1 or a polypeptide fragment thereof), in comparison to competition with one or more unrelated or different antigens. A variety of immunoassay formats are appropriate for selecting agents, antibodies, or other ligands that specifically bind WISP1. Specific binding can be influenced by, for example, the affinity and avidity of the agent described herein (e.g., a polypeptide or anti-WISP1 antibody) and the concentration of agent. The person of ordinary skill in the art can determine appropriate conditions under which the agents described herein selectively bind the WISP1 using any suitable methods, such as titration of an agent in a suitable binding assay.
- key residues refers to certain residues within the variable domain that have more impact on the binding specificity and/or affinity of an antibody, in particular a humanized antibody, than others.
- a key residue includes, but is not limited to, one or more of the following: a residue that is adjacent to a CDR, a potential glycosylation site (can be either N- or O-glycosylation site), a rare residue, a residue capable of interacting with the antigen, a residue capable of interacting with a CDR, a canonical residue, a contact residue between heavy chain variable domain and light chain variable domain, a residue within the Vernier zone, and a residue in the region that overlaps between the Chothia definition of a variable heavy chain CDR/and the Kabat definition of the first heavy chain framework.
- the anti-WISP1 antibodies described herein can be engineered antibodies.
- the term “engineered” refers to the aspect of having been manipulated by the hand of man.
- a locus is considered to be “engineered” when two or more sequences, that are not linked together in that order in nature in that locus, are manipulated by the hand of man to be directly linked to one another in the engineered locus.
- an engineered locus comprises various Ig sequences with a non-native V segment, all of which are found in nature, but are not found in the same locus or are not found in that order in the locus in nature.
- a WISP1-binding polypeptide, antibody, antibody reagent, or antigen-binding portion thereof can be part of a larger immunoadhesion molecule or composition of molecules, formed by covalent or noncovalent association of the antibody antigen-binding portion with one or more other proteins or peptides.
- immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov et al. (1995) Human Antibod.
- Hybridomas 6:93-101) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov et al. (1994) Mol. Immunol.31:1047-1058).
- Antibody portions such as Fab and F(ab').sub.2 fragments, can be prepared from whole antibodies using conventional techniques, such as papain or pepsin digestion, respectively, of whole antibodies.
- antibodies, antigen-binding portions thereof, and immunoadhesion molecules can be obtained using standard recombinant DNA techniques.
- a target binding protein, such as an antigen-binding portion of an antibody may also be part of a dual variable domain (DVD-Ig).
- Antibodies and antibody reagents that are therapeutic and/or specific for any particular target antigen are readily selected by one of skill in the art from known antibodies or antibody reagents, e.g. from FDA- approved therapeutic antibody reagents and/or commercially available antibody reagents which are listed in catalogs according to their target specificity.
- the anti-WISP1 antibody is any known anti-WISP1 antibodies in the art, or any anti- WISP1 antibodies that are yet to be discovered.
- Exemplary anti-WISP1 antibodies known in the art include, but are not limited to, anti-WISP1 antibodies sold by Abcam (e.g., ab60114; ab65943), RND Systems (e.g., mab1680), and Sigma- Aldrich (e.g., SAB2501114).
- the anti-WISP1 antibody is selected from the Table 1 (Table of Antibodies) below.
- the anti-WISP1 antibody comprises any one of the amino acid sequences of SEQ ID NOs: 12- 120.
- Table 1 Table of Antibodies (Anti-WISP1)
- the anti-WISP1 antibody is a humanized anti-WISP1 antibody derived from any known, or yet to be discovered, non-human anti-WISP1 antibody.
- the antibody or antibody reagent binds to an amino acid sequence that corresponds to the amino acid sequence encoding WISP1 (SEQ ID NO: 1).
- the anti-WISP1 antibody or antibody reagent binds to an amino acid sequence that comprises the sequence of SEQ ID NO: 1; or binds to an amino acid sequence that comprises a sequence with at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity to the sequence of SEQ ID NO: 1.
- the anti-WISP1 antibody or antibody reagent binds to an amino acid sequence that comprises the entire sequence of SEQ ID NO: 1.
- the antibody or antibody reagent binds to an amino acid sequence that comprises a fragment of the sequence of SEQ ID NO: 1, wherein the fragment is sufficient to bind its target, e.g., WISP1, and result in the inhibition of WISP1 level and/or activity.
- the antibody or antibody reagent binds to an amino acid sequence that corresponds to the amino acid sequence encoding various human WISP1 isoforms (SEQ ID NOs: 2, 3, or 4).
- the anti-WISP1 antibody or antibody reagent binds to an amino acid sequence that comprises the sequence of SEQ ID NOs: 2, 3, or 4; or binds to an amino acid sequence that comprises a sequence with at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity to the sequence of SEQ ID NOs: 2, 3, or 4.
- the anti-WISP1 antibody or antibody reagent binds to an amino acid sequence that comprises the entire sequence of SEQ ID NOs: 2, 3, or 4. In another embodiment, the antibody or antibody reagent binds to an amino acid sequence that comprises a fragment of the sequence of SEQ ID NOs: 2, 3, or 4, wherein the fragment is sufficient to bind its target, e.g., WISP1, and result in the inhibition of WISP1 level and/or activity.
- target e.g., WISP1
- the antibody or antibody reagent binds to an amino acid sequence that corresponds to the amino acid sequence encoding mouse WISP1 (SEQ ID NO: 6).
- the antibody or antibody reagent binds to an amino acid sequence that comprises the sequence of SEQ ID NO: 6; or binds to an amino acid sequence that comprises a sequence with at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity to the sequence of SEQ ID NO: 6.
- the anti-WISP1 antibody or antibody reagent binds to an amino acid sequence that comprises the entire sequence of SEQ ID NO: 6.
- the antibody or antibody reagent binds to an amino acid sequence that comprises a fragment of the sequence of SEQ ID NO: 6, wherein the fragment is sufficient to bind its target, e.g., WISP1, and result in the inhibition of WISP1 level and/or activity.
- humanized antibodies comprising one or more variable domains comprising one or more CDRs encoded by the variable heavy chain and light chain sequences of SEQ ID NOs: 12-120.
- the antibody or antibody reagent comprises an amino acid sequence with at least 70% homology to any one of SEQ ID NOs: 12-120.
- the antibody or antibody reagent CDR comprises an amino acid sequence with at least 70% homology to any one of SEQ ID NOs: 12-120.
- the antibody or antibody reagent comprises an amino acid sequence with at least 90% homology to any one of SEQ ID NOs: 12-120.
- the antibody or antibody reagent that inhibits WISP1 is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% homologous to SEQ ID NOs 1-4, 6, or SEQ ID NOs: 12-120.
- a nucleic acid or amino acid sequence (e.g., DNA, RNA, or amino acid sequence), for example of, a WISP1-binding fragment or anti-WISP1 antibody, is considered“homologous” when the sequence is at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more, identical to the corresponding native or unedited nucleic acid sequence (e.g., genomic sequence) or amino acid sequence of an antibody that specifically binds to WISP1.
- corresponding native or unedited nucleic acid sequence e.g., genomic sequence
- compositions comprising any of the anti-WISP1 antibodies or antibody reagents described herein.
- the composition further comprises a pharmaceutically acceptable carrier.
- the composition is a pharmaceutical composition. Nucleic acids that inhibit WISP1
- the agent that inhibits WISP1 is an antisense oligonucleotide.
- an “antisense oligonucleotide” refers to a synthesized nucleic acid sequence that is complementary to a DNA or mRNA sequence, such as that of a microRNA. Antisense oligonucleotides are typically designed to block expression of a DNA or RNA target by binding to the target and halting expression at the level of transcription, translation, or splicing. Antisense oligonucleotides of the present invention are complementary nucleic acid sequences designed to hybridize under cellular conditions to a gene, e.g., WISP1.
- oligonucleotides are chosen that are sufficiently complementary to the target, i.e., that hybridize sufficiently well and with sufficient specificity in the context of the cellular environment, to give the desired effect.
- an antisense oligonucleotide that inhibits WISP1 may comprise at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, or more bases complementary to a portion of the coding sequence of the human WISP1 gene (e.g., SEQ ID NO: 5) or the mouse WISP1 gene (e.g., SEQ ID NO: 7).
- WISP1 is depleted from the cell’s genome using any genome editing system including, but not limited to, zinc finger nucleases, TALENS, meganucleases, and CRISPR/Cas systems.
- the genomic editing system used to incorporate the nucleic acid encoding one or more guide RNAs into the cell’s genome is not a CRISPR/Cas system; this can prevent undesirable cell death in cells that retain a small amount of Cas
- the Cas enzyme or the sgRNAs are each expressed under the control of a different inducible promoter, thereby allowing temporal expression of each to prevent such interference.
- AAV adenovirus associated vector
- sgRNAs include lentiviral vectors, such as Epstein Barr, Human immunodeficiency virus (HIV), and hepatitis B virus (HBV).
- HIV Human immunodeficiency virus
- HBV hepatitis B virus
- sgRNA and endonuclease can be delivered in a separate vector as known in the art or as described herein.
- the agent inhibits WISP1 by RNA inhibition.
- Inhibitors of the expression of a given gene can be an inhibitory nucleic acid.
- the inhibitory nucleic acid is an inhibitory RNA (iRNA).
- iRNA inhibitory RNA
- the RNAi can be single stranded or double stranded.
- the iRNA can be siRNA, shRNA, endogenous microRNA (miRNA), or artificial miRNA.
- an iRNA as described herein effects inhibition of the expression and/or activity of a target, e.g. WISP1.
- the agent is siRNA that inhibits WISP1.
- the agent is shRNA that inhibits WISP1.
- siRNA, shRNA, or miRNA are designed using publically available design tools.
- siRNA, shRNA, or miRNA is commonly made using companies such as Dharmacon (Layfayette, CO) or Sigma Aldrich (St. Louis, MO).
- the iRNA can be a dsRNA.
- a dsRNA includes two RNA strands that are sufficiently complementary to hybridize to form a duplex structure under conditions in which the dsRNA will be used.
- One strand of a dsRNA (the antisense strand) includes a region of complementarity that is substantially complementary, and generally fully complementary, to a target sequence.
- the target sequence can be derived from the sequence of an mRNA formed during the expression of the target.
- the other strand (the sense strand) includes a region that is complementary to the antisense strand, such that the two strands hybridize and form a duplex structure when combined under suitable conditions
- RNA of an iRNA can be chemically modified to enhance stability or other beneficial characteristics.
- the nucleic acids featured in the invention may be synthesized and/or modified by methods well established in the art, such as those described in“Current protocols in nucleic acid chemistry,” Beaucage, S.L. et al. (Edrs.), John Wiley & Sons, Inc., New York, NY, USA, which is hereby incorporated herein by reference.
- the agent is miRNA that inhibits WISP1.
- microRNAs are small non-coding RNAs with an average length of 22 nucleotides. These molecules act by binding to complementary sequences within mRNA molecules, usually in the 3 ⁇ untranslated (3 ⁇ UTR) region, thereby promoting target mRNA degradation or inhibited mRNA translation.
- the interaction between microRNA and mRNAs is mediated by what is known as the“seed sequence”, a 6– 8-nucleotide region of the microRNA that directs sequence-specific binding to the mRNA through imperfect Watson– Crick base pairing. More than 900 microRNAs are known to be expressed in mammals.
- a miRNA can be expressed in a cell, e.g., as naked DNA.
- a miRNA can be encoded by a nucleic acid that is expressed in the cell, e.g., as naked DNA or can be encoded by a nucleic acid that is contained within a vector.
- the agent that downmodulates WISP1 is miRNA-15a.
- miRNA-15a is a non-coding RNA that regulates gene expression in a number of organs including the liver. miRNA-15a sequences are known for a number of species, e.g., human miRNA-15a, e.g., miRBase Accession number MI0000069, and mouse miRNA-15a, e.g., miRBase Accession number MI0000564.
- Human miRNA-15a comprises the sequence of SEQ ID NO: 8.
- miRNA-15a can refer to human miRNA-15a, including naturally occurring variants, molecules, and alleles thereof.
- miRNA-15a can be mouse miRNA-15a, having the sequence of SEQ ID NO: 10.
- the agent e.g., the miRNA-15A has a sequence corresponding to the sequence of SEQ ID NO: 8; or comprises the sequence of SEQ ID NO: 8; or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to the sequence of SEQ ID NO: 8.
- the agent e.g., the miRNA-15a has a sequence corresponding to the sequence of SEQ ID NO: 10; or comprises the sequence of SEQ ID NO: 10; or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to the sequence of SEQ ID NO: 10.
- the agent that downmodulates WISP1 is miRNA-412.
- miRNA-412 sequences are known for a number of species, e.g., human miRNA-412, e.g., miRBase Accession number MI0001464, and mouse miRNA-412, e.g., miRBase Accession number MI0001164.
- Human miRNA-412 comprises the sequence of SEQ ID NO: 9.
- miRNA- 412 can refer to human miRNA-15a, including naturally occurring variants, molecules, and alleles thereof.
- miRNA-15a can be mouse miRNA-412, having the sequence of SEQ ID NO: 11.
- the agent e.g., the miRNA-412 has a sequence corresponding to the sequence of SEQ ID NO: 9; or comprises the sequence of SEQ ID NO: 9; or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to the sequence of SEQ ID NO: 9.
- the agent e.g., the miRNA-412
- the agent may result in gene silencing of the target gene (e.g., WISP1), such as with an RNAi molecule (e.g. siRNA or miRNA).
- RNAi molecule e.g. siRNA or miRNA
- This entails a decrease in the mRNA level in a cell for a target by at least about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 99%, about 100% of the mRNA level found in the cell without the presence of the agent.
- the mRNA levels are decreased by at least about 70%, about 80%, about 90%, about 95%, about 99%, about 100%.
- siRNA, shRNA, or miRNA effective target e.g., WISP1 for its downregulation, for example by transfecting the siRNA, shRNA, or miRNA into cells and detecting the levels of a gene (e.g., WISP1) found within the cell via western-blotting or PCR-based assays.
- a gene e.g., WISP1
- the agent may be contained in and thus further include a vector.
- a vector useful for transferring exogenous genes into target mammalian cells are available.
- the vectors may be episomal, e.g. plasmids, virus-derived vectors such cytomegalovirus, adenovirus, etc., or may be integrated into the target cell genome, through homologous recombination or random integration, e.g. retrovirus-derived vectors such as MMLV, HIV-1, ALV, etc.
- retrovirus-derived vectors such as MMLV, HIV-1, ALV, etc.
- combinations of retroviruses and an appropriate packaging cell line may also find use, where the capsid proteins will be functional for infecting the target cells.
- the cells and virus will be incubated for at least about 24 hours in the culture medium.
- the cells are then allowed to grow in the culture medium for short intervals in some applications, e.g.24-73 hours, or for at least two weeks, and may be allowed to grow for five weeks or more, before analysis.
- Commonly used retroviral vectors are "defective", i.e. unable to produce viral proteins required for productive infection. Replication of the vector requires growth in the packaging cell line.
- vector refers to a nucleic acid construct designed for delivery to a host cell or for transfer between different host cells.
- a vector can be viral or non-viral.
- vector encompasses any genetic element that is capable of replication when associated with the proper control elements and that can transfer gene sequences to cells.
- a vector can include, but is not limited to, a cloning vector, an expression vector, a plasmid, phage, transposon, cosmid, artificial chromosome, virus, virion, etc.
- expression vector refers to a vector that directs expression of an RNA or polypeptide (e.g., a WISP1 inhibitor) from nucleic acid sequences contained therein linked to transcriptional regulatory sequences on the vector.
- the sequences expressed will often, but not necessarily, be heterologous to the cell.
- An expression vector may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, for example in human cells for expression and in a prokaryotic host for cloning and amplification.
- RNA transcribed from a gene and polypeptides obtained by translation of mRNA transcribed from a gene.
- gene means the nucleic acid sequence which is transcribed (DNA) to RNA in vitro or in vivo when operably linked to appropriate regulatory sequences.
- the gene may or may not include regions preceding and following the coding region, e.g.5’ untranslated (5’UTR) or “leader” sequences and 3’ UTR or “trailer” sequences, as well as intervening sequences (introns) between individual coding segments (exons).
- regions preceding and following the coding region e.g.5’ untranslated (5’UTR) or “leader” sequences and 3’ UTR or “trailer” sequences, as well as intervening sequences (introns) between individual coding segments (exons).
- Integrating vectors have their delivered RNA/DNA permanently incorporated into the host cell chromosomes. Non-integrating vectors remain episomal which means the nucleic acid contained therein is never integrated into the host cell chromosomes. Examples of integrating vectors include retroviral vectors, lentiviral vectors, hybrid adenoviral vectors, and herpes simplex viral vector.
- Non-integrative viral vectors eliminate the risks posed by integrative retroviruses, as they do not incorporate their genome into the host DNA.
- One example is the Epstein Barr oriP/Nuclear Antigen-1 (“EBNA1”) vector, which is capable of limited self-replication and known to function in mammalian cells. As containing two elements from Epstein-Barr virus, oriP and EBNA1, binding of the EBNA1 protein to the virus replicon region oriP maintains a relatively long-term episomal presence of plasmids in mammalian cells. This particular feature of the oriP/EBNA1 vector makes it ideal for generation of integration-free iPSCs.
- EBNA1 Epstein Barr oriP/Nuclear Antigen-1
- Non-integrative viral vector is adenoviral vector and the adeno-associated viral (AAV) vector.
- AAV adeno-associated viral
- Another non-integrative viral vector is RNA Sendai viral vector, which can produce protein without entering the nucleus of an infected cell.
- the F-deficient Sendai virus vector remains in the cytoplasm of infected cells for a few passages, but is diluted out quickly and completely lost after several passages (e.g., 10 passages).
- Minicircle vectors are circularized vectors in which the plasmid backbone has been released leaving only the eukaryotic promoter and cDNA(s) that are to be expressed.
- viral vector refers to a nucleic acid vector construct that includes at least one element of viral origin and has the capacity to be packaged into a viral vector particle.
- the viral vector can contain a nucleic acid encoding a polypeptide as described herein in place of non-essential viral genes.
- the vector and/or particle may be utilized for the purpose of transferring nucleic acids into cells either in vitro or in vivo. Numerous forms of viral vectors are known in the art.
- Engineered Hepatic Stellate Cells (HSCs) are known in the art.
- described herein is a method of generating a hepatic stellate cell, or population thereof, that expresses an agent that inhibits WISP1, comprising contacting the cell with any of the agents that inhibit WISP1 described herein, and culturing the cell for a sufficient time to allow for expression of the agent.
- the cell is a quiescent cell. Methods for identifying a quiescent cell are described herein above.
- the contacting comprises contacting the cell with an agent or a vector that encodes the agent.
- contacting can comprise, but is not limited to, transduction, nucleofection, electroporation, direct injection (e.g., into the HSC), and/or transfection.
- One skilled in the art can contact the cell with an agent described herein using techniques known in the art.
- the agent is a miRNA.
- the miRNA is miRNA-15a or miRNA412.
- the cell is cultured in Dulbecco’s Modified Eagle Medium (DMEM) supplemented with 20% (weight/volume) fetal bovine serum (FBS) and 1% (weight/volume) penicillin/streptomycin under standard culturing conditions.
- DMEM Modified Eagle Medium
- FBS fetal bovine serum
- penicillin/streptomycin 1% (weight/volume) penicillin/streptomycin under standard culturing conditions.
- the cell is cultured for at least 1 hour to allow for expression of the agent. In another embodiment, the cell is cultured for at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 36, 48, 60, 72, 96, 120, 144, or more hours to all for expression of the agent.
- One skilled in the art can determine if an agent is expressed in the cell following culturing using standard techniques in the art, for example, PCR-based assay to detect miRNA expression.
- the cell transiently expresses the agent.
- the expression of the agent in integrated into the genome of the cell e.g., such that the cell’s progeny expresses the agent.
- One aspect provides a cell line comprising HSCs expressing an agent that inhibits WISP1 generated using methods described herein.
- HSCs that express an agent that inhibits WISP1 can be in a pharmaceutically acceptable carrier, e.g., for administration to a subject in need of treatment, e.g., for liver disease.
- compositions comprising a population of HSCs expressing an agent that inhibits WISP1 generated using methods described herein and a pharmaceutically acceptable carrier.
- described herein is a composition comprising any of any of the agents described herein. In one aspect, described herein is a pharmaceutical composition comprising any of any of the agents described herein.
- described herein is a composition comprising an antibody or antibody reagent that inhibits WISP1.
- a pharmaceutical composition comprising an antibody or antibody reagent that inhibits WISP1.
- a composition or pharmaceutical composition described herein can comprise at least 2, 3, 4, 5, or more agents described herein.
- a composition can comprise an siRNA that inhibits WISP1 and an anti-WISP1 antibody reagent.
- the composition can comprise two anti-WISP1 antibody-reagents.
- the composition is formulated for the treatment or prevention of liver disease.
- administration of agents that inhibit WISP1 (e.g., antibodies, antibody reagents, or WISP1-binding fragments thereof) described herein can include formulation into pharmaceutical compositions or pharmaceutical formulations for parenteral administration, e.g., intravenous; mucosal, e.g., intranasal; ocular, or other mode of administration.
- the agents described herein can be administered along with any pharmaceutically acceptable carrier compound, material, or composition which results in an effective treatment in the subject.
- a pharmaceutical formulation for use in the methods described herein can contain an antibody or antigen-binding fragment thereof as described herein in combination with one or more pharmaceutically acceptable ingredients.
- phrases“pharmaceutically acceptable” refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- pharmaceutically acceptable carrier means a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent, media,
- encapsulating material e.g., lubricant, talc magnesium, calcium or zinc stearate, or steric acid
- solvent encapsulating material involved in maintaining the stability, solubility, or activity of, an antibody or antigen- binding fragment thereof.
- Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
- excipient e.g., lubricant, talc magnesium, calcium or zinc stearate, or steric acid
- solvent encapsulating material involved in maintaining the stability, solubility, or activity of, an antibody or antigen- binding fragment thereof.
- carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
- excipient “carrier”, “pharmaceutically acceptable carrier” or the like are used interchangeably herein.
- Therapeutic formulations of the agents or inhibitors of WISP1 described herein can be prepared for storage by mixing the antibodies or antigen-binding fragments having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins;
- hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN ⁇ , PLURONICS ⁇ or polyethylene glycol (PEG).
- Exemplary lyophilized antibody formulations are described in WO 97/04801, expressly incorporated herein by reference.
- the formulations comprising the compositions described herein contain a pharmaceutically acceptable salt, typically, e.g., sodium chloride, and preferably at about physiological concentrations.
- the formulations of the invention can contain a pharmaceutically acceptable preservative.
- the preservative concentration ranges from 0.1 to 2.0%, typically v/v.
- Suitable preservatives include those known in the pharmaceutical arts. Benzyl alcohol, phenol, m-cresol, methylparaben, and propylparaben are examples of preservatives.
- the formulations of the invention can include a pharmaceutically acceptable surfactant at a concentration of 0.005 to 0.02%.
- compositions comprising agents (e.g., antibodies, antibody reagents, and WISP1-binding fragments thereof) described herein can also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- the composition can comprise a cytotoxic agent, cytokine, or growth inhibitory agent, for example.
- cytotoxic agent e.g., IL-12
- cytokine e.g., IL-12
- growth inhibitory agent for example.
- Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
- compositions comprising agents described herein can also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial
- the pharmaceutical composition further comprises a lipid vehicle.
- lipid vehicles include, but are not limited to, liposomes, micelles, exosomes, lipid emulsions, and lipid-drug complex.
- the pharmaceutical composition further comprises a particle or polymer-based vehicle.
- exemplary particle or polymer-based vehicles include, but are not limited to, nanoparticles, microparticles, polymer microspheres, or polymer-drug conjugates.
- sustained-release preparations can be used.
- Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibodies or antigen-binding fragments in which the matrices are in the form of shaped articles, e.g., films, or microcapsule.
- sustained- release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat.
- copolymers of L-glutamic acid and y ethyl-L-glutamate non-degradable ethylene- vinyl acetate
- degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT ⁇ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate)
- poly-D-(-)-3-hydroxybutyric acid While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
- encapsulated antibodies When encapsulated antibodies remain in the body for a long time, they can denature or aggregate as a result of exposure to moisture at 37oC, resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S--S bond formation through thio-disulfide interchange, stabilization can be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
- the therapeutic formulations to be used for in vivo administration, such as parenteral administration, in the methods described herein can be sterile, which is readily accomplished by filtration through sterile filtration membranes, or other methods known to those of skill in the art. Administration
- the methods described herein relate to treating a subject having or diagnosed as having a liver disease comprising administering an agent that inhibits WISP1 as described herein.
- Subjects having a liver disease can be identified by a physician using current methods of diagnosing a condition. Symptoms and/or complications of a liver disease, which characterize this disease and aid in diagnosis are well known in the art and include but are not limited to, fatigue, weight loss, pain, yellowing of skin and/or eyes, and dark urine. Tests that may aid in a diagnosis of, e.g. a liver disease, include but are not limited example blood tests, non-invasive imaging, and/or tissue biopsy. A family history of a liver disease will also aid in determining if a subject is likely to have the condition or in making a diagnosis of a liver disease.
- the agents and compositions described herein can be administered to a subject having or diagnosed as having a liver disease.
- the methods described herein comprise administering an effective amount of an agent to a subject in order to alleviate at least one symptom of the liver disease.
- "alleviating at least one symptom of the liver disease” is ameliorating any condition or symptom associated with the liver disease (e.g., fatigue, weight loss, pain, yellowing of skin and/or eyes, or dark urine). As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99% or more as measured by any standard technique.
- the agent is administered systemically or locally (e.g., to the liver). In one embodiment, the agent is administered intravenously. In one embodiment, the agent is administered continuously, in intervals, or sporadically.
- the route of administration of the agent will be optimized for the type of agent being delivered (e.g., a miRNA, a cell, or an RNAi), and can be determined by a skilled practitioner.
- agents and pharmaceutical compositions described herein can be administered to a subject in need thereof by any appropriate route which results in an effective treatment in the subject.
- the terms“administering,” and“introducing” are used interchangeably and refer to the placement of an agent or pharmaceutical composition described herein (e.g., an antibody, antibody reagent, or WISP1-binding fragment thereof) into a subject by a method or route which results in at least partial localization of such agents at a desired site, such as a site of infection or cancer, such that a desired effect(s) is produced.
- An agent or pharmaceutical composition can be administered to a subject by any mode of administration that delivers the agent systemically or to a desired surface or target, and can include, but is not limited to, injection, infusion, instillation, and inhalation administration.
- oral administration forms are also contemplated.
- “Injection” includes, without limitation, intravenous, intramuscular, intra-arterial, intrathecal, intraventricular, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, sub capsular, subarachnoid, intraspinal, intracerebro spinal, and intrasternal injection and infusion.
- the agents are formulated, dosed, and administered in a fashion consistent with good medical practice.
- Factors for consideration in this context include the particular disorder being treated, the particular subject being treated, the clinical condition of the individual subject, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
- the "therapeutically effective amount" of the agents to be administered are governed by such considerations, and refers to the minimum amount necessary to ameliorate, treat, or stabilize, the cancer; to increase the time until progression (duration of progression free survival) or to treat or prevent the occurrence or recurrence of a liver disease.
- the agents are optionally formulated, in some embodiments, with one or more additional therapeutic agents currently used to prevent or treat the infection, for example.
- the effective amount of such other agents depends on the amount of agent (e.g., antibodies and WISP1-binding fragments thereof) present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as used herein before or about from 1 to 99% of the heretofore employed dosages.
- an agent e.g., an antibody, antibody reagent, or WISP1-binding fragment thereof
- the agent is suitably administered to the subject at one time or over a series of treatments.
- the agent and the one or more additional therapeutic agents described herein are administered in a therapeutically effective or synergistic amount.
- a "unit dosage form” refers to a dosage for suitable one administration.
- a unit dosage form can be an amount of therapeutic disposed in a delivery device, e.g., a syringe or intravenous drip bag.
- a unit dosage form is administered in a single administration. In another, embodiment more than one unit dosage form can be administered simultaneously.
- the dosage of the agent as described herein can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to administer further cells, discontinue treatment, resume treatment, or make other alterations to the treatment regimen.
- the dosage should not be so large as to cause adverse side effects, such as cytokine release syndrome.
- the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art.
- the dosage can also be adjusted by the individual physician in the event of any complication.
- the dosage ranges for the therapeutic agents depend upon the potency, and encompass amounts large enough to produce the desired effect.
- the dosage should not be so large as to cause unacceptable adverse side effects.
- the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art.
- the dosage can also be adjusted by the individual physician in the event of any complication.
- the dosage ranges from 0.001 mg/kg body weight to 100 mg/kg body weight.
- the dose range is from 5 mg/kg body weight to 100 mg/kg body weight.
- the dose range can be titrated to maintain serum levels between 1 mg/mL and 1000 mg/mL.
- subjects can be administered a therapeutic amount, such as, e.g., 0.1 mg/kg, 0.5 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 2.5 mg/kg, 5 mg/kg, 7.5 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 40 mg/kg, 50 mg/kg, or more.
- a therapeutic amount such as, e.g., 0.1 mg/kg, 0.5 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 2.5 mg/kg, 5 mg/kg, 7.5 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 40 mg/kg, 50 mg/kg, or more.
- a therapeutic amount such as, e.g., 0.1 mg/kg, 0.5 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 2.5 mg/kg, 5 mg/kg, 7.5 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/
- the agent or compositions described herein is used as a monotherapy.
- the agents described herein can be used in combination with other known agents and therapies for a liver disease.
- Administered "in combination,” as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder (a liver disease) and before the disorder has been cured or eliminated or treatment has ceased for other reasons.
- the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as “simultaneous" or “concurrent delivery.”
- the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration.
- the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment.
- delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other.
- the effect of the two treatments can be partially additive, wholly additive, or greater than additive.
- the delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
- the agents described herein and the at least one additional therapy can be administered simultaneously, in the same or in separate compositions, or sequentially.
- the agent described herein can be administered first, and the additional agent can be administered second, or the order of administration can be reversed.
- the agent and/or other therapeutic agents, procedures or modalities can be administered during periods of active disorder, or during a period of remission or less active disease.
- the agent can be administered before another treatment, concurrently with the treatment, post-treatment, or during remission of the disorder.
- Therapeutics currently used to treat a liver disease include, but are not limited to, ursodeoxycholic acid (UDCA, also known as ursodiol, INN, NAN, AAN, or USAN), cholestyramine, stanozolol, naltrexone, rifampicin, pioglitazone, metformin, rosiglitazone, lobeglitazone, retinol ester, vitamin A, liver dialysis, or liver transplant or any other treatment for liver disease known in the art.
- the agent or compositions described herein described herein are not administered with another therapy.
- the agent or compositions described herein described herein are not administered with ursodeoxycholic acid (UDCA, also known as ursodiol, INN, NAN, AAN, or USAN), cholestyramine, stanozolol, naltrexone, rifampicin, pioglitazone, metformin, rosiglitazone, lobeglitazone, retinol ester, vitamin A, liver dialysis, or liver transplant or any other treatment for liver disease known in the art.
- UDCA ursodeoxycholic acid
- the agent or composition and the additional agent can be administered in an amount or dose that is higher, lower or the same as the amount or dosage of each agent used individually, e.g., as a monotherapy.
- the administered amount or dosage of the agent, the additional agent (e.g., second or third agent), or all is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50%) than the amount or dosage of each agent used individually.
- the amount or dosage of agent, the additional agent (e.g., second or third agent), or all, that results in a desired effect is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50% lower) than the amount or dosage of each agent individually required to achieve the same therapeutic effect.
- Parenteral dosage forms of an agents described herein can be administered to a subject by various routes, including, but not limited to, subcutaneous, intravenous (including bolus injection), intramuscular, and intraarterial. Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, parenteral dosage forms are preferably sterile or capable of being sterilized prior to administration to a patient. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, controlled-release parenteral dosage forms, and emulsions.
- phrases“parenteral administration” and“administered parenterally” as used herein, refer to modes of administration other than enteral and topical administration, usually by injection.
- the phrases“systemic administration,” “administered systemically”,“peripheral administration” and“administered peripherally” as used herein refer to the administration of a therapeutic agent other than directly into a target site, tissue, or organ, such as a tumor site, such that it enters the subject’s circulatory system and, thus, is subject to metabolism and other like processes.
- the agent is administered locally, e.g., by direct injections, when the disorder permits, and the injections can be repeated periodically.
- Suitable vehicles that can be used to provide parenteral dosage forms of the disclosure are well known to those skilled in the art. Examples include, without limitation: sterile water; water for injection USP; saline solution; glucose solution; aqueous vehicles such as but not limited to, sodium chloride injection, Ringer's injection, dextrose Injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water-miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
- the duration of a therapy using the methods described herein will continue for as long as medically indicated or until a desired therapeutic effect (e.g., those described herein) is achieved.
- the administration of antibody or antigen-binding fragment described herein is continued for 1 month, 2 months, 4 months, 6 months, 8 months, 10 months, 1 year, 2 years, 3 years, 4 years, 5 years, 10 years, 20 years, or for a period of years up to the lifetime of the subject.
- Controlled and Delayed Release Dosage Forms [00272]
- an agent or composition is administered to a subject by controlled- or delayed-release means.
- the use of an optimally designed controlled-release preparation in medical treatment is characterized by a minimum of drug substance being employed to cure or control the condition in a minimum amount of time.
- Advantages of controlled-release formulations include: 1) extended activity of the drug; 2) reduced dosage frequency; 3) increased patient compliance; 4) usage of less total drug; 5) reduction in local or systemic side effects; 6) minimization of drug accumulation; 7) reduction in blood level fluctuations; 8) improvement in efficacy of treatment; 9) reduction of potentiation or loss of drug activity; and 10) improvement in speed of control of diseases or conditions. (Kim, Cherng-ju, Controlled Release Dosage Form Design, 2 (Technomic Publishing, Lancaster, Pa.: 2000)).
- Controlled-release formulations can be used to control a compound of formula (I)'s onset of action, duration of action, plasma levels within the therapeutic window, and peak blood levels.
- controlled- or extended-release dosage forms or formulations can be used to ensure that the maximum effectiveness of an agent is achieved while minimizing potential adverse effects and safety concerns, which can occur both from under-dosing a drug (i.e., going below the minimum therapeutic levels) as well as exceeding the toxicity level for the drug.
- a variety of known controlled- or extended-release dosage forms, formulations, and devices can be adapted for use with any agent described herein. Examples include, but are not limited to, those described in U.S. Pat. Nos.: 3,845,770; 3,916,899; 3,536,809; 3,598,123; 4,008,719; 5674,533; 5,059,595; 5,591 ,767; 5,120,548; 5,073,543;
- dosage forms can be used to provide slow or controlled-release of one or more active ingredients using, for example, hydroxypropylmethyl cellulose, other polymer matrices, gels, permeable membranes, osmotic systems (such as OROS® (Alza Corporation, Mountain View, Calif. USA)), multilayer coatings, microparticles, liposomes, or microspheres or a combination thereof to provide the desired release profile in varying proportions.
- ion exchange materials can be used to prepare immobilized, adsorbed salt forms of the disclosed compounds and thus effect controlled delivery of the drug. Examples of specific anion exchangers include, but are not limited to, DUOLITE® A568 and DUOLITE® AP143 (Rohm&Haas, Spring House, Pa. USA). Efficacy
- the efficacy of an agents described herein, e.g., for the treatment of a liver disease can be determined by the skilled practitioner. However, a treatment is considered“effective treatment," as the term is used herein, if one or more of the signs or symptoms of the liver disease are altered in a beneficial manner, other clinically accepted symptoms are improved, or even ameliorated, or a desired response is induced e.g., by at least 10% following treatment according to the methods described herein. Efficacy can be assessed, for example, by measuring a marker, indicator, symptom, and/or the incidence of a condition treated according to the methods described herein or any other measurable parameter appropriate, e.g., fatigue, pain, weight loss, or dark urine. Efficacy can also be measured by a failure of an individual to worsen as assessed by hospitalization, or need for medical interventions (i.e., progression of the symptoms). Methods of measuring these indicators are known to those of skill in the art and/or are described herein.
- Efficacy can be assessed in animal models of a condition described herein, for example, a mouse model or an appropriate animal model of liver disease, as the case may be.
- efficacy of treatment is evidenced when a statistically significant change in a marker is observed, e.g., jaundice, fatigue, nausea, vomiting, urine color, abdominal pain.
- the term“effective amount” as used herein refers to the amount of an agent or composition described herein can be administered to a subject having or diagnosed as having a liver disease needed to alleviate at least one or more symptom of the disease.
- the term "therapeutically effective amount” therefore refers to an amount of an agent or composition that is sufficient to provide a particular anti-liver disease effect when administered to a typical subject.
- An effective amount as used herein, in various contexts, would also include an amount of an agent sufficient to delay the development of a symptom of the disease, alter the course of a symptom of the disease (e.g., slowing the progression of the liver disease), or reverse a symptom of the disease (e.g., correcting or halting symptoms of the liver disease).
- an appropriate“effective amount” can be determined by one of ordinary skill in the art using only routine experimentation.
- the agent or composition is administered continuously (e.g., at constant levels over a period of time). Continuous administration of an agent can be achieved, e.g., by epidermal patches, continuous release formulations, or on-body injectors.
- the agent or composition is administered in intervals (e.g., at various levels over a given period of time).
- Effective amounts, toxicity, and therapeutic efficacy can be evaluated by standard pharmaceutical procedures in cell cultures or experimental animals.
- the dosage can vary depending upon the dosage form employed and the route of administration utilized.
- the dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio LD50/ED50.
- Compositions and methods that exhibit large therapeutic indices are preferred.
- a therapeutically effective dose can be estimated initially from cell culture assays.
- a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the agent, which achieves a half-maximal inhibition of symptoms) as determined in cell culture, or in an appropriate animal model.
- Levels in plasma can be measured, for example, by high performance liquid chromatography.
- the effects of any particular dosage can be monitored by a suitable bioassay, e.g., measuring liver function, or blood work, among others.
- the dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the
- a method for treating or preventing a liver disease comprising: administering to a subject in need thereof an antibody or antibody reagent that inhibits WISP1.
- the liver disease is selected from the group consisting of: primary biliary cholangitis, autoimmune hepatitis, alpha 1 antitrypsin deficiency, non-alcoholic steatohepatitis, and scleroderma.
- WISP1 is a splice variant selected from the group consisting of: WISP1v, WISP1vx, and WISP1delta exon 3-4.
- the antibody or antibody reagent that inhibits WISP1 is selected from the group consisting of: mab1680, AF1680, SAB2501114, ab60114, and ab65943.
- the antibody or antibody reagent amino acid sequence comprises at least 70% homology to any one of SEQ ID NOs: 1-4, 6, or 12-120.
- the target cell is a hepatic stellate cell, a fibroblast, or a myofibroblast.
- a composition comprising an antibody or antibody reagent that inhibits WISP1 and a pharmaceutically acceptable carrier.
- composition of any preceding paragraph, wherein the antibody or antibody reagent that inhibits WISP1 is selected from the group consisting of: mab1680, AF1680, SAB2501114, ab60114, and ab65943.
- composition of any preceding paragraph wherein the antibody or antibody reagent amino acid sequence comprises at least 70% homology to any one of SEQ ID NOs: 1-4, 6, or 12-120. 17. The composition of any preceding paragraph, wherein the composition is formulated for treating or preventing a liver disease.
- a method of treating a liver disease in a subject comprising:
- liver disease is primary biliary cholangitis
- autoimmune hepatitis erypha 1 antitrypsin deficiency
- non-alcoholic steatohepatitis erypha 1 antitrypsin deficiency
- scleroderma erypha 1 antitrypsin deficiency
- non-alcoholic steatohepatitis erypha 1 antitrypsin deficiency
- scleroderma erypha 1 antitrypsin deficiency
- non-alcoholic steatohepatitis scleroderma. 21.
- the biological sample is a blood sample, tissue, buffy coat, serum, or tissue.
- the antibody or antibody reagent that inhibits WISP1 is selected from the group consisting of: mab1680, AF1680, SAB2501114, ab60114, and ab65943.
- the antibody or antibody reagent amino acid sequence comprises at least 70% homology to any one of SEQ ID NOs: 1-4, 6, or 12-120.
- a method for treating or preventing a liver disease comprising: administering to a subject in need thereof an agent that inhibits WISP1.
- liver disease is selected from the group consisting of: primary biliary cholangitis, autoimmune hepatitis, alpha 1 antitrypsin deficiency, non-alcoholic steatohepatitis, and scleroderma.
- WISP1 is a splice variant selected from the group consisting of: WISP1v, WISP1vx, and WISP1delta exon 3-4.
- the agent that inhibits WISP1 is selected from the group consisting of: a small molecule, an antibody or antibody reagent, a peptide, a genome editing system, a viral vector, a miRNA, and a siRNA.
- the microRNA is microRNA15a or miRNA412.
- the antibody or antibody reagent that inhibits WISP1 is selected from the group consisting of: mab1680, AF1680, SAB2501114, ab60114, and ab65943.
- the antibody or antibody reagent amino acid sequence comprises at least 70% homology to any one of SEQ ID NOs: 1-4, 6, or 12-120.
- a composition comprising an agent that inhibits WISP1 and a pharmaceutically acceptable carrier.
- the agent that inhibits WISP1 is selected from the group consisting of: a small molecule, an antibody or antibody reagent, a peptide, a genome editing system, a viral vector, a miRNA, and a siRNA.
- a method of treating a liver disease in a subject comprising:
- liver disease is primary biliary cholangitis
- autoimmune hepatitis autoimmune hepatitis, alpha 1 antitrypsin deficiency, non-alcoholic steatohepatitis, or scleroderma. 42. The method of any preceding paragraph, wherein the biological sample is a blood sample, tissue, buffy coat, serum, or tissue.
- the agent that inhibits WISP1 is selected from the group consisting of: a small molecule, an antibody or antibody reagent, a peptide, a genome editing system, a viral vector, a miRNA, and a siRNA.
- microRNA is microRNA15a or miRNA412.
- the antibody or antibody reagent that inhibits WISP1 is selected from the group consisting of: mab1680, AF1680, SAB2501114, ab60114, and ab65943.
- the antibody or antibody reagent amino acid sequence comprises at least 70% homology to any one of SEQ ID NOs: 1-4, 6, or 12-120.
- the contacting comprises contacting the cell with an agent or a vector that encodes the agent.
- contacting comprises transduction, nucleofection, electroporation, direct injection, and/or transfection.
- the agent that inhibits WISP1 is selected from the group consisting of: a small molecule, an antibody or antibody reagent, a peptide, a genome editing system, a viral vector, a miRNA, and a siRNA.
- microRNA is microRNA15a or miRNA412.
- the antibody or antibody reagent that inhibits WISP1 is selected from the group consisting of: mab1680, AF1680, SAB2501114, ab60114, and ab65943.
- the antibody or antibody reagent amino acid sequence comprises at least 70% homology to any one of SEQ ID NOs: 1-4, 6, or 12-120.
- a cell line comprising hepatic stellate cells generated by the method of any of paragraphs 46-53.
- a pharmaceutical composition comprising a hepatic stellate cell, or population thereof, generated by the method of any preceding paragraph, and a pharmaceutically acceptable carrier.
- a method of treating or preventing a liver disease comprising: administering to a subject in need thereof the cells generated by the method of any preceding paragraph, a cell of any preceding paragraph, or the pharmaceutical composition of any preceding paragraph.
- a method of reducing fibrosis in a subject comprising: administering to a subject in need thereof the cells generated by the method any preceding paragraph, a cell of any preceding paragraph, or the pharmaceutical composition of any preceding paragraph.
- a method of treating a liver disease in a subject comprising:
- a method of treating a liver disease in a subject comprising:
- microRNAs miR-15a and miR-412 that independently induce quiescence in activated hepatic stellate cells (HSCs), the cell type that plays a central role in fibrotic progression of the liver.
- HSCs activated hepatic stellate cells
- miR-15a directly targets WISP1 to repress its pro-fibrotic function in activated HSCs.
- WISP1 hepatic stellate cells
- the microRNAs can be a useful therapy to control progressive hepatic fibrosis in PBC (Fig.1).
- miR-15a and miR-412 induce quiescence in HSCs which can subsequently elucidate the function of miR-15a's known target WISP1.
- Three different miRNA delivery systems can be tested: 1) cell therapy using quiescent-like HSCs constitutively expressing miR-15a or miR-412, 2) injecting a lentivirus expressing miR-15a or miR-412 into tail vein, and 3) injecting chemically modified mimics of miR-15a or miR-412 packaged in a lipid based carrier into tail vein. Controls and treatment mice can be used to analyze the outcome.
- PBC Primary biliary cholangitis
- primary biliary cirrhosis is an insidious liver disease that leads to progressive destruction of intrahepatic bile ducts, cholestasis, periportal inflammation, and eventually biliary fibrosis that ends as cirrhotic end-stage liver disease. It is an autoimmune disorder with unclear pathogenesis although both genetic and environmental factors likely interact to manifest the disease.
- PBC affects women far more than men with 9:1 female to male disease ratio. The age-adjusted incidence of PBC in the United States per 1 million person-years for women is 45, and 7 for men, while the prevalence per 1 million persons is 654 for women and 121 for men [1].
- a hydrophilic bile salt ursodeoxycholic acid (UDCA) is still the only drug that has demonstrated survival benefit for PBC. It has been shown to delay disease progression evidenced by improved histology and biochemical parameters. Although the exact mechanism of its action is unclear, it seems to protect cholangiocytes against toxic bile salts. Unfortunately, 30%-40% of UDCA treated individuals still experience disease progression in the setting of suboptimal response [2]. To fill this treatment gap, many different agents are under clinical trials, but some of the prominently tested drugs such as obeticholic acid still has significant side effects and lacks evidence for survival benefit [3].
- HSCs hepatic stellate cells
- MiRNAs are short, non-coding genes that are usually 22 nucleotides in length and are involved in all biologic and pathologic processes. They downregulate specific coding genes by imperfectly base-pairing with complementary sequences within their mRNA targets to induce degradation or translational inhibition. Each miRNA can regulate many different coding genes while each target gene can be regulated by many different miRNAs, constituting a complex layer of gene regulatory network [9]. The experiments described herein have shown that miRNAs are essential for cellular proliferation and reprogramming [10-12].
- the unbiased functional screen described herein capitalized on the natural tendency of HSCs to become activated when they are grown on plastic surface. As HSCs become activated, they lose lipid droplets present abundantly in quiescent HSCs. Utilizing this useful phenotypic dichotomy, miRNAs that force activated HSCs to become more quiescent-like were searched by tracking the level of lipid droplets that re-form in the cytoplasm. Since miRNAs are known to simultaneously target multiple coding genes to influence an entire cellular program such as organ development, carcinogenesis, or cellular reprogramming [17], it was contemplated that even a single miRNA can induce
- lipid droplets were retinoid positive evidenced by fluorescence under ultraviolet light, consistent with those in quiescent HSCs (data not shown).
- the overall size of the transfected HSCs decreased by 10-100 fold, becoming more quiescent-like (Fig.4).
- forced expression of miR-15a or miR-412 downregulated two of the most important gene markers of activation, alpha smooth muscle actin (Acta2) and alpha-1 type I collagen (Col1 a1) (Fig.4).
- reverted HSCs were able to decrease pro-inflammatory cytokine expression from cocultured human hepatocellular carcinoma cell lines HepG2 and Huh7 (Fig.6).
- endogenous miR-15a and miR-412 had decreased expression levels in activated HSCs compared to quiescent HSCs, although not significantly for miR-15a (Fig.7) and miR-41 seems to force reversion activated HSCs toward quienscence in culture conditions that promote activation.
- HSCs that were chosen to be injected have become quiescent-like ex vivo by constitutively expressing miR-15a or miR-412.
- Reprogrammed HSCs were injected once during the third week of four-week CCl 4 challenge.
- Injected HSCs grafted on to the liver confirmed by visualizing within the liver cells emitting the GFP signal, a piggyBac vector expressing miRNA was inserted [18] (Fig.8). More importantly, mice treated with quiescent-like HSCs had histology showing decreased ballooning, apoptosis, inflammation, and fibrosis in the liver (Fig.8) and lower hepatic collagen expression (Fig.9).
- WISP1 is a key target gene for accomplishing some of the miR-15a actions in HSCs. Testing miR-15a and miR-412 in mouse models of cholangitis.
- miRNAs can be delivered systemically using a viral vector or mimics instead of cell therapy.
- the efficacy can be assessed by performing PCR of profibrotic genes in the liver, histology including H&E and Sirius Red stain, hepatic hydroxyproline assay, and measuring plasma ALT and alkaline phosphatase.
- mice challenged with BDL for 21 days normally develop significant fibrosis.
- Reprogrammed HSCs can be injected on days 7 and 14 during the 21-day course of BDL challenge. All mice are sacrificed on day 21.
- Mice challenged with DDC for 28 days normally develop significant fibrosis.
- Reprogrammed HSCs can be injected on days 14 and 21 during the 28 day course of DDC challenge. All mice are sacrificed on day 28.
- the viability of injecting more stable, chemically modified miRNA mimics (Exiqon and Invitrogen) packaged in a lipid based carrier (MaxSuppressorTM by B100 Scientific) can be tested [24, 25].
- Carriers can be injected containing either miR-15a or miR-412 into the tail vein on days 7 and 14 during the 21 day course of BDL challenge. All mice are sacrificed on day 21. Carriers can be injected containing either miR-15a or miR-412 on days 14 and 21 during the 28 day course of DDC challenge. All mice are sacrificed on day 28.
- mice Since it is difficult to induce hepatic fibrosis in female mice, male mice are more useful for the in vivo treatment studies described herein. A power calculation shows that 8 mice can be used for each group to detect 50% decrease in alpha-1 type I collagen level with 20% standard deviation in the measurement at a p value of 0.01 and 90% power.
- One of the biggest challenges of treating HSCs with miRNAs is developing a delivery system that specifically targets this cell type to minimize off-target effects.
- the delivery system can be optimized for improved specificity. For example, two promising HSC delivery systems that were recently developed are a p75 neurotrophin receptor peptide (p75NTRp)-tagged adenovirus and AAV6 vectors [26, 27].
- WISP1 is a member of the Ccn family of matricellular proteins that include Cyr61 (Ccn1), Ctgf (Ccn2), Nov (Ccn3), WISP1 (Ccn4), Wisp2 (Ccn5), and Wisp3 (Ccn6).
- Ctgf is already established as an important pro-fibrotic factor in the liver [28].
- WISP1 was found to be upregulated in human idiopathic pulmonary fibrosis, and treating bleomycin challenged mice with neutralizing WISP1 antibody caused attenuation of lung fibrosis [29]. Moreover, a small animal study showed that blocking WISP1 ameliorates CCl 4 induced liver fibrosis [30]. However, the role of WISP1 in the liver has not been researched in detail, especially in the context of PBC.
- WISP1 is a direct target of miR-15a, its influence on HSC activation status and its role in PBC pathogenesis is unclear.
- a WISP1-null mouse line has been generated to demonstrate WISP1's role in bone formation, but its function in the liver was not studied [31]. These mice are fertile and do not have an overt hepatic phenotype. Their mutant allele is preserved in frozen sperm and embryos at an MMRRC facility in University of California at Davis who guarantees successful mutant mouse derivation.
- the phenotype can be assessed by the overall severity of hepatic pathology.
- WISP1-null mice can be challenged with BDL and DDC. The resulting liver damage sustained by WISP1-null mice can be compared with that of wildtype mice. Given the known profibrotic role of Wispl in other organs including the lung, WISP1-null mice are expected to have a decreased hepatic fibrosis and perhaps even decreased inflammation.
- the liver phenotype can be assessed by performing PCR of profibrotic genes in the liver, histology including H&E and Sirius Red stain, hepatic hydroxyproline assay, and measuring plasma ALT and alkaline phosphatase.
- mice Male wildtype and WISP1- null mice can be challenged with BDL. They can be sacrificed on day 21. Male wildtype and WISP1-null mice can be challenged with DDC. They can be sacrificed on day 28.
- HSCs can then be isolated from mice challenged with 21 days of BDL and 28 days of DDC. These HSCs can be co-cultured with healthy hepatocytes to determine whether pro-inflammatory mediators are induced. The results can be compared to those of wildtype HSCs that underwent the same challenge.
- mice challenged with BDL for 21 days normally develop significant fibrosis.
- the treatment group can receive on days 7 and 14 the commercially available WISP1 antibody previously used for treating bleomycin-induced lung fibrosis (R&D Systems) [29].
- the control group can receive IgG. All mice can be sacrificed on day 21.
- Mice challenged with DDC for 28 days normally develop significant fibrosis.
- WISP1 blocking antibody can be injected on days 14 and 21 during the 28 day course of DDC challenge. All mice can be sacrificed on day 28.
- WISP1 is a pro-inflammatory and pro-fibrotic mediator that can be neutralized with an antibody to decrease the level of inflammation and fibrosis in vivo. Therefore, it is contemplated that blocking WISP1 can also ameliorate biliary fibrosis. Therefore, by analyzing the conditioned media of activated HSCs, secreted paracrine or autocrine mediators can be identified. More detailed analysis of the activated HSC conditioned media can be analyzed through mass spectrometry to identify other mediators that are drug targets.
- MicroRNAs are indispensable for reprogramming mouse embryonic fibroblasts into induced stem cell-like cells.
- Non-alcoholic fatty liver disease can become the most common cause of end-stage liver disease, hepatic transplant, and hepatocellular carcinoma in the developed world in the next 5-10 years.
- NAFLD Non-alcoholic fatty liver disease
- reducing risk factors that can lead to NAFLD is the main mode of management as no FDA approved drug exists.
- developing effective therapies for NAFLD is of utmost importance.
- HSCs Activated hepatic stellate cells
- NAFLD non-alcoholic fatty liver disease
- NAFLD non- alcoholic steatohepatitis
- HSCs hepatic stellate cells
- HSCs Although the importance of HSCs in hepatic fibrosis is well established, there is still much that is unknown about this cell type. For example, are there genes that can reverse activated HSCs back toward quiescence? Are HSCs also involved in early NAFLD, promoting steatosis and inflammation, not just fibrosis? If HSCs contribute to steatohepatitis or fibrosis, what are the important mediators involved in these processes? Answering these questions and gaining better biological insight can lead to novel ideas for managing NAFLD.
- miRNAs microRNAs
- HSCs microRNAs
- a functional screen and assays have been developed to systematically identify miRNAs that force activated HSCs back toward quiescence, and through this effort, identified miR-15a and miR-412. Promoting HSC quiescence through these miRNAs or their downstream targets can prevent fibrotic progression in NAFLD.
- the second major innovation comes in the form of a novel cell therapy using quiescent-like HSCs.
- the initial screen and follow-up in vitro assays were done using transient transfection with mimics of miR-15a or miR- 412, when a piggyBac transposon vector was then used that can integrate into the genome to constitutively express either miRNA in HSCs [17], they seem to transdifferentiate permanently toward a quiescent-like state accompanied by dramatic changes in morphology, expression, and function.
- Other groups have attempted cell therapy in liver cirrhosis using mesenchymal stem cells or macrophages [18], but this is the first time engineered HSCs were used as a therapy for hepatic fibrosis or NASH.
- NASH-HSCs from choline deficient, L-amino acid defined, high fat diet (CDAHFD model (Fig.13) induced steatosis and stimulated expression of pro-inflammatory cytokines in cocultured hepatocytes harvested from healthy mice (Fig.14, 15) [19].
- CDAHFD model Fig.13
- This signaling does not require cell-cell contact because the two cell types in coculture can be separated by a transwell, implying secretion of soluble factor(s) by HSCs.
- HSCs Hepatic stellate cells
- miRNAs miR-15a and miR-412 were chose for further investigation based on the existence of human orthologues and the ability to re-form lipid droplets in both mouse and human HSCs (Fig.3).
- the newly formed lipid droplets were retinoid positive evidenced by fluorescence under ultraviolet light, consistent with those in quiescent HSCs (Fig.17).
- the overall size of the transfected HSCs decreased by 10-100 fold, becoming more quiescent-like (Fig.4).
- forced expression of miR-15a or miR-412 downregulated two of the most important gene markers of activation, alpha smooth muscle actin (Acta2) and alpha-1 type (Col1a1) (Fig.4).
- MiR-15a and miR-412 have not been studied in the context of hepatic stellate cell.
- miR-15 family was found to inhibit Tgf-beta pathway in the heart to potentially attenuate fibrosis [26], and it is also known as a critical tumor suppressor in chronic lymphocytic leukemia [27, 28].
- miR-412 no specific literature exists for miR-412, and thereby its function is completely unknown.
- MiRNAs generally, are short, non-coding genes that are usually 22 nucleotides in length and are involved in all biologic and pathologic processes. They downregulate target coding genes by imperfectly base-pairing with complementary sequences within their mRNA targets to induce degradation or translational inhibition.
- miRNAs can regulate many different coding genes while each target gene can be regulated by many different miRNAs, constituting a complex layer of gene regulatory network. miRNAs directly target about 50% of all mammalian coding genes, demonstrating their wide reach in gene regulation [29]. It has shown that miRNAs are essential for cellular proliferation and reprogramming [30-32]. Nonetheless, miRNAs' role in HSC activation or reversion to quiescence has not been explored.
- WISP1 was identified as a direct target of miR-15a, but there are likely other relevant targets for both miR-15a and miR-412. Numerous prediction algorithms forecast potential direct targets of miRNAs based on sequence complementarities, but most of these predicted targets are not actual targets that can withstand experimental verification. Hence, RNA-Seq of HSCs was performed in various activation states to define the expression profile that can identify true direct targets of miR-15a and miR-412.
- HSCs Three types were deep-sequenced: 1) quiescent HSCs freshly harvested from healthy mice, 2) activated HSCs that have been passed on cell culture dish multiple times, and 3) quiescent-like HSCs that have reverted toward quiescence from the activated state by receiving either miR-15a or miR-412. Since quiescent-like HSCs were sequenced just three days after receiving either miR-15a or miR-412 mimic, any coding gene's decrease in mRNA level could be the result of direct miRNA targeting. Hence, the set of genes with decreased mRNA level after receiving either miR-15a or miR-412 were overlaid with the set of potential direct targets based on a prediction algorithm [33] (Fig.20). This new set (from now called the target candidate set) of common genes derived from two parent sets has a higher probability of including true direct targets.
- target candidate genes were chosen that are known to be part of the two best known signaling pathways that promote HSC activation, those of Tgf-beta and Pdgf. When PANTHER analysis was used to filter genes that are part of these two pathways, 12 and 11 target candidates were left for miR-15a and miR-412, respectively (Fig.20). [34]. These genes can be tested by constructing reporters with or without mutant miRNA binding sequence cloned behind a constitutively active luciferase gene. One of these reporter constructs and a miRNA mimic can be co-transfected into either 293 cells or primary HSCs.
- the co-transfected miRNA can anneal to this sequence and repress the translation of luciferase protein, it can indicate that the coding gene is a true direct target of the tested miRNA.
- the mutant binding sequence should prevent the miRNA from annealing and allow near normal expression of luciferase, further supporting that the tested coding gene sequence is a true miRNA target. It is expected that this experiment is time consuming since 23 high-potential target candidate gene sequences in both actual and mutated forms need to be cloned into the luciferase vector. However, finding direct targets is irreplaceable in elucidating the mechanism of action for miRNAs [32].
- the level of activation can be determined by defining their global expression through RNA-Seq and comparing to both activated and quiescent HSCs.
- the morphology and proliferation can be assessed while cultured on plastic and Matrigel.
- Activated wildtype HSCs are known to revert back to quiescence on Matrigel [36], and knockout HSCs' phenotype can be characterized in this environment. If miR-15a or miR-412 deletion contributes to HSC activation, this effect can overcome the quiescence- promoting effect of Matrigel.
- the miRNA-deleted HSCs' interaction with hepatocytes can be evaluated with the coculture system. Activated HSCs cause cocultured hepatocytes to become steatotic and to express pro-inflammatory mediators.
- the miRNA-deleted HSCs can also be assessed to have a pro-steatotic phenotype even greater than that of wildtype HSCs that are activated.
- reconstituting miR-15a or miR-412 can be tested in the respective deletion lines can rescue the wildtype phenotype.
- the reconstitution of the deleted miRNA can be achieved by transfecting the miRNA-expressing piggyBac vectors have already been cloned and have used for gain of function experiments.
- miR-15a or miR-412 has been expressed individually, it is also specifically contemplated herein to express them together in the same HSC. Moreover, delivering just one of these miRNAs can shift global gene expression pattern about halfway back toward quiescence from the activated state along the transcriptional axis connecting them (Fig. 11). Overexpressing both miRNAs may revert activated HSCs back toward quiescence even more closely than expressing either miRNA alone. This gain of function experiment can be performed by cloning both miRNAs in a single piggyBac vector and transfecting it into activated HSCs. The piggyBac vector can allow integration of miRNA genes into the genome, constitutively expressing them [17].
- HSCs that are simultaneously expressing both miRNAs can be phenotyped with the similar parameters described herein to characterize other HSC lines, including global gene expression using RNA-Seq, morphology, proliferation using an MTT assay, and interaction with hepatocytes using this coculture method.
- cell therapy can be tested in the setting of CCl 4- induced hepatic fibrosis and diet induced NASH as HSCs overexpressing a single miRNA. This HSC line can prevent or decrease liver damage and fibrosis even more than what was observed with HSC lines expressing either miR-15a or miR-412 alone.
- mice treated with quiescent-like HSCs had histology showing decreased ballooning, apoptosis, inflammation, and fibrosis in the liver (Fig.8) and lower hepatic collagen expression (Fig.9).
- in vivo experiments can be expanded to further assess the potential of miR-15a and miR- 412 in treating hepatic steatosis, inflammation, and fibrosis using additional mouse models of hepatic fibrosis and NASH.
- miRNAs can be delivered systemically using a viral vector or mimics instead of cell therapy.
- the efficacy can be assessed by performing PCR of profibrotic genes in the liver, histology including H&E and Sirius Red stain, hepatic hydroxyproline assay, and measuring plasma ALT.
- the CCl4 model of hepatic fibrosis (oral gavage 100 ul of 40% CCl 4 twice a week) can be used in addition to the CDAHFD model of NASH [19].
- 500,000 quiescent-like HSCs can be reprogrammed with miR-15a or miR-412. All appropriate controls such as groups with no treatment and treatment with HSCs that have not been reprogrammed can be included.
- CDAHFD choline-deficient, L-amino acid defined, high fat diet
- a primary human HSC can be used for treating the CCL4 mouse model of hepatic fibrosis in determining the therapeutic potential of miR15a and miR-412.
- CCl4 can be gavaged twice per week to induce the hepatic fibrosis in severe combined immune deficient mice (SCID) which were chosen to prevent immune rejection of human cells.
- SCID severe combined immune deficient mice
- CCL4-based hepatic fibrosis models have been generated successfully with SCID mice by other groups [37].
- Fibrosis prevention study human HSCs can be injected on second, forth, and sixth week during an 8 week course of CCL4 challenge in SCID mice.
- Fibrosis reversion study To test whether reprogrammed human HSCs could reverse pre-existing hepatic fibrosis compared to control, HSCs can be injected on the ninth and eleventh week after 8 week course of 0014 challenge has been completed. All mice can be sacrificed at the end of week 12.
- CCl4 Fibrosis study Lipid carriers containing either miR-15a or miR-412 can be injected into the tail vein on the second, fourth, and sixth week during the 8 week course of CCl 4 challenge. All mice can be sacrificed at the end of week 8.
- CDAHFD NASH study Lipid carriers containing either miR-15a or miR-412 can be injected on weeks 3, 5, and 7 during 9 weeks of CDAHFD. All mice can be sacrificed at the end of week 9.
- WISP1 Defining the function of WISP1 in hepatic steatosis, inflammation, and fibrosis.
- WISP1 has emerged as the first experimentally validated direct target of miR-15a. WISP1 was first identified as one of several up-secreted proteins in the CDAHFD induced NASH-HSC conditioned media, detected using a cytokine array blot that holds >100 representative cytokines, chemokines, and extracellular matrix proteins (Fig.22). More detailed analysis showed that activated HSCs expressed WISP1 almost 30 times the level of quiescent HSCs (Fig.23).
- WISP1 is a member of the Ccn family of matricellular proteins that include Cyr61 (Ccn1), Ctgf (Ccn2), Nov (Ccn3), WISP1 (Ccn4), Wisp2 (Ccn5), and Wisp3 (Ccn6).
- Ctgf is already established as an important profibrotic factor in the liver [42].
- WISP1 was found to be upregulated in human idiopathic pulmonary fibrosis, and treating bleomycin challenged mice with neutralizing WISP1 antibody caused attenuation of lung fibrosis [43].
- a small animal study showed that blocking WISP1 ameliorates CCl 4 induced liver fibrosis [44].
- the role of WISP1 in the liver has not been researched in detail, especially in the context of NASH.
- WISP1 can contribute to this phenotype. Indeed, when WISP1 was overexpressed in HSCs harvested from healthy mice, the conditioned media from these cells caused steatosis in initially healthy primary hepatocytes (Fig.24). Furthermore, miR-15a is predicted to target WISP1 which contains two potential miR-15a binding sequences within its 3'-UTR. Thus, the putative target sequences or their mutated variants were cloned behind a constitutively active luciferase reporter gene.
- WISP1 may be a key target gene for accomplishing some of the miR-15a actions in HSCs and may also be a drug target for managing NASH. It is contemplated herein that the hepatic function of WISP1 is a potential as a treatment target for NASH.
- WISP1 is a direct target of miR-15a, its influence on HSC activation status and its role in NAFLD pathogenesis is unclear.
- a WISP1-null mouse line has been generated to demonstrate WISP1's role in bone formation, but its function in the liver was not studied [45]. These mice are fertile and do not have an overt hepatic phenotype. Their mutant allele is preserved in frozen sperm and embryos at an MMRRC facility in University of California at Davis who guarantees successful mutant mouse derivation (see attached letter).
- Wildtype HSCs in quiescent state become activated after 7-10 days of culturing on plastic, and RNA-seq data presented herein demonstrate a clear difference in global gene expression between these two groups (Fig.11).
- a parallel experiment using WISP1-null HSCs can be used to assess whether WISP1 deletion changes the global expression profile toward that of HSC quiescence even in an activation-promoting environment. After isolating HSCs from WISP1-null mice, the cells can be cultured on plastic dish for one (quiescent) or 28 days (activated in wildtype). Their overall gene expression can be determined through RNA-seq and compare the results to those of wildtype HSCs. The global comparison can be done with multi-dimensional scaling analysis, and differentially expressed genes can be identified for detailed analysis.
- Cell morphology, proliferation, and migration can be compared while cultured on plastic. Morphology can be determined using parameters such as size, extent of cell processes, existence of lipid droplets and whether they are UV- fluorescence positive, a sign of retinoid storage and quiescence. Proliferation can be checked with PCNA and Ki-67 immunostains in case WISP1-null HSCs have decreased proliferation, similar to quiescent HSCs. MTT assay can also be performed to quantify the cell proliferation rate as done in the past [32]. Since the preliminary data presented herein and the published literature point to WISP1 being a pro-fibrotic gene, deleting WISP1 may promote quiescence in HSCs, perhaps even while being cultured on plastic dish.
- reconstituting WISP1 in the knockout HSCs can rescue the wild-type phenotype.
- the reconstituting WISP1 can be achieved by transfecting a WISP1-expressing piggyBac vector.
- WISP1-null HSCs that were transfected with the WISP1-expressing vector can be characterized with the same in vitro assays that were used on WISP1-null cells that were not transfected.
- WISP1-null HSCs' interaction with hepatocytes can be evaluated with the coculture system described herein. Activated wildtype HSCs cause cocultured hepatocytes to become steatotic (Fig.14). HSCs overexpressing WISP1 induce nearby hepatocytes to become steatotic by even greater severity (Fig.24). The WISP1-null HSCs can have an attenuated pro-steatotic phenotype.
- the readout of the coculture assay includes Bodipy stain for lipid droplets and PCR of cocultured hepatocytes to measure the expression of pro-inflammatory factors.
- the phenotype can be assessed by the overall severity of hepatic pathology.
- WISP1-null mice can be challenged with CCl 4 and CDAHFD to model toxin induced hepatic fibrosis and NASH, respectively.
- the resulting liver damage sustained by WISP1-null mice can be assessed with that of wildtype mice.
- WISP1-null mice Given the known profibrotic role of WISP1 in other organs including the lung, it is expected that WISP1-null mice have a decreased hepatic fibrosis and perhaps even decreased steatosis and inflammation.
- liver phenotype can be assessed by performing PCR of profibrotic genes in the liver, histology including H&E and Sirius Red stain, hepatic hydroxyproline assay, and measuring plasma ALT. Lastly, the functional phenotype of HSCs harvested from these mouse models of liver disease can be determined.
- CCl 4 Fibrosis model Male wildtype and WISP1-null mice can be challenged with twice weekly CCl 4 gavage. They can receive CCl 4 for 8 weeks and can be sacrificed at the end of week 8.
- CDAHFD NASH model CDAHFD to wildtype and WISP1-null mice can be fed for 9 weeks. Half of the mice can be sacrificed at the end of week 6 and the other half at the end of week 9 to define the role of WISP1 in moderate NASH (6 weeks of CDAHFD) and late-stage NASH with stage 2 fibrosis (9 weeks of CDAHFD).
- HSCs can be isolated from mice challenged with 4 weeks of CCl 4 and 3 weeks of CDAHFD. These HSCs can be cocultured with healthy hepatocytes to determine whether they develop steatosis and express pro-inflammatory factors. The results can be compared to those of wildtype HSCs that underwent the same challenge.
- Blocking WISP1 with a neutralizing antibody attenuated the bleomycin-induced damage in the mouse lung [43].
- neutralizing WISP1 may decrease the level of inflammation and fibrosis that occur in NASH.
- a mouse model of NASH can be treated with WISP1 antibodies and assess the liver phenotype after 6 and 9 weeks of therapy.
- CDAHFD NASH model CDAHFD to wildtype mice can be fed for 9 weeks.
- the treatment group can receive either the commercially available antibody (R&D Systems) [43] or the antibody by weekly injection [46].
- the control group can receive IgG.
- Half of the mice can be sacrificed at the end of week 6 and the other half at the end of week 9 to test the effect of WISP1 blockage in moderate and late-stage NASH with fibrosis respectively.
- analyzing the conditioned media of HSCs from NASH secreted paracrine or autocrine factors can be identified.
- a more detailed analysis of the NASH-HSC conditioned media through mass spectrometry could identify other mediators that may be drug targets.
- the coculture system described herein could be used to study other liver diseases as long as there are representative mouse models. For example, the interaction of hepatocytes and HSCs can be modeled in alcoholic liver disease by isolating cell types in alcohol-fed mice [47].
- MicroRNAs are indispensable for reprogramming mouse embryonic fibroblasts into induced stem cell-like cells.
- WISP1/CCN4 a potential target for inhibiting prostate cancer growth and spread to bone.
- HSCs are the in the layer located between the PBS and 35 % percoll.
- EXAMPLE 4 ANTIBODIES THAT INHIBIT WISP1 FOR THE TREATMENT AND PREVENTION OF LIVER DISEASES.
- Antibodies that specifically bind and inhibit WISP1 can be used to treat and prevent liver diseases such as primary biliary cholangitis (PBC) and autoimmune hepatitis (AIH).
- liver diseases such as primary biliary cholangitis (PBC) and autoimmune hepatitis (AIH).
- lead candidates that inhibit WISP1 include ant-WISP1 IgG1/IgG4 antibodies and IgG1 ADCC).
- Strategies employed to engineer an anti-WISP1 antibody include but are not limited to Fc engineering for half-life extension; bi-specific antibody technologies to enable inhibition of two anti-fibrotic targets simultaneously; and sweeping technologies that (1) turn antibodies from sequestering entities into catalytic drugs by driving target catabolism, (2) dramatically decrease CoG, dosing levels, and frequency of dosing, (3) increases the likelihood of subcutaneous dosing, and (4) obviates the need for full blocking potential.
- WISP1 antibody was tested on fresh HSCs.
- a WISP1 antibody (Ab WISP1 or WISP IgG, RND Systems, 1 ⁇ g/mL) was incubated with conditioned media for 1 hour at 37 o C and was then applied to HSCs.
- the HSCs were incubated with only conditioned media.
- recombinant WISP1 (Rc-WISP1, 100ng/mL) was also added to the HSCs instead of the antibody.
- HSC samples were evaluated 48-hours post-treatment (Fig.38A).
- Rc-WISP1 is, e.g., WISP1-CCN4, obtained from the cell line identified as Accession # O54774, and is commercially available from R&D Systems.
- Rc-WISP1 was found to significantly increased cell number at day 1 and day 2 post-incubation (Fig.38B), Acta2 mRNA expression (Fig.38C), and Col1a1 mRNA expression (Fig.38D) in HSCs, indicating that HSCs become activated in the presence of recombinant WISP1.
- anti-WISP1 IgG (Ab Wisp1) prevented HSC activation in HSCs; incubation with anti-WISP1 resulted in significantly reduced cell numbers at day 1 and day 2 post-incubation (Fig.38B), Acta2 mRNA expression (Fig.38C), and Col1a1 mRNA expression (Fig.38D) as compared to HSCs incubated with rc WISP1.
- Anti-WISP1 IgG was then tested on primary hepatocytes isolated from choline deficient, L-amino acid defined, high fat diet-induced steatosis (CDAHFD) mouse model.
- a hallmark of a liver disease e.g., NALFD and viral hepatitis is an increase in lipid droplets in the diseased liver cells.
- BODIPY staining is employed.
- CDAHFD cells treated with control IgG have increased BODIPY staining (Fig. 38E and 38F).
- CDAHFD cells treated with anti-WISP1 IgG have decreased BODIPY staining, similar to a control, healthy cell (Fig.38E and 38F).
- data presented herein show that anti-WISP1 IgG can revert a diseased liver cell to a healthy liver cell.
- HSCs were cultured to form a monolayer, and then injured (Fig.39A-Fig.39B).
- Cells were cultured in a 60-mm dish at 90% confluence in growth medium.
- a single linear scratch wound was generated using a sterile P200 pipette tip.
- the cells were washed with PBS to remove floating cellular debris and re-fed with recombinant Wisp1 protein (100 ng/mL, R&D Systems, Minneapolis, MN) and monoclonal Wisp1 antibody (1 ⁇ g/mL, R&D Systems, Minneapolis, MN) for 24 h.
- Wound closure or cell migration was photographed when the scrape wound was introduced, 12, and 24 h after injury using an inverted microscope.
- the area between wound edges in dish at each time was measured using a standard template placed on the image. Data were expressed as wound area (percentage) relative to initial wound area.
- the wounded area was determined using publically available ImageJ (NIH) software.
- HSCs were incubated with either Rc WISP1 or anti-WISP1 IgG.
- HSCs incubated with rc WISP1 showed a more rapid migration as compared to control or anti-WISP1 IgG treated HSCs, particularly after the 12 hours time point.
- HSCs incubated with anti-WISP1 IgG resulted in a slower migration, similar to a control treated HSC (Fig.39A-Fig.39B).
- Anti-WISP1 IgG prevented HSC migration following injury as compared to HSCs treated with Rc-WISP1. This result confirms that antibodies that inhibit WISP1 can prevent HSC activation and migration, making them a useful agent to treat liver diseases.
- SEQ ID NO: 1 is an amino acid sequence that encodes human WNT1-inducible-signaling pathway protein 1 isoform 1 precursor.
- SEQ ID NO: 2 is an amino acid sequence that encodes human WNT1-inducible-signaling pathway protein 1 isoform 2 precursor.
- MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLIT DGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAHAVGEVEAWHRNCIAYTSPWSPCSTSCGLG VSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQ PKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYPDFSEIAN
- SEQ ID NO: 3 is an amino acid sequence that encodes human WNT1-inducible-signaling pathway protein 1 isoform 3 precursor.
- SEQ ID NO: 4 is an amino acid sequence that encodes human WNT1-inducible-signaling pathway protein 1 isoform 4 precursor.
- SEQ ID NO: 5 is a nucleotide sequence of human WNT1 inducible signaling pathway protein 1 (WISP1),
- transcript variant 1 mRNA.
- SEQ ID NO: 6 is an amino acid sequence of mouse WNT1-inducible-signaling pathway protein 1 precursor [Mus musculus].
- SEQ ID NO: 7 is a nucleotide sequence of mouse WNT1 inducible signaling pathway protein 1 (Wisp1),
- transcript variant 1 mRNA [Mus musculus].
- SEQ ID NO: 8 is a nucleotide sequence of human MiR 15a.
- SEQ ID NO: 9 is a nucleotide sequence of human Mir-412.
- SEQ ID NO: 10 is a nucleotide sequence of mouse MiR 15a. (SEQ ID NO: 10)
- SEQ ID NO: 11 is a nucleotide sequence of mouse Mir-412. (SEQ ID NO: 11)
- SEQ ID NOs: 12-31 are Rattus heavy chain complementarity determining regions for IgG.
- SEQ ID NOs: 32-51 are Rattus light chain complementarity determining regions for IgG.
- SEQ ID NOs: 52-71 are Ovis aries (sheep) heavy chain complementarity determining regions for IgG.
- SEQ ID NOs: 72-90 are Ovis aries (sheep) light chain complementarity determining regions for IgG.
- SEQ ID NOs: 91-110 are Capra hircus (goat) heavy chain complementarity determining regions for IgG.
- SEQ ID NOs: 111-121 are Leporidae (rabbit) heavy chain complementarity determining regions for IgG.
- SEQ ID NOs: 122-141 are Leporidae (rabbit) light chain complementarity determining regions for IgG.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biomedical Technology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Zoology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Physics & Mathematics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Epidemiology (AREA)
- Plant Pathology (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Nutrition Science (AREA)
- Endocrinology (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2021521144A JP2022512735A (ja) | 2018-10-19 | 2019-10-18 | 肝疾患を治療するための組成物および方法 |
| AU2019361120A AU2019361120A1 (en) | 2018-10-19 | 2019-10-18 | Compositions and methods for treatment of liver disease |
| US17/286,011 US20210388073A1 (en) | 2018-10-19 | 2019-10-18 | Compositions and Methods for Treatment of Liver Disease |
| CN202411435476.8A CN120305401A (zh) | 2018-10-19 | 2019-10-18 | 用于肝病的治疗的组合物和方法 |
| EP19873989.8A EP3866852A4 (en) | 2018-10-19 | 2019-10-18 | COMPOSITIONS AND METHODS OF TREATING HEPATIC DISEASES |
| CN201980083971.8A CN113271971A (zh) | 2018-10-19 | 2019-10-18 | 用于肝病的治疗的组合物和方法 |
| KR1020217014607A KR20210081366A (ko) | 2018-10-19 | 2019-10-18 | 간 질환의 치료를 위한 조성물 및 방법 |
| CA3117098A CA3117098A1 (en) | 2018-10-19 | 2019-10-18 | Compositions and methods for treatment of liver disease |
| IL282251A IL282251A (en) | 2018-10-19 | 2021-04-12 | Compositions and methods for treatment of liver disease |
| US18/824,691 US20250223344A1 (en) | 2018-10-19 | 2024-09-04 | Compositions and Methods for Treatment of Liver Disease |
| JP2024163238A JP2025011102A (ja) | 2018-10-19 | 2024-09-20 | 肝疾患を治療するための組成物および方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862747903P | 2018-10-19 | 2018-10-19 | |
| US62/747,903 | 2018-10-19 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/286,011 A-371-Of-International US20210388073A1 (en) | 2018-10-19 | 2019-10-18 | Compositions and Methods for Treatment of Liver Disease |
| US18/824,691 Continuation US20250223344A1 (en) | 2018-10-19 | 2024-09-04 | Compositions and Methods for Treatment of Liver Disease |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020081920A1 true WO2020081920A1 (en) | 2020-04-23 |
Family
ID=70284106
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/056910 Ceased WO2020081920A1 (en) | 2018-10-19 | 2019-10-18 | Compositions and methods for treatment of liver disease |
Country Status (9)
| Country | Link |
|---|---|
| US (2) | US20210388073A1 (enExample) |
| EP (1) | EP3866852A4 (enExample) |
| JP (2) | JP2022512735A (enExample) |
| KR (1) | KR20210081366A (enExample) |
| CN (2) | CN120305401A (enExample) |
| AU (1) | AU2019361120A1 (enExample) |
| CA (1) | CA3117098A1 (enExample) |
| IL (1) | IL282251A (enExample) |
| WO (1) | WO2020081920A1 (enExample) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021087440A1 (en) * | 2019-11-01 | 2021-05-06 | Figene, Llc | Fibroblast-based therapy for treatment of sclerosing cholangitis |
| CN116194479A (zh) * | 2020-07-10 | 2023-05-30 | Gt创新公司 | 抗tau抗体 |
| WO2024185720A1 (ja) * | 2023-03-03 | 2024-09-12 | Karydo TherapeutiX株式会社 | 抗体、又はその抗原結合フラグメント |
| US12410246B2 (en) | 2019-09-16 | 2025-09-09 | Opsidio, LLC | Anti-stem cell factor antibodies and methods of blocking the interaction between SCF and c-Kit |
| WO2025179048A3 (en) * | 2024-02-20 | 2025-10-02 | Ecogenome Llc | Antibodies that bind dach1 and methods of use |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN117487010B (zh) * | 2022-08-02 | 2025-02-14 | 东莞市朋志生物科技有限公司 | 抗四碘甲状腺素抗体或其功能性片段、检测四碘甲状腺素的试剂和试剂盒 |
| CN117045680B (zh) * | 2023-10-12 | 2023-12-08 | 北京国卫生物科技有限公司 | 促进肝脏再生的干细胞制剂及其制备方法 |
| CN119331100B (zh) * | 2024-10-16 | 2025-07-25 | 天津大学 | 特异性结合25-羟基维生素d的单克隆抗体及其应用 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110311540A1 (en) * | 1997-10-29 | 2011-12-22 | David Botstein | Wisp polypeptides and nucleic acids encoding same |
| US20160165861A1 (en) * | 2014-12-10 | 2016-06-16 | Regents Of The University Of Minnesota | Genetically modified cells, tissues, and organs for treating disease |
| US20170304442A1 (en) * | 2014-04-15 | 2017-10-26 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind wisp1 |
| WO2017201422A1 (en) * | 2016-05-20 | 2017-11-23 | The General Hospital Corporation | Using micrornas to control activation status of hepatic stellate cells and to prevent fibrosis in progressive liver diseases |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1177796B1 (en) * | 1999-04-27 | 2011-04-27 | Mitsubishi Tanabe Pharma Corporation | Medicament for prevention or therapeutic treatment of liver disease |
| WO2003014345A1 (fr) * | 2001-08-08 | 2003-02-20 | Ajinomoto Co., Inc. | Ensemble de genes participant a l'activation des astrocytes du foie |
| US9944671B2 (en) * | 2010-06-02 | 2018-04-17 | Alnylam Pharmaceuticals, Inc. | Compositions and methods directed to treating liver fibrosis |
-
2019
- 2019-10-18 KR KR1020217014607A patent/KR20210081366A/ko active Pending
- 2019-10-18 WO PCT/US2019/056910 patent/WO2020081920A1/en not_active Ceased
- 2019-10-18 CN CN202411435476.8A patent/CN120305401A/zh active Pending
- 2019-10-18 CN CN201980083971.8A patent/CN113271971A/zh active Pending
- 2019-10-18 AU AU2019361120A patent/AU2019361120A1/en active Pending
- 2019-10-18 JP JP2021521144A patent/JP2022512735A/ja not_active Withdrawn
- 2019-10-18 US US17/286,011 patent/US20210388073A1/en not_active Abandoned
- 2019-10-18 EP EP19873989.8A patent/EP3866852A4/en active Pending
- 2019-10-18 CA CA3117098A patent/CA3117098A1/en active Pending
-
2021
- 2021-04-12 IL IL282251A patent/IL282251A/en unknown
-
2024
- 2024-09-04 US US18/824,691 patent/US20250223344A1/en active Pending
- 2024-09-20 JP JP2024163238A patent/JP2025011102A/ja active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110311540A1 (en) * | 1997-10-29 | 2011-12-22 | David Botstein | Wisp polypeptides and nucleic acids encoding same |
| US20170304442A1 (en) * | 2014-04-15 | 2017-10-26 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind wisp1 |
| US20160165861A1 (en) * | 2014-12-10 | 2016-06-16 | Regents Of The University Of Minnesota | Genetically modified cells, tissues, and organs for treating disease |
| WO2017201422A1 (en) * | 2016-05-20 | 2017-11-23 | The General Hospital Corporation | Using micrornas to control activation status of hepatic stellate cells and to prevent fibrosis in progressive liver diseases |
Non-Patent Citations (8)
| Title |
|---|
| ANONYMOUS: "Recombinant Human WISP-1/CCN4, Catalog Number. 1627-WS", 18 May 2018 (2018-05-18), XP055805200, Retrieved from the Internet <URL:https://www.rndsystems.com/products/recombinant-human-wisp-1-ccn4-protein-cf_1627-ws#product-datasheets> [retrieved on 20200219] * |
| JAIMIE CHEN , WEI GAO , PING ZHOU , XIAOCUI MA , BENJAMIN TSCHUDY-SENEY , CHENGHAI LIU , MARK A ZERN , PING LIU , YUYOU DUAN : "Enhancement Of Hepatocyte Differentiation From Human Embryonic Stem Cells By Chinese Medicine Fuzhenghuayu", SCIENTIFIC REPORTS, vol. 6, 18841, 6 January 2016 (2016-01-06), pages 1 - 13, XP055702084, DOI: 10.1038/srep18841 * |
| MELCHIORRE CERVELLO , LYDIA GIANNITRAPANI , MANUELA LABBOZZETTA , MONICA NOTARBARTOLO , NATALE D'ALESSANDRO , NADIA LAMPIASI , ANT: "Expression Of WISPs And Of Their Novel Alternative Variants In Human Hepatocellular Carcinoma Cells", ANNALS OF THE NEW YORK ACADEMY OF SCIENCES, vol. 1028, no. 1, December 2004 (2004-12-01) - 12 January 2006 (2006-01-12), pages 432 - 439, XP055702088, ISSN: 0077-8923, DOI: 10.1196/annals.1322.051 * |
| OGHENESUVWE ERHIRHIE EARNEST, EKENE, NWOKE E, AJAGHAKU DANIEL, LOTANNA: "Guidelines On Dosage Calculation And Stock Solution Preparation In Experimental Animals' Studies", JOURNAL OF NATURAL SCIENCES RESEARCH, vol. 4, no. 18, 2014, pages 100 - 106, XP055805205, ISSN: 2224-3186 * |
| PETER D TURNPENNY, SIAN ELLARD: "Alagille Syndrome: Pathogenesis, Diagnosis And Management", EUROPEAN JOURNAL OF HUMAN GENETICS, vol. 20, no. 3, 1 March 2011 (2011-03-01), pages 251 - 257, XP055590188, ISSN: 1018-4813, DOI: 10.1038/ejhg.2011.181 * |
| See also references of EP3866852A4 * |
| SHUQING JIN , ZHIXIA CHEN , XIBING DING , XIANG ZHAO , XI JIANG , YAO TONG , TIMOTHY R BILLIAR , QUAN LI: "Mechanical Ventilation Augments Poly(I:C)-Induced Lung Injury Via A WISP1-lntegrin beta3-Dependent Pathway In Mice", MOLECULAR MEDICINE, vol. 22, no. 1, 6 January 2016 (2016-01-06), pages 54 - 63, XP055702100, ISSN: 1076-1551, DOI: 10.2119/molmed.2015.00233 * |
| YAO TONG , XI-BING DING , ZHI-XIA CHEN , SHU-QING JIN , XIANG ZHAO , XIN WANG , SHU-YA MEI , XI JIANG , LINGYU WANG , QUAN LI : "WISP1 Mediates Hepatic Warm Ischemia Reperfusion Injury Via TLR4 Signaling In Mice", SCIENTIFIC REPORTS, vol. 6, 20141, 29 January 2016 (2016-01-29), pages 1 - 11, XP055702105, DOI: 10.1038/srep20141 * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12410246B2 (en) | 2019-09-16 | 2025-09-09 | Opsidio, LLC | Anti-stem cell factor antibodies and methods of blocking the interaction between SCF and c-Kit |
| WO2021087440A1 (en) * | 2019-11-01 | 2021-05-06 | Figene, Llc | Fibroblast-based therapy for treatment of sclerosing cholangitis |
| CN116194479A (zh) * | 2020-07-10 | 2023-05-30 | Gt创新公司 | 抗tau抗体 |
| WO2024185720A1 (ja) * | 2023-03-03 | 2024-09-12 | Karydo TherapeutiX株式会社 | 抗体、又はその抗原結合フラグメント |
| WO2025179048A3 (en) * | 2024-02-20 | 2025-10-02 | Ecogenome Llc | Antibodies that bind dach1 and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| US20210388073A1 (en) | 2021-12-16 |
| JP2022512735A (ja) | 2022-02-07 |
| CN113271971A (zh) | 2021-08-17 |
| EP3866852A1 (en) | 2021-08-25 |
| CN120305401A (zh) | 2025-07-15 |
| EP3866852A4 (en) | 2022-07-06 |
| AU2019361120A1 (en) | 2021-05-13 |
| US20250223344A1 (en) | 2025-07-10 |
| CA3117098A1 (en) | 2020-04-23 |
| JP2025011102A (ja) | 2025-01-23 |
| KR20210081366A (ko) | 2021-07-01 |
| IL282251A (en) | 2021-05-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250223344A1 (en) | Compositions and Methods for Treatment of Liver Disease | |
| JP7858715B2 (ja) | 高親和性のアイソフォーム選択的TGFβ1阻害剤、およびその使用 | |
| JP5782132B2 (ja) | 抗CD40抗体のサイレントFc変異体 | |
| US11130803B2 (en) | Isoform-selective TGFβ1 inhibitors and use thereof | |
| AU2018364630A1 (en) | Methods and compositions for the generation and use of humanized conformation-specific phosphorylated tau antibodies | |
| EP2882456B1 (en) | Use of il-20 antagonists for treating liver diseases | |
| JP2021507677A (ja) | 抗trkbモノクローナル抗体および使用の方法 | |
| WO2005018671A1 (ja) | 癌転移阻害剤 | |
| US20240270858A1 (en) | Therapeutics and methods for treating or ameliorating metabolic disorders | |
| EP4501354A1 (en) | Composition and method for inhibiting fibrosis | |
| US10398786B2 (en) | Therapeutic gene cocktail for heart regeneration | |
| US20130202586A1 (en) | Stem cell therapy using inhibitors of lysophosphatidic acid | |
| US20260035468A1 (en) | New anti-itgb8 antibodies and its uses thereof | |
| CA3105988C (en) | High-affinity, isoform-selective tgf.beta.1 inhibitors and use thereof | |
| KR20240124222A (ko) | 조절 t 세포에 특이적으로 존재하는 dkk1 단백질 및 그 용도 | |
| EP4735645A2 (en) | Methods for detection and treatment of cancer | |
| CA2915827A1 (en) | Use of il-20 antagonists for alleviating obesity | |
| EA049507B1 (ru) | ВЫСОКОАФФИННЫЕ, СЕЛЕКТИВНЫЕ В ОТНОШЕНИИ ИЗОФОРМЫ ИНГИБИТОРЫ TGFβ1 И ИХ ПРИМЕНЕНИЕ |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19873989 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2021521144 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3117098 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2019361120 Country of ref document: AU Date of ref document: 20191018 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20217014607 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019873989 Country of ref document: EP Effective date: 20210519 |