WO2020047473A1 - Single-chain and multi-chain chimeric polypeptides and uses thereof - Google Patents

Single-chain and multi-chain chimeric polypeptides and uses thereof Download PDF

Info

Publication number
WO2020047473A1
WO2020047473A1 PCT/US2019/049158 US2019049158W WO2020047473A1 WO 2020047473 A1 WO2020047473 A1 WO 2020047473A1 US 2019049158 W US2019049158 W US 2019049158W WO 2020047473 A1 WO2020047473 A1 WO 2020047473A1
Authority
WO
WIPO (PCT)
Prior art keywords
domain
target
amino acids
binding domain
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/049158
Other languages
English (en)
French (fr)
Inventor
Hing Wong
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
HCW Biologics Inc
Original Assignee
HCW Biologics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202510209794.0A priority Critical patent/CN120365435A/zh
Priority to CA3109361A priority patent/CA3109361A1/en
Priority to EP19779635.2A priority patent/EP3844182B1/en
Priority to AU2019328575A priority patent/AU2019328575B2/en
Priority to EP25175073.3A priority patent/EP4592314A3/en
Application filed by HCW Biologics Inc filed Critical HCW Biologics Inc
Priority to CN201980069954.9A priority patent/CN113015744B/zh
Priority to JP2021536663A priority patent/JP7474769B2/ja
Publication of WO2020047473A1 publication Critical patent/WO2020047473A1/en
Priority to IL280920A priority patent/IL280920A/en
Anticipated expiration legal-status Critical
Priority to JP2024065081A priority patent/JP7745032B2/ja
Priority to AU2024227260A priority patent/AU2024227260B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/36Blood coagulation or fibrinolysis factors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/15Natural-killer [NK] cells; Natural-killer T [NKT] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4225Growth factors
    • A61K40/4229Transforming growth factor [TGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/555Interferons [IFN]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/36Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against blood coagulation factors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0646Natural killers cells [NK], NKT cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/57Skin; melanoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/74Inducing cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • the present disclosure relates to the field of biotechnology, and more specifically, to single-chain and multi-chain chimeric polypeptides having a linker domain positioned between two target-binding domains that are useful for a variety of applications.
  • Adoptive immunotherapy or cellular therapy requires the culture of immune cells obtained from a subject in vivo (and optionally genetic manipulation of the immune cells to express a chimeric antigen receptor or a T-cell receptor) before administration back into the subject.
  • a sufficient number of immune cells is necessary in order to provide a therapeutic effect in the subject.
  • immune cells obtained from a subject need to be cultured for three or more weeks before a therapeutically effective number of immune cells can be obtained.
  • many methods of culturing immune cells obtained from a subject in vitro require a layer of feeder cells, which requires subsequent purification or isolation of the immune cells before administration back to the subject.
  • the present invention is based on the discovery that single-chain and multi-chain chimeric polypeptides having a linker domain positioned between two target-binding domains are effective in stimulating an immune cell, inducing or increasing proliferation of an immune cell, inducing differentiation of an immune cell, or treating a subject in need thereof (e.g., a subject having cancer or an aging-related disease or condition).
  • the present invention is also based on the discovery that the multi-chain chimeric polypeptides described herein promote the metabolism of the immune cells by increasing their aerobic glycolysis (Warburg Effect), oxidative phosphorylation, and mitochondrial reserve respiratory capacity to support their differentiation to effector cells and to enhance their effector-cell function(s).
  • a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium comprising an effective amount of (i) a single-chain chimeric polypeptide comprising a first target-binding domain, a linker domain, and a second target-binding domain, and (ii) an IgGl antibody construct that comprises at least one antigen-binding domain that binds specifically to the linker domain, under conditions that allow for the activation and proliferation of the natural killer cell or the T cell, wherein the first target-binding domain and the second target-binding domain are each independently selected from the group consisting of: a soluble interleukin, soluble cytokine protein, or soluble cell surface protein, an antigen-binding domain, a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor, and ligands of co-stimulatory molecules.
  • the first target-binding domain and the linker domain directly abut each other.
  • the single chain chimeric polypeptide further includes a linker sequence between the first target binding domain and the linker domain.
  • the linker domain and the second target-binding domain directly abut each other.
  • the single- chain chimeric polypeptide further includes a linker sequence between the linker domain and the second target-binding domain.
  • the first target-binding domain and the second target-binding domain directly abut each other.
  • the single-chain chimeric polypeptide further includes a linker sequence between the first target-binding domain and the second target-binding domain.
  • the second target-binding domain and the linker domain directly abut each other.
  • the single-chain chimeric polypeptide further includes a linker sequence between the second target-binding domain and the linker domain.
  • the first target-binding domain and the second target-binding domain bind specifically to the same antigen.
  • the first target-binding domain and the second target-binding domain bind specifically to the same epitope.
  • the first target-binding domain and the second target-binding domain comprise the same amino acid sequence.
  • the first target-binding domain and the second target-binding domain bind specifically to different antigens.
  • first target-binding domain and the second target- binding domain is an antigen-binding domain.
  • first target- binding domain and the second target-binding domain are each an antigen-binding domain.
  • antigen-binding domain comprises a scFv or a single domain antibody.
  • a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium comprising an effective amount of (i) a single-chain chimeric polypeptide comprising a first target-binding domain, a linker domain, and a second target-binding domain, and (ii) an IgGl antibody construct that comprises at least one antigen-binding domain that binds specifically to the linker domain, one or both of the first target-binding domain and the second target-binding domain bind to a target selected from the group consisting of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD52, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26
  • methods of promoting the activation and proliferation of a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium comprising an effective amount of (i) a single-chain chimeric polypeptide comprising a first target-binding domain, a linker domain, and a second target-binding domain, and (ii) an IgGl antibody construct that comprises at least one antigen-binding domain that binds specifically to the linker domain, one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin or cytokine protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group consisting of: IL-l, IL- 2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL-18, IL-21, PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP16-binding protein.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin or cytokine receptor.
  • the soluble interleukin or cytokine receptor is a soluble TGF-b receptor II (TGF-PRII), a soluble TGF-PRIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • TGF-PRII soluble TGF-b receptor II
  • a soluble TGF-PRIII soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble NKp46
  • a soluble DNAM-l a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • the ligand of a co-stimulatory molecule is a soluble CD80, CD86, CD40, ICOSL, CD70, OX40L, 4-1BBL, GITRL, LIGHT, TIM3, TIM4, ICAM1, LFA3, CDld, or LLT-l.
  • a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium comprising an effective amount of (i) a single-chain chimeric polypeptide comprising a first target-binding domain, a linker domain, and a second target-binding domain, and (ii) an IgGl antibody construct that comprises at least one antigen-binding domain that binds specifically to the linker domain, the linker domain is a soluble tissue factor domain.
  • the soluble tissue factor domain is a soluble human tissue factor domain.
  • the soluble human tissue factor domain comprises a sequence that is at least 80% identical to SEQ ID NO: 1.
  • the soluble human tissue factor domain comprises a sequence that is at least 90% identical to SEQ ID NO: 1. In some embodiments, the soluble human tissue factor domain comprises a sequence that is at least 95% identical to SEQ ID NO: 1. In some embodiments, the soluble human tissue factor domain does not include one or more of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a pheny
  • the soluble human tissue factor domain does not include any of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble tissue factor domain is not capable of binding Factor Vila. In some embodiments, the soluble tissue factor domain does not convert inactive Factor X into Factor Xa. In some embodiments, the single-chain chimeric polypeptide does not stimulate blood coagulation in a mammal.
  • methods of promoting the activation and proliferation of a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium comprising an effective amount of (i) a single-chain chimeric polypeptide comprising a first target-binding domain, a linker domain, and a second target-binding domain, and (ii) an IgGl antibody construct that comprises at least one antigen-binding domain that binds specifically to the linker domain, the IgGl antibody construct includes at least one antigen-binding domain that binds specifically to the soluble tissue factor domain.
  • the linker domain is selected from the group consisting of: a kappa chain and a lambda chain.
  • the IgGl antibody construct is a monoclonal IgGl antibody, where both of the antigen binding domains in the monoclonal IgGl antibody bind specifically to the linker domain.
  • the IgGl antibody construct is a bispecific IgGl antibody, where one of the two antigen-binding domains in the bispecific IgGl antibody binds specifically to the linker domain.
  • the single-chain chimeric polypeptide further includes one or more additional target-binding domains at its N- and/or C- terminus. In some embodiments, the single-chain chimeric polypeptide includes one or more additional target-binding domains at its N-terminus.
  • one or more additional target-binding domains directly abuts the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single chain chimeric polypeptide further includes a linker sequence between one of the at least one additional target-binding domains and the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide includes one or more additional target-binding domains at its C- terminus. In some embodiments, one of the one or more additional target-binding domains directly abuts the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide further includes a linker sequence between one of the at least one additional target- binding domains and the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide includes one or more additional target binding domains at its N-terminus and the C- terminus. In some embodiments, one of the one or more additional target-binding domains at the N-terminus directly abuts the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide further includes a linker sequence between one of the one or more additional target-binding domains at the N-terminus and the first target-binding domain, the second target-binding domain, or the linker domain. In some embodiments, one of the one or more additional target-binding domains at the C-terminus directly abuts the first target-binding domain, the second target-binding domain, or the linker domain. In some embodiments, the single-chain chimeric polypeptide further includes a linker sequence between one of the one or more additional target-binding domains at the C- terminus and the first target-binding domain, the second target-binding domain, or the linker domain.
  • methods of promoting the activation and proliferation of a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium comprising an effective amount of (i) a single-chain chimeric polypeptide comprising a first target-binding domain, a linker domain, and a second target-binding domain, and (ii) an IgGl antibody construct that comprises at least one antigen-binding domain that binds specifically to the linker domain, two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same antigen.
  • two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same epitope. In some embodiments, two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains comprise the same amino acid sequence. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same antigen. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same epitope. In some
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each comprise the same amino acid sequence. In some embodiments, the first target-binding domain, the second target- binding domain, and the one or more additional target-binding domains bind specifically to different antigens. In some embodiments, one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen-binding domain. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen-binding domain. In some embodiments, the antigen-binding domain comprises a scFv or a single domain antibody.
  • a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium comprising an effective amount of (i) a single-chain chimeric polypeptide comprising a first target-binding domain, a linker domain, and a second target-binding domain, and (ii) an IgGl antibody construct that comprises at least one antigen-binding domain that binds specifically to the linker domain, one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains bind specifically to a target selected from the group consisting of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6,
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group consisting of: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL- 18, IL-21 , PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP 16-binding protein.
  • the soluble interleukin or cytokine receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a ligand of a co-stimulatory molecule.
  • the ligand of a co-stimulatory molecule is a soluble CD80, CD86, CD40, ICOSL, CD70, OX40L, 4- 1BBL, GITRL, LIGHT, TIM3, TIM4, ICAM1, LFA3, CDld, or LLT-l.
  • a natural killer cell or a T cell in some embodiments, contacting a natural killer cell or a T cell in a liquid culture medium comprising an effective amount of (i) a single-chain chimeric polypeptide comprising a first target-binding domain, a linker domain, and a second target-binding domain, and (ii) an IgGl antibody construct that comprises at least one antigen-binding domain that binds specifically to the linker domain, the single-chain chimeric polypeptide further comprises a signal sequence at its N-terminal end. In some embodiments, the single-chain chimeric polypeptide lacks a signal sequence at its N- terminal end.
  • the single-chain chimeric polypeptide further comprises a peptide tag positioned at the N-terminal end or the C-terminal end of the single-chain chimeric polypeptide. In some embodiments, the single-chain chimeric polypeptide further includes a signal sequence at its N-terminal end. In some
  • the single-chain chimeric polypeptide lacks a signal sequence at its N- terminal end.
  • the contacting step is performed for a period of about 2 hours to about 20 days. In some embodiments, the contacting step is performed for a period of about 1 day to about 15 days.
  • the liquid culture medium is a serum-free liquid culture medium.
  • the liquid culture medium is a chemically-defined liquid culture medium.
  • the liquid culture medium comprises the single-chain chimeric polypeptide and the IgGl antibody construct at a molar ratio of about 0.5: 1 to about 2: 1.
  • the liquid culture medium comprises the single-chain chimeric polypeptide and the IgGl antibody construct at a molar ratio of about 0.8: 1 to about 1.2: 1.
  • a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium comprising an effective amount of (i) a single-chain chimeric polypeptide comprising a first target-binding domain, a linker domain, and a second target-binding domain, and (ii) an IgGl antibody construct that comprises at least one antigen-binding domain that binds specifically to the linker domain, the NK cell or T cell was previously obtained from a subject.
  • the method further includes obtaining the NK cell or T cell from the subject prior to the contacting step.
  • the NK cell or T cell has previously been genetically modified to express a chimeric antigen receptor or a recombinant T-cell receptor.
  • the method further includes, after the contacting step, introducing into the NK cell or the T cell a nucleic acid encoding a chimeric antigen-receptor or a recombinant T-cell receptor. In some embodiments, the method further includes, before the contacting step, introducing into the NK cell or the T cell a nucleic acid encoding a chimeric antigen-receptor or a recombinant T-cell receptor. In some embodiments, the method further includes, after the contacting step, isolating the NK cell or the T cell.
  • the NK cell or the T cell has an increased level of expression or secretion of one or more proteins selected from the group consisting of: TNF-a, IFN-T, granzyme A, granzyme B, perforin, 2B4, CD8, CDl la,
  • CD 16 CD25, CD27, CD48, CD49d, CD54, CD56, CD58, CD62L, CD69, CD70, CD94, CD137, CD 158a, CDl58b, CDl58e, CD178, CD226, CD253, NKG2A, NKG2C, NKG2D, LIR- 1 , LILR-B 1 , KIR2DL 1 , KIR3DL 1 , KIR2DL2, KIR2DL3 , CXCR3 ,
  • a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium comprising an effective amount of (i) a single-chain chimeric polypeptide comprising a first target-binding domain, a linker domain, and a second target-binding domain, and (ii) an IgGl antibody construct that comprises at least one antigen-binding domain that binds specifically to the linker domain, the method further includes, after the contacting step, administering the NK cell or the T cell to a subject in need thereof.
  • the subject has been identified or diagnosed as having an age-related disease or condition.
  • the age-related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerulosclerosis, liver cirrhosis, NAFLD, osteoporosis, amyotrophic lateral sclerosis, Huntington’s disease
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastic and esoph
  • coronavirus coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, and influenza virus.
  • provided herein are activated NK cell or T cells produced by any of the methods described herein that employ single-chain chimeric polypeptides.
  • pharmaceutical compositions that include such activated NK cells or T cell.
  • kits that include such pharmaceutical compositions.
  • methods of killing a cancer cell, an infected cell, or a senescent cell in a subject in need thereof that include administering to the subject a therapeutically effective amount of the activated NK cell or the activated T cell produced by any of the methods described herein that employ single-chain chimeric polypeptides or the pharmaceutical composition that include such NK cells or T cell.
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastic and esoph
  • the subject has been identified or diagnosed as having an aging-related disease or condition.
  • the aging-related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis,
  • Parkinson’s disease age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerulosclerosis, liver cirrhosis, NAFLD, osteoporosis, amyotrophic lateral sclerosis, Huntington’s disease, spinocerebellar ataxia, multiple sclerosis, and renal dysfunction.
  • the methods of killing a cancer cell, an infected cell, or a senescent cell in a subject in need thereof include administering to the subject a therapeutically effective amount of the activated NK cell or the activated T cell produced by any of the methods described herein that employ single-chain chimeric polypeptides or the pharmaceutical composition that includes such activated NK cells or T cells.
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastic and esophageal cancer, pancreatic cancer, prostate cancer, breast cancer, colorec
  • the subject has been identified or diagnosed as having an aging-related disease or condition. In some embodiments, the subject has been identified or diagnosed as having an aging-related disease or condition. In some embodiments, the aging-related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, ma
  • the subject has been diagnosed or identified as having an infectious disease.
  • the infectious disease is infection with human immunodeficiency virus, cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, and influenza virus.
  • kits that include (i) a single-chain chimeric polypeptide including a first target-binding domain, a linker domain, and a second target binding domain, wherein the first target-binding domain and the second target-binding domain are each independently selected from the group consisting of: a soluble interleukin or cytokine protein, an antigen-binding domain, a soluble interleukin or cytokine receptor, and ligands of co-stimulatory molecules; and (ii) an IgGl antibody construct including at least one antigen-binding domain that binds specifically to the linker domain.
  • the first target-binding domain and the linker domain directly abut each other.
  • the single-chain chimeric polypeptide further comprises a linker sequence between the first target-binding domain and the linker domain. In some embodiments, the linker domain and the second target- binding domain directly abut each other. In some embodiments, the single-chain chimeric polypeptide further includes a linker sequence between the linker domain and the second target-binding domain. In some embodiments, the first target-binding domain and the second target-binding domain directly abut each other. In some embodiments, the single-chain chimeric polypeptide further includes a linker sequence between the first target-binding domain and the second target-binding domain. In some embodiments, the second target-binding domain and the linker domain directly abut each other.
  • the single-chain chimeric polypeptide further includes a linker sequence between the second target-binding domain and the linker domain.
  • the first target-binding domain and the second target-binding domain bind specifically to the same antigen.
  • the first target-binding domain and the second target-binding domain bind specifically to the same epitope.
  • the first target-binding domain and the second target-binding domain comprise the same amino acid sequence.
  • the first target-binding domain and the second target-binding domain bind specifically to different antigens.
  • one or both of the first target-binding domain and the second target- binding domain is an antigen-binding domain.
  • the first target- binding domain and the second target-binding domain are each an antigen-binding domain.
  • the antigen-binding domain comprises a scFv or a single domain antibody.
  • kits that include a single-chain chimeric polypeptide and an IgGl antibody construct, one or both of the first target-binding domain and the second target-binding domain bind to a target selected from the group consisting of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL- 10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26a, CD36, ULBP2, CD30, CD200, CD80, CD86, PD-L2, B7-H4, HVEM, ILT3, ILT4, TIGIT, MHCII, LAG3, CD272, VISTA, CD137, CD40, CD47, CD70, 0X40, IGF-1R, MUC4AC, MUC5AC, Trop-2, CMET, EGFR
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group consisting of: IL-l, IL- 2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL-18, IL-21, PDGF-DD, SCF, FLT3L,
  • the MICA, MICB, and a ULP16-binding protein are examples of the first target-binding domain and the second target-binding domain.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor.
  • the soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • TGF-b RII soluble TGF-b receptor II
  • a soluble TGF-b RIII soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble NKp46
  • a soluble DNAM-l a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • the ligand of a co-stimulatory molecule is a soluble CD80, CD86, CD40, ICOSL, CD70, OX40L, 4-1BBL, GITRL, LIGHT, TIM3, TIM4, ICAM1, LFA3, CDld, or LLT-l.
  • the linker domain is a soluble tissue factor domain.
  • the soluble tissue factor domain is a soluble human tissue factor domain.
  • the soluble human tissue factor domain includes a sequence that is at least 80% identical to SEQ ID NO: 1.
  • the soluble human tissue factor domain includes a sequence that is at least 90% identical to SEQ ID NO: 1.
  • the soluble human tissue factor domain includes a sequence that is at least 95% identical to SEQ ID NO: 1.
  • the soluble human tissue factor domain does not include one or more of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble human tissue factor domain does not include any of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble tissue factor domain is not capable of binding Factor Vila. In some embodiments, the soluble tissue factor domain does not convert inactive Factor X into Factor Xa. In some embodiments, the single-chain chimeric polypeptide does not stimulate blood coagulation in a mammal. In some embodiments of kits that include a single-chain chimeric polypeptide and an IgGl antibody construct, the IgGl antibody construct includes at least one antigen binding domain that binds specifically to the soluble tissue factor domain. In some embodiments, the linker domain is selected from the group consisting of: a kappa chain and a lambda chain.
  • the IgGl antibody construct is a monoclonal IgGl antibody, where both antigen-binding domains in the monoclonal IgGl antibody bind specifically to the linker domain.
  • the IgGl antibody construct is a bispecific IgGl antibody, where one of the two antigen-binding domains in the bispecific IgGl antibody binds specifically to the linker domain.
  • kits that include a single-chain chimeric polypeptide and an IgGl antibody construct, the single-chain chimeric polypeptide further includes one or more additional target-binding domains at its N- and/or C-terminus.
  • the single-chain chimeric polypeptide includes one or more additional target-binding domains at its N-terminus. In some embodiments, the one or more additional target-binding domains directly abuts the first target-binding domain, the second target-binding domain, or the linker domain. In some embodiments, the single chain chimeric polypeptide further includes a linker sequence between one of the at least one additional target-binding domains and the first target-binding domain, the second target-binding domain, or the linker domain. In some embodiments, the single-chain chimeric polypeptide includes one or more additional target-binding domains at its C- terminus.
  • one of the one or more additional target-binding domains directly abuts the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide further includes a linker sequence between one of the at least one additional target- binding domains and the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide includes one or more additional target binding domains at its N-terminus and the C- terminus. In some embodiments, one of the one or more additional target-binding domains at the N-terminus directly abuts the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide further includes a linker sequence between one of the one or more additional target-binding domains at the N-terminus and the first target-binding domain, the second target-binding domain, or the linker domain. In some embodiments, one of the one or more additional target-binding domains at the C-terminus directly abuts the first target-binding domain, the second target-binding domain, or the linker domain. In some embodiments, the single-chain chimeric polypeptide further includes a linker sequence between one of the one or more additional target-binding domains at the C- terminus and the first target-binding domain, the second target-binding domain, or the linker domain.
  • kits that include a single-chain chimeric polypeptide and an IgGl antibody construct, two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same antigen. In some embodiments, two or more of the first target- binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same epitope. In some embodiments, two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains comprise the same amino acid sequence.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same antigen. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same epitope. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each include the same amino acid sequence. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to different antigens.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen-binding domain.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen-binding domain.
  • the antigen-binding domain includes a scFv or a single domain antibody.
  • kits that include a single-chain chimeric polypeptide and an IgGl antibody construct, one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains bind specifically to a target selected from the group consisting of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3,
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group consisting of: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL- 18, IL-21 , PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP 16-binding protein.
  • one or more of the first target-binding domain, the second target binding domain, and the one or more additional target-binding domains is a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, a soluble CD122, a soluble CD3, or a soluble CD28.
  • TGF-b RII soluble TGF-b receptor II
  • a soluble TGF-b RIII a soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble NKp
  • the first target- binding domain and the second target-binding domain is a ligand of a co-stimulatory molecule.
  • the ligand of a co-stimulatory molecule is a soluble CD80, CD86, CD40, ICOSL, CD70, OX40L, 4-1BBL, GITRL, LIGHT, TIM3, TIM4, ICAM1, LFA3, CDld, or LLT-l.
  • the single-chain chimeric polypeptide further includes a peptide tag positioned at the N-terminal end or the C- terminal end of the single-chain chimeric polypeptide.
  • the single- chain chimeric polypeptide further includes a signal sequence at its N-terminal end.
  • the single-chain chimeric polypeptide lacks a signal sequence at its N-terminal end.
  • a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium including: (1) an effective amount of a multi-chain chimeric polypeptide that includes: (a) a first chimeric polypeptide including: (i) a first target-binding domain; (ii) a linker domain; and (iii) a first domain of a pair of affinity domains; (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target-binding domain, wherein the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains; and (2) an effective amount of an IgGl antibody construct including at least one antigen-binding domain that binds specifically to the linker domain, under conditions that allow for the activation and proliferation of the natural killer
  • the first target- binding domain and the linker domain directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence between the first target-binding domain and the linker domain in the first chimeric polypeptide.
  • the linker domain and the first domain of the pair of affinity domains directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence between the linker domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
  • the first target-binding domain and the second target-binding domain bind specifically to the same antigen.
  • the first target-binding domain and the second target-binding domain bind specifically to the same epitope.
  • the first target-binding domain and the second target-binding domain include the same amino acid sequence.
  • the first target-binding domain and the second target-binding domain bind specifically to different antigens.
  • one or both of the first target-binding domain and the second target- binding domain is an antigen-binding domain.
  • the first target- binding domain and the second target-binding domain are each antigen-binding domains.
  • the antigen-binding domain includes a scFv or a single domain antibody.
  • methods of promoting the activation and proliferation of a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium that includes first and second chimeric polypeptides and an IgGl antibody construct that includes at least one antigen-binding domain that binds specifically to a linker domain in one chimeric polypeptide, one or both of the first target- binding domain and the second target-binding domain bind specifically to a target selected from the group consisting of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26a, CD36, ULBP2, CD30, CD200, CD80, CD86, PD-L2, B7-H4, HVE
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin or cytokine protein
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group consisting of: IL-l, IL- 2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL-18, IL-21, PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP16-binding protein.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • TGF-b RII soluble TGF-b receptor II
  • a soluble TGF-b RIII soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble NKp46
  • a soluble DNAM-l a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • one or both of the first target-binding domain and the second target-binding domain is
  • the ligand of a co-stimulatory molecule is a soluble CD80, CD86, CD40, ICOSL, CD70, OX40L, 4-1BBL, GITRL, LIGHT, TIM3, TIM4, ICAM1, LFA3, CDld, or LLT-l.
  • the first chimeric polypeptide further includes one or more additional target-binding domain(s), where at least one of the one or more target-binding domain(s) is positioned between the linker domain and the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further includes a linker sequence between the linker domain and the at least one of the one or more target antigen-binding domain(s), and/or a linker sequence between the at least one of the one or more target antigen-binding domain(s) and the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further includes one or more additional target-binding domains at the N- terminal and/or C-terminal end of the first chimeric polypeptide. In some embodiments, at least one of the one or more additional target-binding domains directly abuts the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence between the at least one of the one or more additional target-binding domains and the first domain of the pair of affinity domains. In some embodiments, the at least one of the one or more additional target-binding domains directly abuts the first target-binding domain in the first chimeric polypeptide. In some embodiments, the first chimeric polypeptide further includes a linker sequence between the at least one of the one or more additional target- binding domains and the first target-binding domain.
  • At least one of the one or more additional target-binding domains is disposed at the N- and/or C- terminus of the first chimeric polypeptide, and at least one of the one or more additional target-binding domains is positioned between the linker domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the at least one additional target-binding domain of the one or more additional target-binding domains disposed at the N-terminus directly abuts the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence disposed between the at least one additional target-binding domain and the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide. In some embodiments, he at least one additional target-binding domain of the one or more additional target-binding domains disposed at the C-terminus directly abuts the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide. In some embodiments, the first chimeric polypeptide further includes a linker sequence disposed between the at least one additional target- binding domain and the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the at least one of the one or more additional target-binding domains positioned between the linker domain and the first domain of the pair of affinity domains directly abuts the linker domain and/or the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further includes a linker sequence disposed (i) between the linker domain and the at least one of the one or more additional target-binding domains positioned between the linker domain and the first domain of the pair of affinity domains, and/or (ii) between the first domain of the pair of affinity domains and the at least one of the one or more additional target-binding domains positioned between the linker domain and the first domain of the pair of affinity domains.
  • the second chimeric polypeptide further includes one or more additional target-binding domains at the N- terminal end and/or the C-terminal end of the second chimeric polypeptide. In some embodiments, at least one of the one or more additional target-binding domains directly abuts the second domain of the pair of affinity domains in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence between at least one of the one or more additional target-binding domains and the second domain of the pair of affinity domains in the second chimeric polypeptide. In some embodiments, at least one of the one or more additional target-binding domains directly abuts the second target-binding domain in the second chimeric polypeptide. In some embodiments, the second chimeric polypeptide further includes a linker sequence between at least one of the one or more additional target-binding domains and the second target-binding domain in the second chimeric polypeptide.
  • methods of promoting the activation and proliferation of a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium that includes first and second chimeric polypeptides and an IgGl antibody construct that includes at least one antigen-binding domain that binds specifically to a linker domain in one chimeric polypeptide, two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same antigen. In some embodiments, two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same epitope.
  • two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains include the same amino acid sequence. In some embodiments, the first target-binding domain, the second target- binding domain, and the one or more additional target-binding domains each bind specifically to the same antigen. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same epitope. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each comprise the same amino acid sequence.
  • first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to different antigens.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen-binding domain.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen-binding domain.
  • the antigen-binding domain includes a scFv.
  • methods of promoting the activation and proliferation of a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium that includes first and second chimeric polypeptides and an IgGl antibody construct that includes at least one antigen-binding domain that binds specifically to a linker domain in one chimeric polypeptide, one or more of the first target-binding domain, the second target-binding domain, and the one or more target binding domains bind specifically to a target selected from the group consisting of:
  • one or more of the first target binding domain, the second target-binding domain, and the one or more additional target binding domains is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group consisting of: IL-l, IL-2, IL-3, IL- 7, IL-8, IL-10, IL-12, IL-15, IL-17, IL-18, IL-21, PDGF-DD, SCF, FLT3L, MICA,
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, a soluble CD122, a soluble CD3, or a soluble CD28.
  • the first chimeric polypeptide further comprises a peptide tag at the N- terminal end or the C-terminal end of the first chimeric polypeptide.
  • the first target-binding domain and the second target-binding domain is a ligand of a co-stimulatory molecule.
  • the ligand of a co-stimulatory molecule is a soluble CD80, CD86, CD40, ICOSL, CD70, OX40L, 4-1BBL, GITRL, LIGHT, TIM3, TIM4, ICAM1, LFA3, CDld, or LLT-l.
  • the first chimeric polypeptide further comprises a peptide tag at the N-terminal end or the C-terminal end of the second chimeric polypeptide.
  • the second chimeric polypeptide further comprises a peptide tag at the N-terminal end or the C-terminal end of the second chimeric polypeptide.
  • the linker domain is a soluble tissue factor domain.
  • the soluble tissue factor domain is a soluble human tissue factor domain.
  • the soluble human tissue factor domain includes a sequence that is at least 80% identical to SEQ ID NO: 1.
  • the soluble human tissue factor domain includes a sequence that is at least 90% identical to SEQ ID NO: 1.
  • the soluble human tissue factor domain includes a sequence that is at least 95% identical to SEQ ID NO: 1. In some embodiments, the soluble human tissue factor domain does not include one or more of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble human tissue factor domain does not include any of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble tissue factor domain is not capable of binding to Factor Vila. In some embodiments, the soluble tissue factor domain does not convert inactive Factor X into Factor Xa. In some embodiments, the multi-chain chimeric polypeptide does not stimulate blood coagulation in a mammal.
  • the linker domain is selected from the group consisting of: a kappa chain and a lambda chain.
  • the IgGl antibody construct is a monoclonal IgGl antibody, where both antigen-binding domains in the monoclonal IgGl antibody bind specifically to the linker domain.
  • the IgGl antibody construct is a bispecific IgGl antibody, where one of the two antigen-binding domains in the bispecific IgGl antibody binds specifically to the linker domain.
  • the pair of affinity domains is a sushi domain from an alpha chain of human IL-15 receptor (ILl5Ra) and a soluble IL- 15.
  • the soluble IL15 has a D8N or D8A amino acid substitution.
  • the human ILl5Ra is a mature full-length ILl5Ra.
  • the pair of affinity domains is selected from the group consisting of: barnase and barnstar, a PKA and an AKAP, adapter/docking tag modules based on mutated RNase I fragments, and SNARE modules based on interactions of the proteins syntaxin, synaptotagmin, synaptobrevin, and SNAP25.
  • the first chimeric polypeptide and/or the second chimeric polypeptide further includes a signal sequence at its N-terminal end. In some embodiments, the first chimeric polypeptide and/or the second chimeric polypeptide lacks a signal sequence at its N-terminal end.
  • the contacting step is performed for a period of about 2 hours to about 20 days. In some embodiments, the contacting step is performed for a period of about 1 day to about 15 days.
  • the liquid culture medium is a serum-free liquid culture medium. In some embodiments, the liquid culture medium is a chemically-defined liquid culture medium.
  • the liquid culture medium comprises the multi-chain chimeric polypeptide and the IgGl antibody construct at a molar ratio of about 0.5: 1 to about 2: 1. In some embodiments, the liquid culture medium comprises the multi-chain chimeric polypeptide and the IgGl antibody construct at a molar ratio of about 0.8: 1 to about 1.2: 1.
  • the NK cell or T cell was previously obtained from a subject. In some embodiments, the method further includes obtaining the NK cell or T cell from the subject prior to the contacting step. In some embodiments, the NK cell or T cell has previously been genetically modified to express a chimeric antigen receptor or a recombinant T-cell receptor.
  • the method further includes, after the contacting step, introducing into the NK cell or the T cell a nucleic acid encoding a chimeric antigen-receptor or a recombinant T-cell receptor. In some embodiments, the method further includes, before the contacting step, introducing into the NK cell or the T cell a nucleic acid encoding a chimeric antigen-receptor or a recombinant T-cell receptor. In some embodiments, the method further includes, after the contacting step, isolating the NK cell or the T cell.
  • the NK cell or the T cell has an increased level of expression or secretion of one or more proteins selected from the group consisting of: TNF-a, IFN-T, granzyme A, granzyme B, perforin, 2B4, CD8, CDlla, CD16, CD25, CD27, CD48, CD49d, CD54, CD56, CD58, CD62L, CD69, CD70, CD94, CD137, CDl58a, CDl58b, CDl58e, CD178, CD226, CD253, NKG2A, NKG2C, NKG2D, LIR-l, LILR-B1, KIR2DL1, KIR3DL1, KIR2DL2, KIR2DL3, CXCR3, NKp30, NKp44, NKp46, NKG2D, DNAM-l, NKG2A, TRAIL, FasL, CXCR3, CXCR4, LTB, MX1, BAX, TNF-a, and IFN-
  • proteins selected from the group consisting of
  • methods of promoting the activation and proliferation of a natural killer cell or a T cell that include contacting a natural killer cell or a T cell in a liquid culture medium that includes first and second chimeric polypeptides and an IgGl antibody construct that includes at least one antigen-binding domain that binds specifically to a linker domain in one chimeric polypeptide, the subject has been identified or diagnosed as having an age-related disease or condition.
  • the age-related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis,
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma,
  • B-cell neoplasms multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastic and esophageal cancer, pancreatic cancer, prostate cancer, breast cancer, colorectal cancer, ovarian cancer, non-small cell lung carcinoma, squamous cell head and neck carcinoma, endometrial cancer, cervical cancer, liver cancer, and hepatocellular carcinoma
  • CLL chronic lymphocytic leukemia
  • AML acute myeloid leukemia
  • CML chronic myeloid leukemia
  • immunodeficiency virus cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, and influenza virus.
  • provided herein are activated NK cell or T cells produced by any of the methods described herein that employ multi-chain chimeric polypeptides.
  • pharmaceutical compositions that include such activated NK cells or T cell.
  • kits that include such pharmaceutical compositions.
  • methods of killing a cancer cell, an infected cell, or a senescent cell in a subject in need thereof that include administering to the subject a therapeutically effective amount of the activated NK cell or the activated T cell produced by any of the methods described herein that employ multi-chain chimeric polypeptides or the pharmaceutical composition that include such NK cells or T cell.
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastic and esoph
  • the subject has been identified or diagnosed as having an aging-related disease or condition.
  • the aging-related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis,
  • Parkinson’s disease age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerulosclerosis, liver cirrhosis, NAFLD, osteoporosis, amyotrophic lateral sclerosis, Huntington’s disease, spinocerebellar ataxia, multiple sclerosis, and renal dysfunction.
  • the methods of killing a cancer cell, an infected cell, or a senescent cell in a subject in need thereof include administering to the subject a therapeutically effective amount of the activated NK cell or the activated T cell produced by any of the methods described herein that employ multi-chain chimeric polypeptides or the pharmaceutical composition that includes such activated NK cells or T cells.
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastic and esophageal cancer, pancreatic cancer, prostate cancer, breast cancer, colorec
  • the subject has been identified or diagnosed as having an aging-related disease or condition. In some embodiments, the subject has been identified or diagnosed as having an aging-related disease or condition. In some embodiments, the aging-related disease or condition is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, ma
  • the subject has been diagnosed or identified as having an infectious disease.
  • the infectious disease is infection with human immunodeficiency virus, cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, and influenza virus.
  • kits that include: 1) a multi-chain chimeric polypeptide that includes: (a) a first chimeric polypeptide including: (i) a first target- binding domain; (ii) a linker domain; and (iii) a first domain of a pair of affinity domains; (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target-binding domain, wherein the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains; and (2) an effective amount of an IgGl antibody construct including at least one antigen-binding domain that binds specifically to the linker domain.
  • the first target-binding domain and the linker domain directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence between the first target-binding domain and the linker domain in the first chimeric polypeptide.
  • the linker domain and the first domain of the pair of affinity domains directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence between the linker domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
  • the first target-binding domain and the second target-binding domain bind specifically to the same antigen. In some embodiments, the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments, the first target-binding domain and the second target-binding domain include the same amino acid sequence. In some embodiments, the first target-binding domain and the second target-binding domain bind specifically to different antigens. In some embodiments, one or both of the first target-binding domain and the second target- binding domain is an antigen-binding domain. In some embodiments, the first target- binding domain and the second target-binding domain are each antigen-binding domains. In some embodiments, the antigen-binding domain includes a scFv or a single domain antibody.
  • kits that include a multi-chain chimeric polypeptide and an IgGl antibody construct
  • one or both of the first target-binding domain and the second target-binding domain bind specifically to a target selected from the group consisting of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26a, CD36, ULBP2, CD30, CD200, CD80, CD86, PD-L2, B7-H4, HVEM, ILT3, ILT4, TIGIT, MHCII, LAG3, CD272, VISTA, CD 137, CD40, CD47, CD70, 0X40, IGF- 1R, MUC4AC, MUC5AC, Trop-2, CMET,
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group consisting of: IL-l, IL- 2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-l 7, IL-l 8, IL-21, PDGF-DD, SCF, FLT3L,
  • the MICA, MICB, and a ULP16-binding protein are examples of the first target-binding domain and the second target-binding domain.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • TGF-b RII soluble TGF-b receptor II
  • a soluble TGF-b RIII soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble NKp46
  • a soluble DNAM-l a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • one or both of the first target-binding domain and the second target-binding domain is
  • the ligand of a co-stimulatory molecule is a soluble CD80, CD86, CD40, ICOSL, CD70, OX40L, 4-1BBL, GITRL, LIGHT, TIM3, TIM4, ICAM1, LFA3, CDld, or LLT-l.
  • the first chimeric polypeptide further includes one or more additional target-binding domain(s), where at least one of the one or more target-binding domain(s) is positioned between the linker domain and the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further includes a linker sequence between the linker domain and the at least one of the one or more target antigen-binding domain(s), and/or a linker sequence between the at least one of the one or more target antigen-binding domain(s) and the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further includes one or more additional target-binding domains at the N-terminal and/or C-terminal end of the first chimeric polypeptide. In some embodiments, at least one of the one or more additional target-binding domains directly abuts the first domain of the pair of affinity domains in the first chimeric polypeptide. In some embodiments, the first chimeric polypeptide further includes a linker sequence between the at least one of the one or more additional target-binding domains and the first domain of the pair of affinity domains. In some embodiments, the at least one of the one or more additional target-binding domains directly abuts the first target-binding domain in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence between the at least one of the one or more additional target-binding domains and the first target- binding domain. In some embodiments, at least one of the one or more additional target- binding domains is disposed at the N- and/or C-terminus of the first chimeric
  • the first chimeric polypeptide further includes a linker sequence disposed between the at least one additional target-binding domain and the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the at least one additional target-binding domain of the one or more additional target- binding domains disposed at the C-terminus directly abuts the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence disposed between the at least one additional target-binding domain and the first target- binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the at least one of the one or more additional target- binding domains positioned between the linker domain and the first domain of the pair of affinity domains directly abuts the linker domain and/or the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further includes a linker sequence disposed (i) between the linker domain and the at least one of the one or more additional target-binding domains positioned between the linker domain and the first domain of the pair of affinity domains, and/or (ii) between the first domain of the pair of affinity domains and the at least one of the one or more additional target-binding domains positioned between the linker domain and the first domain of the pair of affinity domains.
  • the second chimeric polypeptide further includes one or more additional target-binding domains at the N-terminal end or the C-terminal end of the second chimeric polypeptide. In some embodiments, at least one of the one or more additional target-binding domains directly abuts the second domain of the pair of affinity domains in the second chimeric polypeptide. In some embodiments, the second chimeric polypeptide further includes a linker sequence between at least one of the one or more additional target-binding domains and the second domain of the pair of affinity domains in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence between at least one of the one or more additional target-binding domains and the second target-binding domain in the second chimeric polypeptide.
  • kits that include a multi -chain chimeric polypeptide and an IgGl antibody construct, two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same antigen. In some embodiments, two or more of the first target- binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same epitope. In some two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains include the same amino acid sequence.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same antigen. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same epitope. In some embodiments, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each include the same amino acid sequence. In some embodiments, the first target-binding domain, the second target- binding domain, and the one or more additional target-binding domains bind specifically to different antigens.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen-binding domain.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen-binding domain.
  • the antigen-binding domain includes a scFv.
  • kits that include a multi -chain chimeric polypeptide and an IgGl antibody construct, one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains bind specifically to a target selected from the group consisting of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26a, CD36, ULBP2, CD30, CD200, CD80, CD86, PD-L2, B7-H4, HVEM, ILT3, ILT4, TIGIT, MHCII, LAG3, CD272, VISTA, CD137, CD40, CD47, CD70, 0X40, IGF-1R, MUC4AC,
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface receptor is selected from the group consisting of: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL- 12, IL-l 5, IL-l 7, IL-18, IL-21, PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULPl6- binding protein.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, a soluble CD122, a soluble CD3, or a soluble CD28.
  • TGF-b RII soluble TGF-b receptor II
  • a soluble TGF-b RIII a soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble
  • one or both of the first target-binding domain and the second target binding domain is a ligand of a co-stimulatory molecule.
  • the ligand of a co-stimulatory molecule is a soluble CD80, CD86, CD40, ICOSL, CD70, OX40L, 4-1BBL, GITRL, LIGHT, TIM3, TIM4, ICAM1, LFA3, CDld, or LLT-l.
  • the linker domain is a soluble tissue factor domain.
  • the soluble tissue factor domain is a soluble human tissue factor domain.
  • the soluble human tissue factor domain includes a sequence that is at least 80% identical to SEQ ID NO: 1. In some embodiments, the soluble human tissue factor domain includes a sequence that is at least 90% identical to SEQ ID NO: 1. In some embodiments, the soluble human tissue factor domain includes a sequence that is at least 95s% identical to SEQ ID NO: 1.
  • the soluble human tissue factor domain does not include one or more of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble human tissue factor domain does not include any of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble tissue factor domain is not capable of binding to Factor Vila. In some embodiments, the soluble tissue factor domain does not convert inactive Factor X into Factor Xa. In some embodiments, the multi-chain chimeric polypeptide does not stimulate blood coagulation in a mammal.
  • kits that include a multi -chain chimeric polypeptide and an IgGl antibody construct
  • the IgGl antibody construct includes at least one antigen binding domain that binds specifically to the soluble tissue factor domain.
  • the linker domain is selected from the group consisting of: a kappa chain and a lambda chain.
  • the IgGl antibody construct is a monoclonal IgGl antibody, where both antigen-binding domains in the monoclonal IgGl antibody bind specifically to the linker domain.
  • the IgGl antibody construct is a bispecific IgGl antibody, where one of the two antigen-binding domains in the bispecific IgGl antibody binds specifically to the linker domain.
  • kits that include a multi-chain chimeric polypeptide and an IgGl antibody construct
  • the pair of affinity domains is a sushi domain from an alpha chain of human IL-15 receptor (ILl5Ra) and a soluble IL-15.
  • the soluble IL15 has a D8N or D8A amino acid substitution.
  • the human ILl5Ra is a mature full-length ILl5Ra.
  • the pair of affinity domains is selected from the group consisting of: barnase and barnstar, a PKA and an AKAP, adapter/docking tag modules based on mutated RNase I fragments, and SNARE modules based on interactions of the proteins syntaxin, synaptotagmin, synaptobrevin, and SNAP25.
  • the first chimeric polypeptide and/or the second chimeric polypeptide further include a signal sequence at its N-terminal end. In some embodiments, the first chimeric polypeptide and/or the second chimeric polypeptide lacks a signal sequence at its N-terminal end.
  • the first chimeric polypeptide and/or the second chimeric polypeptide further include a signal sequence at its N-terminal end. In some embodiments, the first chimeric polypeptide and/or the second chimeric polypeptide lacks a signal sequence at its N-terminal end.
  • Also provided herein are methods of increasing the glucose consumption of an immune cell that include: contacting an immune cell in a liquid culture medium including an effective amount of (i) a single-chain chimeric polypeptide including a first target- binding domain, a linker domain, and a second target-binding domain, and optionally (ii) an IgGl antibody construct that includes at least one antigen-binding domain that binds specifically to the linker domain, under conditions that allow for glucose consumption in the immune cell, where the first target-binding domain and the second target-binding domain are each independently selected from the group of: a soluble interleukin, soluble cytokine protein, or soluble cell surface protein, an antigen-binding domain, a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor, and ligands of co-stimulatory molecules.
  • Also provided herein are methods of increasing the oxidative phosphorylation of an immune cell that include: contacting an immune cell in a liquid culture medium including an effective amount of (i) a single-chain chimeric polypeptide including a first target-binding domain, a linker domain, and a second target-binding domain, and optionally (ii) an IgGl antibody construct that includes at least one antigen-binding domain that binds specifically to the linker domain, under conditions that allow for oxidative phosphorylation in the immune cell, where the first target-binding domain and the second target-binding domain are each independently selected from the group of: a soluble interleukin, soluble cytokine protein, or soluble cell surface protein, an antigen- binding domain, a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor, and ligands of co-stimulatory molecules.
  • Also provided herein are methods of increasing the aerobic glycolysis of an immune cell that include: contacting an immune cell in a liquid culture medium including an effective amount of (i) a single-chain chimeric polypeptide including a first target- binding domain, a linker domain, and a second target-binding domain, and optionally (ii) an IgGl antibody construct that includes at least one antigen-binding domain that binds specifically to the linker domain, under conditions that allow for aerobic glycolysis in the immune cell, where the first target-binding domain and the second target-binding domain are each independently selected from the group of: a soluble interleukin, soluble cytokine protein, or soluble cell surface protein, an antigen-binding domain, a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor, and ligands of co stimulatory molecules.
  • Also provided herein are methods of increasing the extracellular acidification rate (ECAR) of an immune cell that include: contacting an immune cell in a liquid culture medium including an effective amount of (i) a single-chain chimeric polypeptide including a first target-binding domain, a linker domain, and a second target-binding domain, and optionally (ii) an IgGl antibody construct that includes at least one antigen binding domain that binds specifically to the linker domain, under conditions that allow for extracellular acidification by the immune cell, where the first target-binding domain and the second target-binding domain are each independently selected from the group of: a soluble interleukin, soluble cytokine protein, or soluble cell surface protein, an antigen binding domain, a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor, and ligands of co-stimulatory molecules.
  • Also provided herein are methods of increasing the mitochondrial oxygen consumption rate of an immune cell that include: contacting an immune cell in a liquid culture medium including an effective amount of (i) a single-chain chimeric polypeptide including a first target-binding domain, a linker domain, and a second target-binding domain, and optionally (ii) an IgGl antibody construct that includes at least one antigen- binding domain that binds specifically to the linker domain, under conditions that allow for mitochondrial oxygen consumption rate by the immune cell, where the first target- binding domain and the second target-binding domain are each independently selected from the group of: a soluble interleukin, soluble cytokine protein, or soluble cell surface protein, an antigen-binding domain, a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor, and ligands of co-stimulatory molecules.
  • the liquid culture medium includes the single-chain chimeric polypeptide and the IgGl antibody construct.
  • the IgGl antibody construct is a monoclonal IgGl antibody, where both of the antigen-binding domains in the monoclonal IgGl antibody bind specifically to the linker domain.
  • the IgGl antibody construct is a bispecific IgGl antibody, where one of the two antigen-binding domains in the bispecific IgGl antibody binds specifically to the linker domain.
  • the contacting step is performed for a period of about 2 hours to about 20 days (e.g., about 1 day to about 15 days).
  • the liquid culture medium is a serum-free liquid culture medium.
  • the liquid culture medium is a chemically-defined liquid culture medium.
  • the liquid culture medium includes serum.
  • the liquid culture medium includes the single-chain chimeric polypeptide and the IgGl antibody construct at a molar ratio of about 0.5: 1 to about 2: 1 (e.g., about 0.8: 1 to about 1.2: 1).
  • the first target binding domain and the linker domain directly abut each other.
  • the single-chain chimeric polypeptide further comprises a linker sequence between the first target-binding domain and the linker domain.
  • the linker domain and the second target-binding domain directly abut each other.
  • the single-chain chimeric polypeptide further includes a linker sequence between the linker domain and the second target-binding domain.
  • the first target- binding domain and the second target-binding domain directly abut each other.
  • the single-chain chimeric polypeptide further includes a linker sequence between the first target-binding domain and the second target-binding domain. In some embodiments of any of the methods described herein, the second target-binding domain and the linker domain directly abut each other. In some embodiments of any of the methods described herein, the single-chain chimeric polypeptide further includes a linker sequence between the second target-binding domain and the linker domain.
  • the first target- binding domain and the second target-binding domain bind specifically to the same antigen. In some embodiments of any of the methods described herein, the first target- binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of any of the methods described herein, the first target- binding domain and the second target-binding domain include the same amino acid sequence. In some embodiments of any of the methods described herein, the first target- binding domain and the second target-binding domain bind specifically to different antigens.
  • one or both of the first target-binding domain and the second target-binding domain is an antigen-binding domain.
  • the first target- binding domain and the second target-binding domain are each an antigen-binding domain.
  • the antigen binding domain includes a scFv or a single domain antibody.
  • one or both of the first target-binding domain and the second target-binding domain bind to a target selected from the group of: CDl6a, CD28, CD3, CD33, CD20, CD 19, CD22, CD52, CD 123, IL- 1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26a, CD36, ULBP2, CD30, CD200, CD80, CD86, PD-L2, B7-H4, HVEM, ILT3, ILT4, TIGIT, MHCII, LAG3, CD272, VISTA, CD 137, CD40,
  • a target selected from the group of: CDl6a, CD28, CD3, CD33, CD20, CD 19, CD22, CD52, CD 123, IL- 1R, IL-l, VEGF, IL-6R,
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group consisting of: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL-l 2, IL-15, IL-l 7, IL-18, IL-21, PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP16-binding protein.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor.
  • the soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • TGF-b RII soluble TGF-b receptor II
  • a soluble TGF-b RIII soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble NKp46
  • a soluble DNAM-l a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • the linker domain is a soluble tissue factor domain. In some embodiments of any of the methods described herein, the soluble tissue factor domain is a soluble human tissue factor domain. In some embodiments of any of the methods described herein, the soluble human tissue factor domain comprises a sequence that is at least 80% identical, at least 90% identical, or at least 95% identical to SEQ ID NO: 1.
  • the soluble human tissue factor domain does not include one or more of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble human tissue factor domain does not include any of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble tissue factor domain is not capable of binding Factor Vila. In some embodiments of any of the methods described herein, the soluble tissue factor domain does not convert inactive Factor X into Factor Xa. In some embodiments of any of the methods described herein, the single-chain chimeric polypeptide does not stimulate blood coagulation in a mammal. In some embodiments of any of the methods described herein, the IgGl antibody construct includes at least one antigen-binding domain that binds specifically to the soluble tissue factor domain. In some embodiments of any of the methods described herein, the linker domain is selected from the group of: a kappa chain and a lambda chain.
  • the IgGl antibody construct is a monoclonal IgGl antibody, where both of the antigen-binding domains in the monoclonal IgGl antibody bind specifically to the linker domain. In some embodiments of any of the methods described herein, the IgGl antibody construct is a bispecific IgGl antibody, where one of the two antigen-binding domains in the bispecific IgGl antibody binds specifically to the linker domain.
  • the single-chain chimeric polypeptide further includes one or more additional target-binding domains at its N- and/or C-terminus. In some embodiments of any of the methods described herein, the single-chain chimeric polypeptide includes one or more additional target-binding domains at its N-terminus. In some embodiments of any of the methods described herein, one or more additional target-binding domains directly abuts the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide further includes a linker sequence between one of the at least one additional target-binding domains and the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide includes one or more additional target-binding domains at its C- terminus. In some embodiments of any of the methods described herein, one of the one or more additional target-binding domains directly abuts the first target-binding domain, the second target-binding domain, or the linker domain. In some embodiments of any of the methods described herein, the single-chain chimeric polypeptide further includes a linker sequence between one of the at least one additional target-binding domains and the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide includes one or more additional target binding domains at its N- terminus and the C-terminus. In some embodiments of any of the methods described herein, one of the one or more additional target-binding domains at the N-terminus directly abuts the first target-binding domain, the second target-binding domain, or the linker domain. In some embodiments of any of the methods described herein, the single- chain chimeric polypeptide further includes a linker sequence between one of the one or more additional target-binding domains at the N-terminus and the first target-binding domain, the second target-binding domain, or the linker domain.
  • one of the one or more additional target-binding domains at the C-terminus directly abuts the first target-binding domain, the second target-binding domain, or the linker domain.
  • the single-chain chimeric polypeptide further includes a linker sequence between one of the one or more additional target-binding domains at the C- terminus and the first target-binding domain, the second target-binding domain, or the linker domain.
  • two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same antigen. In some embodiments of any of the methods described herein, two or more of the first target- binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same epitope. In some embodiments of any of the methods described herein, two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains include the same amino acid sequence.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same antigen. In some embodiments of any of the methods described herein, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same epitope. In some embodiments of any of the methods described herein, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each include the same amino acid sequence. In some embodiments of any of the methods described herein, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to different antigens.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen-binding domain.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen binding domain.
  • the antigen-binding domain includes a scFv or a single domain antibody.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains bind specifically to a target selected from the group of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL- 10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26a, CD36, ULBP2, CD30, CD200, CD80, CD86, PD-L2, B7-H4, HVEM, ILT3, ILT4,
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group of: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL- 18, IL-21, PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP16-binding protein.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor.
  • the soluble interleukin, soluble cytokine receptor, or soluble cell surface receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, a soluble CD122, a soluble CD3, or a soluble CD28.
  • TGF-b RII soluble TGF-b receptor II
  • a soluble TGF-b RIII soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble NKp46
  • a soluble DNAM-l a scMHCI, a scMHCII, a scTCR
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a ligand of a co-stimulatory molecule.
  • the ligand of a co- stimulatory molecule is a soluble CD80, CD86, CD40, ICOSL, CD70, OX40L, 4-1BBL, GITRL, LIGHT, TIM3, TIM4, ICAM1, LFA3, CDld, or LLT-l.
  • the single-chain chimeric polypeptide further includes a peptide tag positioned at the N-terminal end or the C-terminal end of the single-chain chimeric polypeptide.
  • the immune cell was previously obtained from a subject. Some embodiments of any of the methods described herein further include obtaining the immune cell from the subject prior to the contacting step. In some embodiments of any of the methods described herein, the immune cell has previously been genetically modified to express a chimeric antigen receptor or a recombinant T-cell receptor.
  • Some embodiments of any of the methods described herein further include, after the contacting step, introducing into the immune cell a nucleic acid encoding a chimeric antigen-receptor or a recombinant T-cell receptor. Some embodiments of any of the methods described herein further include, before the contacting step, introducing into the immune cell a nucleic acid encoding a chimeric antigen-receptor or a
  • Some embodiments of any of the methods described herein further include, after the contacting step, isolating the immune cell. In some
  • the immune cell after the contacting step, has an increased level of expression or secretion of one or more proteins selected from the group of: TNF-a, IFN-T, granzyme A, granzyme B, perforin, 2B4,
  • CD8 CDl la, CD16, CD25, CD27, CD48, CD49d, CD54, CD56, CD58, CD62L, CD69, CD70, CD94, CD137, CDl58a, CDl58b, CDl58e, CD178, CD226, CD253, NKG2A, NKG2C, NKG2D, LIR-l, LILR-B1, KIR2DL1, KIR3DL1, KIR2DL2, KIR2DL3, CXCR3, NKp30, NKp44, NKp46, NKG2D, DNAM-l, NKG2A, TRAIL, FasL, CXCR3, CXCR4, LTB, MX1, BAX, TNF-a, and IFN-g as compared to the level of expression or secretion of the one or more proteins prior to the contacting step administering the immune cell to a subject in need thereof.
  • the subject has been identified or diagnosed as having an age-related disease or condition.
  • the age-related disease or condition is selected from the group of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerulo
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma,
  • the subject has been diagnosed or identified as having an infectious disease.
  • the infectious disease is infection with human immunodeficiency virus, cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, or influenza virus.
  • activated immune cells produced by any of the methods described herein.
  • pharmaceutical compositions that include any of the activated immune cells produced by any of the methods described herein.
  • kits that include a pharmaceutical composition including any of the activated immune cells described herein produced by any of the methods described herein.
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastic and esophageal cancer, pancreatic cancer, prostate cancer,
  • CLL chronic lymphocytic leuk
  • the subject has been identified or diagnosed as having an aging-related disease or condition.
  • the aging-related disease or condition is selected from the group of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerular fibrosis, fibrosis in pancreatitis, glaucoma,
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non- Hodgkin’s lymphoma, Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastic and esophageal cancer, pancreatic cancer, prostate cancer,
  • the subject has been identified or diagnosed as having an aging-related disease or condition.
  • the aging-related disease or condition is selected from the group of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerular fibrosis, fibrosis in pancreatitis, glaucoma,
  • the subject has been diagnosed or identified as having an infectious disease.
  • the infectious disease is infection with human immunodeficiency virus, cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, or influenza virus.
  • Also provided herein are methods of increasing the glucose consumption of an immune cell that include: contacting an immune cell in a liquid culture medium including (1) an effective amount of a multi-chain chimeric polypeptide including: (a) a first chimeric polypeptide including: (i) a first target-binding domain; (ii) a linker domain; and (iii) a first domain of a pair of affinity domains; (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target binding domain, where the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains; and (2) an effective amount of an IgGl antibody construct including at least one antigen-binding domain that binds specifically to the linker domain, under conditions that allow for glucose consumption in the immune cell.
  • a multi-chain chimeric polypeptide including: (a) a first chimeric poly
  • Also provided herein are methods of increasing the oxidative phosphorylation of an immune cell that include: contacting an immune cell in a liquid culture medium including (1) an effective amount of a multi-chain chimeric polypeptide including: (a) a first chimeric polypeptide including: (i) a first target-binding domain; (ii) a linker domain; and (iii) a first domain of a pair of affinity domains; (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target-binding domain, where the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains; and (2) an effective amount of an IgGl antibody construct including at least one antigen-binding domain that binds specifically to the linker domain, under conditions that allow for oxidative phosphorylation in the immune cell.
  • a multi-chain chimeric polypeptide
  • Also provided herein are methods of increasing the aerobic glycolysis of an immune cell that include: contacting an immune cell in a liquid culture medium including (1) an effective amount of a multi-chain chimeric polypeptide including: (a) a first chimeric polypeptide including: (i) a first target-binding domain; (ii) a linker domain; and (iii) a first domain of a pair of affinity domains; (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target binding domain, where the first chimeric polypeptide and the second chimeric
  • polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains; and (2) an effective amount of an IgGl antibody construct including at least one antigen-binding domain that binds specifically to the linker domain, under conditions that allow for aerobic glycolysis in the immune cell.
  • Also provided herein are methods of increasing the extracellular acidification rate (ECAR) of an immune cell that include: contacting an immune cell in a liquid culture medium including (1) an effective amount of a multi-chain chimeric polypeptide including: (a) a first chimeric polypeptide including: (i) a first target-binding domain; (ii) a linker domain; and (iii) a first domain of a pair of affinity domains; (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target-binding domain, where the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains; and (2) an effective amount of an IgGl antibody construct including at least one antigen-binding domain that binds specifically to the linker domain, under conditions that allow for extracellular acidification by the immune cell.
  • a multi-chain chimeric polypeptide including
  • Also provided herein are methods of increasing the mitochondrial oxygen consumption rate of an immune cell that include: contacting an immune cell in a liquid culture medium including (1) an effective amount of a multi-chain chimeric polypeptide including: (a) a first chimeric polypeptide including: (i) a first target-binding domain; (ii) a linker domain; and (iii) a first domain of a pair of affinity domains; (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target-binding domain, where the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains; and (2) an effective amount of an IgGl antibody construct including at least one antigen-binding domain that binds specifically to the linker domain, under conditions that allow for mitochondrial oxygen consumption rate by the immune cell.
  • a multi-chain chimeric polypeptide including: (a
  • the liquid culture medium includes the single-chain chimeric polypeptide and the IgGl antibody construct.
  • the IgGl antibody construct is a monoclonal IgGl antibody, where both of the antigen-binding domains in the monoclonal IgGl antibody bind specifically to the linker domain.
  • the IgGl antibody construct is a bispecific IgGl antibody, where one of the two antigen-binding domains in the bispecific IgGl antibody binds specifically to the linker domain.
  • the contacting step is performed for a period of about 2 hours to about 20 days (e.g., about 1 day to about 15 days).
  • the liquid culture medium is a serum-free liquid culture medium. In some embodiments of any of the methods described herein, the liquid culture medium is a chemically-defined liquid culture medium. In some embodiments of any of the methods described herein, the liquid culture medium includes serum. In some embodiments of any of the methods described herein, the liquid culture medium includes the single-chain chimeric polypeptide and the IgGl antibody construct at a molar ratio of about 0 5: 1 to about 2: 1 (e.g., about 0 8: 1 to about 1.2: 1).
  • the first target- binding domain and the linker domain directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence between the first target-binding domain and the linker domain in the first chimeric polypeptide.
  • the linker domain and the first domain of the pair of affinity domains directly abut each other in the first chimeric polypeptide.
  • the first chimeric polypeptide further comprises a linker sequence between the linker domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric
  • the second chimeric polypeptide further includes a linker sequence between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
  • the first target- binding domain and the second target-binding domain bind specifically to the same antigen. In some embodiments of any of the methods described herein, the first target- binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of any of the methods described herein, the first target- binding domain and the second target-binding domain include the same amino acid sequence. In some embodiments of any of the methods described herein, the first target- binding domain and the second target-binding domain bind specifically to different antigens. In some embodiments of any of the methods described herein, one or both of the first target-binding domain and the second target-binding domain is an antigen-binding domain.
  • the first target- binding domain and the second target-binding domain are each antigen-binding domains.
  • the antigen-binding domain comprises a scFv or a single domain antibody.
  • one or both of the first target-binding domain and the second target-binding domain bind specifically to a target selected from the group of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa,
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group of: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL- 12, IL-l 5, IL-l 7, IL-18, IL-21, PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP16- binding protein.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble
  • NKp30 a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • the first chimeric polypeptide further includes one or more additional target-binding domain(s), where at least one of the one or more target-binding domain(s) is positioned between the linker domain and the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further includes a linker sequence between the linker domain and the at least one of the one or more target antigen-binding domain(s), and/or a linker sequence between the at least one of the one or more target antigen-binding domain(s) and the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further comprises one or more additional target-binding domains at the N- terminal and/or C-terminal end of the first chimeric polypeptide. In some embodiments of any of the methods described herein, at least one of the one or more additional target binding domains directly abuts the first domain of the pair of affinity domains in the first chimeric polypeptide. In some embodiments of any of the methods described herein, the first chimeric polypeptide further includes a linker sequence between the at least one of the one or more additional target-binding domains and the first domain of the pair of affinity domains.
  • the at least one of the one or more additional target-binding domains directly abuts the first target-binding domain in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence between the at least one of the one or more additional target-binding domains and the first target-binding domain.
  • At least one of the one or more additional target-binding domains is disposed at the N- and/or C-terminus of the first chimeric polypeptide, and at least one of the one or more additional target-binding domains is positioned between the linker domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the at least one additional target-binding domain of the one or more additional target-binding domains disposed at the N-terminus directly abuts the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence disposed between the at least one additional target- binding domain and the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the at least one additional target-binding domain of the one or more additional target-binding domains disposed at the C-terminus directly abuts the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the first chimeric polypeptide further includes a linker sequence disposed between the at least one additional target-binding domain and the first target-binding domain or the first domain of the pair of affinity domains in the first chimeric polypeptide.
  • the at least one of the one or more additional target-binding domains positioned between the linker domain and the first domain of the pair of affinity domains directly abuts the linker domain and/or the first domain of the pair of affinity domains.
  • the first chimeric polypeptide further includes a linker sequence disposed (i) between the linker domain and the at least one of the one or more additional target-binding domains positioned between the linker domain and the first domain of the pair of affinity domains, and/or (ii) between the first domain of the pair of affinity domains and the at least one of the one or more additional target-binding domains positioned between the linker domain and the first domain of the pair of affinity domains.
  • the second chimeric polypeptide further includes one or more additional target-binding domains at the N-terminal end and/or the C-terminal end of the second chimeric polypeptide. In some embodiments of any of the methods described herein, at least one of the one or more additional target-binding domains directly abuts the second domain of the pair of affinity domains in the second chimeric polypeptide. In some embodiments of any of the methods described herein, the second chimeric polypeptide further includes a linker sequence between at least one of the one or more additional target-binding domains and the second domain of the pair of affinity domains in the second chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence between at least one of the one or more additional target-binding domains and the second target-binding domain in the second chimeric polypeptide.
  • two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same antigen. In some embodiments of any of the methods described herein, two or more of the first target- binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same epitope. In some embodiments of any of the methods described herein, two or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains include the same amino acid sequence.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same antigen. In some embodiments of any of the methods described herein, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same epitope. In some embodiments of any of the methods described herein, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each include the same amino acid sequence.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to different antigens.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen-binding domain.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen binding domain.
  • the antigen-binding domain comprises a scFv.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains bind specifically to a target selected from the group of: CDl6a, CD28, CD3, CD33, CD20, CD19, CD22, CD123, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL- 10, PDL-l, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26a, CD36, ULBP2, CD30, CD200, CD80, CD86, PD-L2, B7-H4, HVEM, ILT3, ILT4, TIGIT, MHCII, LAG3, CD272, VISTA, CD137, CD40, CD47, CD70, 0X40, IGF-1R, MUC4AC, MUC5AC, Trop-2, CMET, EGFR, HER1,
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group of: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL- 18, IL-21, PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP16-binding protein.
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains is a soluble interleukin receptor, soluble cytokine receptor, or soluble cell surface receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, a soluble CD 122, a soluble CD3, or a soluble CD28.
  • TGF-b RII soluble TGF-b receptor II
  • a soluble TGF-b RIII a soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble NKp46
  • a soluble DNAM-l a scMHCI, a scMHCII, a scTCR
  • a soluble CD155 a soluble CD 122, a soluble CD3,
  • the first chimeric polypeptide further includes a peptide tag at the N-terminal end or the C-terminal end of the first chimeric polypeptide.
  • the second chimeric polypeptide further includes a peptide tag at the N-terminal end or the C-terminal end of the second chimeric polypeptide.
  • the linker domain is a soluble tissue factor domain. In some embodiments of any of the methods described herein, the soluble tissue factor domain is a soluble human tissue factor domain. In some embodiments of any of the methods described herein, the soluble human tissue factor domain includes a sequence that is at least 80% identical, at least 90% identical, or at least 95% identical to SEQ ID NO: 1.
  • the soluble human tissue factor domain does not include one or more of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble human tissue factor domain does not include any of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • the soluble tissue factor domain is not capable of binding to Factor Vila. In some embodiments of any of the methods described herein, the soluble tissue factor domain does not convert inactive Factor X into Factor Xa. In some embodiments of any of the methods described herein, the multi-chain chimeric polypeptide does not stimulate blood coagulation in a mammal. In some embodiments of any of the methods described herein, the IgGl antibody construct includes at least one antigen-binding domain that binds specifically to the soluble tissue factor domain. In some embodiments of any of the methods described herein, the linker domain is selected from the group of: a kappa chain and a lambda chain.
  • the IgGl antibody construct is a monoclonal IgGl antibody, where both antigen-binding domains in the monoclonal IgGl antibody bind specifically to the linker domain. In some embodiments of any of the methods described herein, the IgGl antibody construct is a bispecific IgGl antibody, where one of the two antigen-binding domains in the bispecific IgGl antibody binds specifically to the linker domain.
  • the pair of affinity domains is a sushi domain from an alpha chain of human IL-15 receptor (ILl5Ra) and a soluble IL-15.
  • the soluble IL15 has a D8N or D8A amino acid substitution.
  • the human ILl5Ra is a mature full-length ILl5Ra.
  • the pair of affinity domains is selected from the group consisting of: bamase and barnstar, a PKA and an AKAP, adapter/docking tag modules based on mutated RNase I fragments, and SNARE modules based on interactions of the proteins syntaxin, synaptotagmin, synaptobrevin, and SNAP25.
  • the first chimeric polypeptide and/or the second chimeric polypeptide further includes a signal sequence at its N-terminal end. In some embodiments of any of the methods described herein, the first chimeric polypeptide and/or the second chimeric polypeptide lacks a signal sequence at its N-terminal end.
  • the immune cell was previously obtained from a subject. Some embodiments of any of the methods described herein further include obtaining the immune cell from the subject prior to the contacting step. In some embodiments of any of the methods described herein, the immune cell has previously been genetically modified to express a chimeric antigen receptor or a recombinant T-cell receptor. Some embodiments of any of the methods described herein further include, after the contacting step, introducing into the immune cell a nucleic acid encoding a chimeric antigen-receptor or a recombinant T-cell receptor.
  • Some embodiments of any of the methods described herein further include, before the contacting step, introducing into the immune cell a nucleic acid encoding a chimeric antigen-receptor or a recombinant T-cell receptor. Some embodiments of any of the methods described herein further include, after the contacting step, isolating the immune cell.
  • the immune cell after the contacting step, has an increased level of expression or secretion of one or more proteins selected from the group of: TNF-a, IFN-Y, granzyme A, granzyme B, perforin, 2B4, CD8, CDl la, CD16, CD25, CD27, CD48, CD49d, CD54, CD56, CD58, CD62L, CD69, CD70, CD94, CD137, CDl58a, CDl58b, CDl58e, CD178, CD226, CD253,
  • Some embodiments of any of the methods described herein further include, after the contacting step, administering the immune cell to a subject in need thereof.
  • the subject has been identified or diagnosed as having an age-related disease or condition.
  • the age-related disease or condition is selected from the consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerul
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma,
  • the subject has been diagnosed or identified as having an infectious disease.
  • the infectious disease is infection with human immunodeficiency virus, cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, or influenza virus.
  • activated immune cells produced using any of the methods described herein.
  • pharmaceutical compositions that include any of the activated immune cells described herein produced by any of the methods described herein.
  • kits that include any of the pharmaceutical compositions described herein that include any of the activated immune cells described herein produced by any of the methods described herein.
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma,
  • the subject has been identified or diagnosed as having an aging-related disease or condition.
  • the aging-related disease or condition is selected from the group of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerular fibrosis, fibrosis in pancreatitis, glaucoma,
  • the subject has been identified or diagnosed as having a cancer.
  • the cancer is selected from the group of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non- Hodgkin’s lymphoma, Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastic and esophageal cancer, pancreatic cancer, prostate cancer,
  • the subject has been identified or diagnosed as having an aging-related disease or condition.
  • the aging-related disease or condition is selected from the group of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis,
  • inflammatory bowel disease intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerulosclerosis, liver cirrhosis, NAFLD, osteoporosis, amyotrophic lateral sclerosis, Huntington’s disease,
  • the subject has been diagnosed or identified as having an infectious disease.
  • the infectious disease is infection with human immunodeficiency virus, cytomegalovirus, adenovirus, coronavirus, rhinovirus, rotavirus, smallpox, herpes simplex virus, hepatitis B virus, hepatitis A virus, and hepatitis C virus, papillomavirus, or influenza virus.
  • the soluble human tissue factor domain does not stimulate blood coagulation. In some embodiments of any of the methods or kits described herein, the soluble tissue factor domain comprises or consists of a sequence from a wildtype soluble human tissue factor (or any sequence therefrom).
  • Also provided herein are methods of inducing differentiation of an immune cell into a memory or memory -like immune cell that include contacting an immune cell in a liquid culture medium including: (1) an effective amount of a multi-chain chimeric polypeptide comprising: (a) a first chimeric polypeptide including: (i) a first target binding domain; (ii) a linker domain; and (iii) a first domain of a pair of affinity domains; (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target-binding domain, where the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains; and (2) an effective amount of an IgGl antibody construct including at least one antigen-binding domain that binds specifically to the linker domain.
  • a multi-chain chimeric polypeptide comprising: (a) a first chimeric
  • Also provided herein are methods of inducing differentiation of an immune cell into a memory or memory -like immune cell that include contacting an immune cell in a liquid culture medium including an effective amount of (i) a single-chain chimeric polypeptide including a first target-binding domain, a linker domain, and a second target binding domain, and (ii) an IgGl antibody construct that includes at least one antigen- binding domain that binds specifically to the linker domain.
  • the immune cell was previously obtained from a subject.
  • the immune cell is selected from the group c of: an immature thymocyte, a periperhal blood Treg cell, a Thl7 cell, a Th22 cell, a Th9 cell, a Th2 cell, a Thl cell, a Th3 cell, ld T cell, an ab T cell, a tumor-infiltrating T cell, a CD8 + T cell, a CD4 + T cell, a natural killer T cell, a mast cell, a macrophage, a neutrophil, a dendritic cell, a basophil, an eosinophil, and a natural killer cell.
  • the immune cell has previously been genetically modified to express a chimeric antigen receptor or a recombinant T-cell receptor.
  • Some embodiments of any of the methods described herein further include, after the contacting step, introducing into the immune cell a nucleic acid encoding a chimeric antigen-recpetor or a recombinant T-cell receptor. Some embodiments of any of the methods described herein further include administering to the immune cell to a subject in need thereof.
  • a chimeric polypeptide refers to a polypeptide that includes amino acid sequences (e.g., domains) originally derived from two different sources (e.g., two different naturally-occurring proteins, e.g., from the same or different species).
  • a chimeric polypeptide can include domains from at least two different naturally occurring human proteins.
  • a chimeric polypeptide can include a domain that is a synthetic sequence (e.g., a scFv) and a domain that is derived from a naturally-occurring protein (e.g., a naturally-occurring human protein).
  • a chimeric polypeptide can include at least two different domains that are synthetic sequences (e.g., two different scFvs).
  • an“antigen-binding domain” is one or more protein domain(s) (e.g., formed from amino acids from a single polypeptide or formed from amino acids from two or more polypeptides (e.g., the same or different polypeptides) that is capable of specifically binding to one or more different antigen(s).
  • an antigen-binding domain can bind to an antigen or epitope with specificity and affinity similar to that of naturally-occurring antibodies.
  • the antigen-binding domain can be an antibody or a fragment thereof.
  • an antigen-binding domain can include an alternative scaffold. Non-limiting examples of antigen-binding domains are described herein. Additional examples of antigen-binding domains are known in the art.
  • A“soluble tissue factor domain” refers to a polypeptide having at least 70% identity (e.g., at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, at least 99% identity, or 100% identical) to a segment of a wildtype mammalian tissue factor protein (e.g., a wildtype human tissue factor protein) that lacks the transmembrane domain and the intracellular domain.
  • soluble tissue factor domains are described herein.
  • soluble interleukin protein is used herein to refer to a mature and secreted interleukin protein or a biologically active fragment thereof.
  • a soluble interleukin protein can include a sequence that is at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical to a wildtype mature and secreted mammalian interleukin protein (e.g., a wildtype human interleukin protein) and retains its biological activity.
  • soluble interleukin proteins are described herein.
  • soluble cytokine protein is used herein to refer to a mature and secreted cytokine protein or a biologically active fragment thereof.
  • a soluble cytokine protein can include a sequence that is at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical to a wildtype mature and secreted mammalian interleukin protein (e.g., a wildtype human interleukin protein) and retains its biological activity.
  • soluble cytokine proteins are described herein.
  • soluble interleukin receptor is used herein in the broadest sense to refer to a polypeptide that lacks a transmembrane domain (and optionally an intracellular domain) that is capable of binding one or more of its natural ligands (e.g., under physiological conditions, e.g., in phosphate buffered saline at room temperature).
  • a soluble interleukin receptor can include a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to an extracellular domain of wildtype interleukin receptor and retains its ability to specifically bind to one or more of its natural ligands, but lacks its transmembrane domain (and optionally, further lacks its intracellular domain).
  • soluble interleukin receptors are described herein.
  • soluble cytokine receptor is used herein in the broadest sense to refer to a polypeptide that lacks a transmembrane domain (and optionally an intracellular domain) that is capable of binding one or more of its natural ligands (e.g., under physiological conditions, e.g., in phosphate buffered saline at room temperature).
  • a soluble cytokine receptor can include a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to an extracellular domain of wildtype cytokine receptor and retains its ability to specifically bind to one or more of its natural ligands, but lacks its transmembrane domain (and optionally, further lacks its intracellular domain).
  • soluble cytokine receptors are described herein.
  • ligand of a co- stimulatory molecule is used herein in the broadest sense to refer to a polypeptide that is capable of binding and activating a co-stimulatory receptor molecule on an immune cell (e.g., under physiological conditions, e.g., in phosphate buffered saline at room temperature).
  • a ligand of a co stimulatory molecule can include a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to a ligand of a co- stimulatory molecule that retains its ability to specifically bind to one or more of its natural receptors.
  • Non-limiting examples of ligands of co-stimulatory molecules are described herein.
  • antibody is used herein in its broadest sense and includes certain types of immunoglobulin molecules that include one or more antigen-binding domains that specifically bind to an antigen or epitope.
  • An antibody specifically includes, e.g., intact antibodies (e.g., intact immunoglobulins), antibody fragments, and multi-specific antibodies.
  • an antigen-binding domain is an antigen-binding domain formed by a VH -VL dimer. Additional examples of an antibody are described herein. Additional examples of an antibody are known in the art.
  • affinity refers to the strength of the sum total of non-covalent interactions between an antigen-binding site and its binding partner (e.g., an antigen or epitope). Unless indicated otherwise, as used herein,“affinity” refers to intrinsic binding affinity, which reflects a 1 : 1 interaction between members of an antigen-binding domain and an antigen or epitope.
  • the affinity of a molecule X for its partner Y can be represented by the dissociation equilibrium constant (KD). The kinetic components that contribute to the dissociation equilibrium constant are described in more detail below. Affinity can be measured by common methods known in the art, including those described herein.
  • Affinity can be determined, for example, using surface plasmon resonance (SPR) technology (e.g., BIACORE®) or biolayer interferometry (e.g., FORTEBIO®).
  • SPR surface plasmon resonance
  • BIACORE® BIACORE®
  • biolayer interferometry e.g., FORTEBIO®
  • the term“pair of affinity domains” is two different protein domain(s) that bind specifically to each other with a KD of less than of less than 1 x 10 7 M (e.g., less than 1 x 10 8 M, less than 1 x 10 9 M, less than 1 x 10 10 M, or less than 1 x 10 11 M).
  • a pair of affinity domains can be a pair of naturally-occurring proteins.
  • a pair of affinity domains can be a pair of synthetic proteins. Non- limiting examples of pairs of affinity domains are described herein.
  • epitope means a portion of an antigen that specifically binds to an antigen-binding domain.
  • Epitopes can, e.g., consist of surface-accessible amino acid residues and/or sugar side chains and may have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and non- conformational epitopes are distinguished in that the binding to the former but not the latter may be lost in the presence of denaturing solvents.
  • An epitope may comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding. Methods for identifying an epitope to which an antigen-binding domain binds are known in the art.
  • An“immune effector cell” refers to a cell of the immune system of a mammal that is capable, directly or indirectly, of recognizing and/or causing cytostasis or cell death of a pathogenic cell (e.g., a cancer cell) in the mammal.
  • a pathogenic cell e.g., a cancer cell
  • immune effector cells include macrophages, natural killer cells, T-lymphocytes (e.g., cytotoxic T-lymphocytes and T-helper cells), neutrophils, monocytes, and eosinophils. Additional examples of immune effector cells are known in the art.
  • treatment means to ameliorate at least one symptom of a disorder.
  • the disorder being treated is cancer and to ameliorate at least one symptom of cancer includes reducing aberrant proliferation, gene expression, signaling, translation, and/or secretion of factors.
  • the methods of treatment include administering a therapeutically effective amount of composition that reduces at least one symptom of a disorder to a subject who is in need of, or who has been determined to be in need of such treatment.
  • Figure 1 shows a schematic diagram of an exemplary IL-7/IL-l5RaSu DNA construct.
  • Figure 2 shows a schematic diagram of an exemplary IL-21/TF/IL-15 DNA construct.
  • Figure 3 shows a schematic diagram of the interaction between the exemplary IL- 7/IL-l5RaSu and IL-21/TF/IL-15 DNA constructs.
  • Figure 4 shows a schematic diagram of the interaction between the exemplary IL-
  • Figure 5 shows the expansion of primary natural killer (NK) cells by stimulation with 2ltl5-7s + anti-TF IgGl antibody.
  • Figure 6 shows activation of expanded primary NK cells, using CD25 MFI and
  • CD69 MFI markers of NK cell activation.
  • Figure 7 shows cytotoxic activity of expanded NK cells against K562 human tumor cells, wherein NK cells stimulated with 2ltl5-7s + anti-TF IgGl antibody demonstrate greater specific lysis of K562 cells than NK cells not stimulated with 2ltl 5- 7s + anti-TF IgGl antibody.
  • Figure 8 shows a schematic diagram of an exemplary TGF-PRII/IL- 15RaSu DNA construct.
  • Figure 9 shows a schematic diagram of an exemplary IL-21/TF/IL-15 DNA construct.
  • Figure 10 shows a schematic diagram of the interaction between the exemplary
  • Figure 11 shows a schematic diagram of the interaction between the exemplary TGF-PRII /IL-l5RaSu and IL-21/TF/IL-15 fusion proteins resulting in an IL-21/TF/IL- 15: TGF-pRII/IL-l5RaSU complex (2ltl5-TGFRs).
  • Figure 12 shows the expansion of primary natural killer (NK) cells by stimulation with 2ltl5-TGFRs + anti-TF IgGl antibody (dark line with squares) or primary NK cells contacted with 2ltl5-TGFRs alone, anti-TF IgGl antibody, anti-TF IgG4 antibody, or with a combination of 2ltl5-TGFRs + anti-TF IgG4 antibody (all other data shown).
  • NK primary natural killer
  • Figure 13 shows activation of expanded primary NK cells, using CD25 MFI (top) and CD69 MFI (bottom) as markers of NK cell activation.
  • Figure 14 shows a schematic diagram of an exemplary IL-2l/IL-l5RaSu DNA construct.
  • Figure 15 shows a schematic diagram of an exemplary IL-7/TF/IL-15 DNA construct.
  • Figure 16 shows a schematic diagram of the interaction between the exemplary IL-2l/IL-l5RaSu and IL-7/TF/IL-15 DNA constructs.
  • Figure 17 shows a schematic diagram of the interaction between the exemplary IL-2l/IL-l5RaSu and IL-7/TF/IL-15 fusion proteins resulting in an IL-7/TF/IL-15TL- 2l/IL-l5RaSu complex (7tl 5-21 s).
  • Figure 18 shows in diagrammatic form the activation and expansion of primary natural killer (NK) cells by stimulation with 2ltl5-TGFRs + anti-TF IgGl antibody.
  • Figure 19 shows size exclusion chromatography (SEC) profiles of anti-TF IgGl antibody, 7tl 5-21 s and the complex containing equal amounts of anti-TF IgGl antibody and 7tl5-2ls.
  • Figure 20 is a graph showing the oxygen consumption rate (OCR) in pmoles/min for human NK cells isolated from blood (1 x 10 6 cells/mL) and stimulated with (1) 50 nM anti-TF IgGl (IgGl), (2) 100 nM 7tl5-2ls and 50 nM anti-TF IgGl, or (3) 100 nM 2 ltl 5-7s and 50 nM anti-TF IgGl for up to 5 days at 37 °C, 5% C0 2 in RPMI 1640 supplemented with 4 mM L-glutamine, penicillin, streptomycin, non-essential amino acids, sodium pyruvate, and 10% fetal bovine serum.
  • OCR oxygen consumption rate
  • Cells were maintained at a concentration of 0.5 x 10 6 cells/mL to 2.0 x 10 6 cells/mL until day 5. Glycolysis stress tests were performed in Seahorse media containing 2 mM glutamine. The drug concentrations used during the assay were as follows: 10 mM glucose, 100 nm oligomycin, and 100 mM 2-deoxy-D-glucose.
  • Figure 21 is a graph showing the extracellular acidification rate (ECAR) in mpH/minute for human NK cells isolated from blood (1 x 10 6 cells/mL) and stimulated with (1) 50 nM anti-TF IgGl (IgGl), (2) 100 nM 7tl5-2ls and 50 nM anti-TF IgGl, or (3) 100 nM 2 ltl 5-7s and 50 nM anti-TF IgGl for up to 5 days at 37 °C, 5% CO2 in RPMI 1640 supplemented with 4 mM L-glutamine, penicillin, streptomycin, non- essential amino acids, sodium pyruvate, and 10% fetal bovine serum.
  • ECAR extracellular acidification rate
  • Cells were maintained at a concentration of 0.5 x 10 6 cells/mL to 2.0 x 10 6 cells/mL until day 5. Glycolysis stress tests were performed in Seahorse media containing 2 mM glutamine. The drug concentrations used during the assay were as follows: 10 mM glucose, 100 nm oligomycin, and 100 mM 2-deoxy-D-glucose.
  • Figure 22 is a schematic showing the structure of the l8tl5-l2s construct.
  • Figure 23 are two graphs showing the oxygen consumption rate (OCR) in pmoles/min for human NK cells isolated from blood (2 x 10 6 cells/mL) of two different donors.
  • the isolated NK cells were left unstimulated or were stimulated with (1) 100 nM l8tl5-l2s (“1812”) or a mixture of (2) recombinant human IL-12 (0.25 pg), recombinant human IL-15 (1.25 pg), and recombinant human IL-18 (1.25 pg) (“single cytokines”), overnight at 37 °C, 5% CO2 in RPMI 1640 supplemented with 4 mM L-glutamine, penicillin, streptomycin, non-essential amino acids, sodium pyruvate, and 10% fetal bovine serum.
  • OCR oxygen consumption rate
  • the cells were harvested and extracellular flux assays on expanded NK cells were performed using a XFp Analyzer (Seahorse Bioscience). The harvested cells were washed and plated at 2.0 x 10 5 cells/well in at least duplicate for extracellular flux analysis of oxygen consumption rate. Glycolysis stress tests were performed in Seahorse Media contain 2 mM glutamine. Drug concentrations during the assay were: 10 mM glucose, 100 nM oligomycin, and 100 mM 2-deoxy-D-glucose.
  • Figure 24 are two graphs showing the extracellular acidification rate (ECAR) in mpH/minute for human NK cells isolated from blood (2 x 10 6 cells/mL) of two different donors.
  • the isolated NK cells were left unstimulated or were stimulated with (1) 100 nM l8tl5-l2s (“1812”) or a mixture of (2) recombinant human IL-12 (0.25 pg), recombinant human IL-15 (1.25 pg), and recombinant human IL-18 (1.25 pg) (“single cytokines”), overnight at 37 °C, 5% CO2 in RPMI 1640 supplemented with 4 mM L- glutamine, penicillin, streptomycin, non-essential amino acids, sodium pyruvate, and 10% fetal bovine serum.
  • the cells were harvested and extracellular flux assays on expanded NK cells were performed using a XFp Analyzer (Seahorse
  • the harvested cells were washed and plated at 2.0 x 10 6 cells/well in at least duplicate for extracellular flux analysis of extracellular flux analysis (ECAR).
  • ECAR extracellular flux analysis
  • Glycolysis stress tests were performed in Seahorse Media contain 2 mM glutamine. Drug concentrations during the assay were: 10 mM glucose, 100 nM oligomycin, and 100 mM 2-deoxy-D-glucose.
  • Figure 25 shows a schematic diagram of an exemplary IL-l2/IL-l5RaSu DNA construct.
  • Figure 26 shows a schematic diagram of an exemplary IL-18/TF/IL-15 DNA construct.
  • Figure 27 shows a schematic diagram of the interaction between the exemplary IL-l2/IL-l5RaSu and IL-18/TF/IL-15 DNA constructs.
  • Figure 28 shows a schematic diagram of the interaction between the exemplary IL-l2/IL-l5RaSu and IL-18/TF/IL-15 fusion proteins resulting in IL-l8/TF/IL-l5:IL- l2/IL-l5RaSu complex (18tl 5-l2s).
  • Figure 29 shows a chromatograph of l8tl5-l2s purification elution from an anti- TF affinity column.
  • Figure 30 shows an exemplary chromatographic profile of anti-TF antibody/SEC- purified 18tl 5-l2s protein following elution on an analytical size exclusion column, demonstrating separation of monomeric multiprotein l8tl5-l2s complexes from protein aggregates.
  • Figure 31 shows an example of a 4-12% SDS-PAGE of the l8tl5-l2s complex following disulfide bond reduction.
  • Lane 1 SeeBlue Plus2 marker
  • Lane 2 anti-TF antibody-purified l8tl5-l2s (0.5 pg)
  • Lane 3 anti-TF antibody-purified l8tl5-l2s (1 rig) ⁇
  • Figure 32 shows SDS PAGE analysis of deglycosylated and non-deglycosylated l8tl5-l2s.
  • Lane 1 anti-TF antibody-purified l8tl5-l2s (0.5 pg), non-deglycosylated;
  • Lane 2 anti-TF antibody-purified 18tl 5-l2s (1 pg), non-deglycosylated;
  • Lane 3 18tl 5- l2s (1 pg), deglycosylated, Lane 4: Markl2 unstained maker.
  • Figure 33 shows a sandwich ELISA for the 18tl 5-l2s complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-12 detection antibody (BAF 219).
  • Figure 34 shows a sandwich ELISA for the 18tl 5-l2s complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-15 detection antibody (BAM 247).
  • Figure 35 shows a sandwich ELISA for the 18tl 5-l2s complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-18 detection antibody (D045-6).
  • Figure 36 shows a sandwich ELISA for the 18tl 5-l2s complex, comprising an anti-human tissue factor (143) capture antibody and an anti-human tissue factor detection antibody.
  • Figure 37 shows proliferation of IL- 15 -dependent 32 ⁇ b cells mediated by the l8tl5-l2s complex (open squares) and recombinant IL-15 (black squares).
  • Figure 38 shows biological activity of IL-18 within the l8tl5-l2s complex (open squares), where recombinant IL-18 (black squares) and recombinant IL-12 (black circles) serve as positive and negative controls, respectively.
  • Figure 39 shows biological activity of IL-12 within the l8tl5-l2s complex (open squares), where recombinant IL-12 (black circles) and recombinant IL-18 (open squares) serve as positive and negative controls, respectively.
  • Figure 40A shows a flow cytometry graph of cell-surface CD25 expression of NK cells induced by the l8tl5-l2s complex.
  • Figure 40B shows a flow cytometry graph of cell-surface CD69 expression of NK cells induced by the l8tl5-l2s complex.
  • Figure 41 shows a flow cytometry graph of intracellular interferon gamma expression of NK cells induced by the l8tl5-l2s complex.
  • Figure 42 shows a bar graph showing cytotoxicity of l8tl5-l2s induced human NK cells against K562.
  • K562 cells labeleled with Celltrace violet
  • human NK cells NK cells were isolated from human blood huffy coat with StemCell human NK cell purification kit
  • PI propidium iodide
  • Figure 43 shows a schematic diagram of an exemplary IL-l2/IL-l5RaSu/aCDl6 DNA construct.
  • Figure 44 shows a schematic diagram of an exemplary IL-18/TF/IL-15 DNA construct.
  • Figure 45 shows a schematic diagram of the interaction between the exemplary IL- 12/IL- 15RaSu/aCD 16scFv and IL-18/TF/IL-15 DNA constructs.
  • Figure 46 shows a schematic diagram of an exemplary l8tl5-l2s/aCDl6 protein complex.
  • Figure 47 shows a sandwich ELISA for the l8tl5-l2sl6 complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-12 (dark line) or an anti-human tissue factor detection antibody (light line).
  • Figure 48 shows a schematic diagram of an exemplary TGF RII/IL- 15RaSu DNA construct.
  • Figure 49 shows a schematic diagram of an exemplary IL-21/TF/IL-15 construct.
  • Figure 50 shows a schematic diagram of the interaction between the exemplary IL- IL-21/TF/IL-15 and TGF RII/IL- l 5RaSu constructs.
  • Figure 51 shows a schematic diagram of the interaction between the exemplary TGF RII/IL- l 5RaSu and IL-21/TF/IL-15 fusion proteins, resulting in an IL-21/TF/IL- l5/TGF RII/IL-l5RaSu complex (2ltl5-TGFRs).
  • Figure 52 shows a chromatograph of 2ltl5-TGFRs purification elution from an anti-TF antibody affinity column.
  • Figure 53 shows an exemplary 2ltl5-TGFRs size exclusion chromatograph showing a main protein peak and a high molecular weight peak
  • Figure 54 shows an example of a 4-12% SDS-PAGE of the 2ltl5-TGFRs complex following disulfide bond reduction.
  • Lane 1 Markl2 unstained marker (numbers on the left side indicate molecular weights in kDa);
  • Lane 2 2ltl5-TGFRs (0.5 pg);
  • Lane 3 2ltl5-TGFRs (1 pg);
  • Lane 4 2ltl5-TGFRs, deglycosylated (1 pg), wherein the MW was the expected size of 53kDa and 39.08 kDa.
  • Figure 55 shows a sandwich ELISA for the 2ltl5-TGFRs complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-21 detection antibody (13-7218-81, BioLegend).
  • Figure 56 shows a sandwich ELISA for the 2ltl5-TGFRs complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human IL-15 detection antibody (BAM 247, R&D Systems).
  • Figure 57 shows a sandwich ELISA for the 2ltl5-TGFRs complex, comprising an anti-human tissue factor capture antibody and a biotinylated anti-human TGF RII detection antibody (BAF241, R&D Systems).
  • Figure 58 shows a sandwich ELISA for the 2ltl5-TGFRs complex, comprising an anti-human tissue factor (143) capture antibody and an anti-human tissue factor detection antibody.
  • Figure 59 shows IL- 15 -dependent proliferation of 32 ⁇ b cells mediated by the 2ltl5-TGFRs complex (open squares) compared to IL-15 (black squares).
  • Figure 60 shows biological activity of the TGFpRII domain within the 2ltl 5-
  • TGFpRII/Fc black squares served as a positive control.
  • Figure 61A shows a flow cytometry graph of cell-surface CD25 expression of NK cells induced by the 2ltl5-TGFRs complex.
  • Figure 61B shows a flow cytometry graph of cell-surface CD69 expression of NK cells induced by the 2ltl5-TGFRs complex.
  • Figure 62 shows a flow cytometry graph of intracellular interferon gamma expression of NK cells induced by the 2ltl5-TGFRs complex.
  • Figure 63 shows a bar graph showing cytotoxicity of 2ltl5-TGFRs-induced human NK cells against K562.
  • K562 cells labeleled with Celltrace violet
  • human NK cells NK cells were isolated from human blood huffy coat with StemCell human NK cell purification kit
  • l8tl5-l2s were incubated with l8tl5-l2s in RPMI-10 for 20 hours.
  • Cell mixtures were harvested, stained with propidium iodide (PI), and analyzed using a BD FACSCelestaTM flow cytometer. The graph represents duplicated samples.
  • PI propidium iodide
  • Figure 64 are schematic diagrams of an exemplary aCD3scFv/TF/aCD28scFv single-chain chimeric polypeptide.
  • Figure 65 is a chromatograph showing the elution of an exemplary aCD3scFv/TF/aCD28scFv single-chain chimeric polypeptide from an anti -tissue factor affinity column.
  • Figure 66 is a chromatograph showing the elution of a Superdex 200 Increase 10/300 GL gel filtration column loaded with an exemplary aCD3scFv/TF/aCD28scFv single-chain chimeric polypeptide.
  • Figure 67 is a sodium dodecyl sulfate polyacrylamide gel (4-12% NuPage Bis- Tris gel) of an exemplary aCD3scFv/TF/aCD28scFv single-chain chimeric polypeptide purified using an anti-tissue factor affinity column.
  • Figure 68 is a graph showing the ELISA quantitation of an exemplary aCD3scFv/TF/aCD28scFv single-chain chimeric polypeptide performed using the methods described in Example 53. Purified tissue factor was used as the control.
  • Figure 69 is a graph showing the ability of an exemplary
  • aCD3scFv/TF/aCD28scFv single-chain chimeric polypeptide to stimulate CD25 expression in CD4 + T-cells isolated from blood from two donors. The experiments were performed as described in Example 54.
  • Figure 70 is a graph showing the ability of an exemplary
  • aCD3scFv/TF/aCD28scFv single-chain chimeric polypeptide to stimulate CD25 expression in CD8 + T-cells isolated from blood from two donors. The experiments were performed as described in Example 54.
  • Figure 71 is a graph showing the ability of an exemplary
  • Figure 72 shows a schematic diagram of an exemplary IL-7/IL-l5RaSu DNA construct.
  • Figure 73 shows a schematic diagram of an exemplary IL-21/TF/IL-15 DNA construct.
  • Figure 74 shows a schematic diagram of the interaction between the exemplary IL-7/IL-l5RaSu and IL-21/TF/IL-15 DNA constructs.
  • Figure 75 shows a schematic diagram of the interaction between the exemplary IL-7/IL-l5RaSu and IL-21/TF/IL-15 fusion proteins resulting in an IL-2l/TF/IL-l5:IL- 7/IL-l5RaSu complex (2ltl5-7s).
  • Figure 76 shows a schematic diagram of an exemplary TGF-PRII/IL- 15RaSu DNA construct.
  • Figure 77 shows a schematic diagram of an exemplary IL-21/TF/IL-15 DNA construct.
  • Figure 78 shows a schematic diagram of the interaction between the exemplary TGF-b RII/IL-l5RaSu and IL-21/TF/IL-15 DNA constructs.
  • Figure 79 shows a schematic diagram of the interaction between the exemplary TGF-PRII /IL-l5RaSu and IL-21/TF/IL-15 fusion proteins resulting in an IL-21/TF/IL- 15: TGF-pRII/IL-l5RaSU complex (2ltl5-TGFRs).
  • Figure 80 shows a schematic diagram of an exemplary IL-2l/IL-l5RaSu DNA construct.
  • Figure 81 shows a schematic diagram of an exemplary IL-7/TF/IL-15 DNA construct.
  • Figure 82 shows a schematic diagram of the interaction between the exemplary IL-2l/IL-l5RaSu and IL-7/TF/IL-15 DNA constructs.
  • Figure 83 shows a schematic diagram of the interaction between the exemplary
  • Figure 84 shows size exclusion chromatography (SEC) profiles of anti-TF IgGl antibody, 7tl 5-21 s and the complex containing equal amounts of anti-TF IgGl antibody and 7tl5-2ls.
  • Figure 85 shows a schematic of the 7tl5-l6s2l construct.
  • Figure 86 shows an additional schematic of the 7tl5-l6s2l construct.
  • Figures 87A and 87B are graphs showing binding of 7tl5-l6s2l to CHO cells expressing human CDl6b as compared to a control protein.
  • Figures 88A-88C are results from ELISA experiments using antibodies against
  • FIG. 89 shows results of the 32 ⁇ b cell proliferation assay with 7tl5-l6s2l or recombinant IL- 15.
  • Figure 90 is a line graph showing the chromatographic profile of 7tl5-l6s2l protein containing cell culture supernatant following binding and elution on anti-TF antibody resin.
  • Figure 91 shows the analytical SEC Profile of 7tl5-l6s2l.
  • Figure 92 shows a schematic of the TGFRtl5-l6s2l construct.
  • Figure 93 shows an additional schematic of the TGFRtl5-l6s2l construct.
  • Figures 94A and 94B show binding affinity of TGFRtl5-l6s2l and 7tl 5-21 s with CHO cells expressing human CDl6b.
  • Figure 94A shows binding affinity of TGFRtl5- l6s2l with CHO cells expressing human CDl6b.
  • Figure 94B shows binding affinity of 7tl 5-21 s with CHO cells expressing human CDl6b.
  • Figure 95 shows results of TGF l inhibition by TGFRtl5-l6s2l and TGFR-Fc.
  • Figure 96 shows results of 32 ⁇ b cell proliferation assay with TGFRtl5-l6s2l or recombinant IL- 15.
  • Figures 97A-97C show results of detecting IL-15, IL-21, and TGF RII in TGFRtl5-l6s2l with corresponding antibodies using ELISA.
  • Figure 98 is a line graph showing the chromatographic profile of TGFRtl5-l6s2l protein containing cell culture supernatant following binding and elution on anti-TF antibody resin.
  • Figure 99 shows results of a reduced SDS-PAGE analysis of TGFRtl5-l6s2l.
  • Figure 100 shows a schematic of the 7tl5-7s construct.
  • Figure 101 shows an additional schematic of the 7tl5-7s construct.
  • Figure 102 is a line graph showing the chromatographic profile of 7tl5-7s protein containing cell culture supernatant following binding and elution on anti-TF antibody resin.
  • Figure 103 shows detection of TF, IL-15 and IL-7 in 7tl5-7s using ELISA.
  • Figure 104A and 104B show spleen weight and the percentages of immune cell types in 7tl5-7s-treated and control-treated mice.
  • Figure 115A shows spleen weight in mice treated with 7tl5-7s as compared to PBS control.
  • Figure 115B shows the percentage of CD4 + T cells, CD8 + T cells, and NK cells in mice treated with 7tl5-7s as compared to PBS control.
  • Figure 105 shows a schematic of the TGFRtl5-TGFRs construct.
  • Figure 106 shows an additional schematic of the TGFRtl5-TGFRs construct.
  • Figure 107 shows results of TGF l inhibition by TGFRtl5-TGFRs and TGFR-
  • Figure 108 shows results of 32 ⁇ b cell proliferation assay with TGFRtl5-TGFRs or recombinant IL-15
  • Figures 109A and 109B show results of detecting IL-15 and TGF RII in
  • Figure 110 is a line graph showing the chromatographic profile of TGFRtl 5- TGFRs protein containing cell culture supernatant following binding and elution on anti- TF antibody resin.
  • Figure 111 shows the analytical SEC profile of TGFRtl 5-TGFRs.
  • Figure 112 shows TGFRtl 5-TGFRs before and after deglycosylation as analyzed by reduced SDS-PAGE.
  • Figures 113 A and 113B show spleen weight and the percentages of immune cell types in TGFRtl 5-TGFRs-treated and control -treated mice.
  • Figure 113 A shows spleen weight in mice treated with TGFRtl5-TGFRs as compared to PBS control.
  • Figure 113B shows the percentage of CD4 + T cells, CD8 + T cells, and NK cells in mice treated with TGFRtl 5-TGFRs as compared to PBS control.
  • Figure 114A and 114B show the spleen weight and immunostimulation over 92 hours in mice treated with TGFRtl 5-TGFRs.
  • Figure 114A shows spleen weight of mice treated with TGFRtl 5-TGFRs at 16, 24, 48, 72, and 92 hours after treatment.
  • Figure 114B shows the percentages of immune cells in mice treated with TGFRtl 5-TGFRs at
  • Figure 115A and 115B show Ki67 and Granzyme B expression in mice treated with TGFRtl 5-TGFRs over time.
  • Figure 116 shows enhancement of cytotoxicity of splenocytes by TGFRtl 5- TGFRs in C57BL/6 Mice.
  • Figure 117 shows changes in tumor size in response to PBS treatment, chemotherapy alone, TGFRtl5-TGFRs alone, or chemotherapy and TGFRtl5-TGFRs combination, in a pancreatic cancer mouse model.
  • Figure 118 shows the cytotoxicity of NK cells isolated from mice treated with T GFRt 15 -TGFRs .
  • Figures 119A-119E show results of the in vivo efficacy of TGFRtl5-TGFRs in a melanoma mouse model.
  • Figure 119A shows a schematic of the treatment regimen.
  • Figure 119B shows tumor volume over time following saline treatment, chemotherapy (DTX), or chemotherapy (DTX), TGFRtl5-TGFRs and TA99 (anti-TRPl antibody) combination treatment.
  • Figure 119C shows peripheral blood analysis using fluorescently labeled antibodies against NK1.1.
  • Figure 119D shows peripheral blood analysis using fluorescently labeled antibodies against CD8.
  • Figure 119E shows peripheral blood analysis using fluorescently labeled antibodies against CD4.
  • Figure 120 shows a schematic of the 7tl5-2lsl37L (long version) construct.
  • Figure 121 shows an additional schematic of the 7tl5-2lsl37L (long version) construct.
  • Figure 122 is a line graph showing the chromatographic profile of 7tl5-2lsl37L (long version) protein containing cell culture supernatant following binding and elution on anti-TF antibody resin.
  • Figure 123 shows the analytical SEC profile of 7tl5-2lsl37L (long version).
  • Figure 124 shows binding of 7tl5-2lsl37L (short version) to CD137L (4.1BBL)
  • Figures 125A-125C show detection of IL15, IL21, and IL7 in 7tl5-2lsl37L (short version) with ELISA.
  • Figure 125A shows detection of IL15 in 7tl5-2lsl37L (short version) with ELISA.
  • Figure 125B shows detection of IL21 in 7tl5-2lsl37L (short version) with ELISA.
  • Figure 125C shows detection of IL7 in 7tl5-2lsl37L (short version) with ELISA.
  • Figure 126 shows results from a CTLL-2 cell proliferation assay.
  • Figure 127 shows the activity of 7tl5-lsl37L (short version) in promoting IL21R containing B9 cell proliferation.
  • Figure 128 shows a schematic of the 7tl5-TGFRs construct.
  • Figure 129 shows an additional schematic of the 7tl5-TGFRs construct.
  • Figure 130 shows results of TGF l inhibition by 7tl5-TGFRs and TGFR-Fc.
  • Figures 131A-131C show detection of IL-15, TGF RII, and IL-7 in 7tl5-TGFRs with ELISA.
  • Figure 132 shows results of 32 ⁇ b cell proliferation assay with 7tl5-TGFRs or recombinant IL- 15.
  • Figure 133 is a line graph showing the chromatographic profile of 7tl5-TGFRs protein containing cell culture supernatant following binding and elution on anti-TF antibody resin.
  • Figure 134 shows 7tl5-TGFRs before and after deglycosylation as analyzed using reduced SDS-PAGE.
  • Figure 135 shows ELISA detection of IL-7, IL-15 and TGF RII in the 7tl5-TGFRs protein.
  • Figures 136A and 136B show spleen weight and the percentages of immune cell types in 7tl5-TGFRs-treated and control-treated mice.
  • Figure 136A shows spleen weight in mice treated with 7tl5-TGFRs at various dosages, as compared to PBS control.
  • Figure 136B shows the percentage of CD4 + T cells, CD8 + T cells, and NK cells in mice treated with 7tl5-TGFRs at various dosages, as compared to PBS control.
  • Figures l37A and 137B show upregulation of CD44 expression of CD4 +
  • Figures 138A and 138B show upregulation of Ki67 expression and Granzyme B expression of CD8 + T cells and NK Cells by 7tl5-TGFRs in C57BL/6 mice.
  • Figure 139 shows enhancement of cytotoxicity of splenocytes by 7tl5-TGFRs in C57BL/6 mice.
  • Figure 140 shows a schematic of the TGFRtl5-2lsl37L construct.
  • Figure 141 shows an additional schematic of the TGFRtl5-2lsl37L construct.
  • Figure 142 is a line graph showing the chromatographic profile of
  • Figure 143 shows a schematic of the TGFRtl5-TGFRs2l construct.
  • Figure 144 shows an additional schematic of the TGFRtl5-TGFRs2l
  • Figure 145 is a line graph showing the chromatographic profile of TGFRtl5- TGFRs2l protein containing cell culture supernatant following binding and elution on anti-TF antibody resin.
  • Figure 146 shows TGFRtl5-TGFRs2l before and after deglycosylation as analyzed by reduced SDS-PAGE.
  • Figures 147A and 147B show detection of components of TGFRtl5-TGFRs2l using ELISA.
  • Figures 148A and 148B show the percentages and proliferation of CD4 + T cells
  • Figure 149 shows upregulation of Granzyme B expression of splenocytes in mice treated with TGFRtl5-TGFRs2l.
  • Figure 150 shows enhancement of cytotoxicity of splenocytes by TGFRtl5-
  • Figure 151 shows a schematic of the TGFRtl5-TGFRsl6 construct.
  • Figure 152 shows an additional schematic of the TGFRtl5-TGFRsl6 construct.
  • Figure 153 shows a schematic of the TGFRtl5-TGFRsl37L construct.
  • Figure 154 shows an additional schematic of the TGFRtl5-TGFRsl37L construct.
  • Figure 155 are schematic diagrams of an exemplary 2t2 single-chain chimeric polypeptide.
  • Figure 156 shows IL-2 activity in 2t2 as compared to recombinant IL-2 using a 32 ⁇ b cell proliferation assay.
  • Figure 157 shows IL-2 activity in 2t2 as compared to recombinant IL-2 using a
  • CTLL-2 cell proliferation assay
  • Figure 158 shows the fasting blood glucose levels in ApoE /_ mice fed with standard chow or a high fat diet and treated with a PBS control (untreated) or with 2t2.
  • Figure 159 shows the ratio of CD4 + CD25 + FoxP3 + T regulatory cells in blood lymphocytes from ApoE /_ mice fed with standard chow or a high fat diet and treated with a PBS control (untreated) or with 2t2.
  • Figure 160 is a line graph showing the chromatographic profile of 2t2 protein containing cell culture supernatant following binding and elution on anti-TF antibody resin.
  • Figure 161 shows an analytical SEC profile of 2t2.
  • Figures 162A and 162B show reduced SDS-PAGE analysis of 2t2 before and after deglycosylation.
  • Figure 162A shows reduced SDS-PAGE analysis of 2t2before deglycosylation.
  • Figure 162B shows reduced SDS-PAGE analysis of 2t2 after deglycosylation.
  • Figures 163 A and 163B show results of immunostimulation in C57BL/6 mice using 2t2.
  • Figure 163 A shows spleen weight following treatment with 2t2.
  • Figure 163B shows the percentages of immune cell types following 2t2 treatment.
  • Figure 164 shows upregulation of CD25 expression of CD4 + T cells in mice treated with 2t2.
  • Figure 165 shows the pharmacokinetics of 2t2 in C57BL/6 mice.
  • Figures 166A and 166B show effects of 2t2 in attenuating the formation of high fat-induced atherosclerotic plaques in ApoE /_ mice.
  • Figure 166A shows a representative view of atherosclerotic plaques from ApoE /_ mice fed with standard chow or a high fat diet and treated with either PBS control or 2t2.
  • Figure 166B shows the results of quantitative analysis of atherosclerotic plaques of each group.
  • Figure 167 shows fasting glucose levels in 2t2 treated-mice as compared to control -treated mice.
  • Figure 168 shows the percentage of CD4 + CD25 + FoxP3 + Tregs in blood lymphocytes from mice treated with 2t2 and control-treated mice.
  • Figure 169 are schematic diagrams of an exemplary 15tl 5 single-chain chimeric polypeptide.
  • Figure 170 shows the IL-15 activity of 15tl 5 as compared to recombinant IL-15 in a 32 ⁇ b cell proliferation assay.
  • Figure 171 is a line graph showing the chromatographic profile of 15tl 5 protein containing cell culture supernatant following binding and elution on anti-TF resin.
  • Figures 172A and 172B show reduced SDS-PAGE analysis of 15tl 5 before and after deglycosylation.
  • Figure 172A shows reduced SDS-PAGE analysis of 15tl 5 before deglycosylation.
  • Figure 172B shows reduced SDS-PAGE analysis of 15tl 5 after deglycosylation.
  • Figure 173 is a set of histograms and a set of graphs showing the change in the surface phenotype of NK cells after stimulation with 18tl 5-l2s, l8tl5-l2sl6, and 7tl 5- 21 s + anti-TF antibody.
  • Figure 174 is a set of graphs showing changes in the surface phenotype of lymphocyte populations after stimulation with l8tl5-l2s; l8tl5-l2sl6; a mixture of single cytokines rhILl5, rh ⁇ Ll8, and rhIL-l2; 7tl 5-21 s + anti-TF antibody; 7tl 5-21 s; or anti-TF antibody.
  • Figure 175 is a graph of the increase in proliferation of NK cells in vitro after stimulation with a multi-chain construct alone or in the presence of anti-TF IgGl or anti- TF IgG4.
  • Figure 176 is a graph of the increase in proliferation over time of NK cells in vitro after stimulation with the combination of 7tl 5-21 s and anti-TF antibody.
  • Figure 177 is a graph of the changes in surface phenotype on 7tl 5-21 s + anti-TF antibody-expanded NK cells.
  • Figure 178 is a schematic and a set of graphs showing the persistence of 7tl 5-21 s and anti-TF antibody-expanded NK cells in NSG mice following treatment with 7tl 5-21, T GFRt 15 -TGFRs or 2t2.
  • Figure 179 A and 179B is a set of images and a set of graphs showing killing of chemically-induced senescent human fibroblasts by 7tl 5-21 s + anti-TF antibody- expanded NK cells.
  • Figure 180A-180C is a set of images and a set of graphs showing killing of UV- induced senescent human fibroblast by 7tl 5-21 s + anti-TF antibody-expanded NK cells.
  • Figure 181 shows proliferation of NK cells upon stimulation with 7tl5-2ls, 7tl 5-
  • Figure 182 shows NK cell expansion induced by the 7tl5-2ls + anti-TF antibody (IgGl) and by the 7tl5-2lsl37L (short version) + anti-TF antibody (IgGl).
  • Figure 183 shows clearance of Daudi tumor cells in NSG mice upon treatment with NK cells activated by the 7tl5-2ls and anti-TF antibody (IgGl) complex.
  • Figures 184A-184E show improvement of skin texture in ApoE /_ mice fed with a Western diet and treated with 2t2 or TGFRtl5-TGFRs.
  • Figure 184A is a representative picture of a chow diet-fed ApoE /_ mouse taken one week after PBS treatment.
  • Figure 184B is a representative picture of a Western diet-fed ApoE /_ mouse taken one week after PBS treatment.
  • Figure 184C shows a representative picture of a Western diet-fed ApoE /_ mouse taken one week after TGFRtl5-TGFRs treatment.
  • Figure 184D shows a representative picture of a Western diet-fed ApoE /_ mouse taken one week after 2t2 treatment.
  • Figure 184E shows a representative picture of a Western diet-fed ApoE /_ mouse taken one week after treatment with 2ltl5-TGFRs.
  • Figure 185 shows a graph of Factor X (FX) activation following treatment with single-chain or multi-chain chimeric polypeptides.
  • Figure 186 shows clotting time for a buffer with varying concentrations of Innovin in a prothrombin time (PT) test.
  • Figure 187 shows clotting time for multi-chain chimeric polypeptides in a PT Assay.
  • Figure 188 shows clotting time of the multi-chain chimeric polypeptides in a PT assay when mixed with 32DB cells.
  • Figure 189 shows clotting time of multi-chain chimeric polypeptides in a PT assay when mixed with human PBMC.
  • Figure 190 shows binding of 7tl5-2lsl37L (long version) and 7tl5-2lsl37L
  • Figure 191A-191D show detection of IL7, IL21, IL15, and 4.1BBL in 7tl5- 2lsl37L (long version) by the respective antibodies using ELISA.
  • Figure 192 shows IL-15 activity of 7tl5-2lsl37L (long version) and 7tl 5- 2lsl37L (short version) as evaluated by a IL2Ra y-containing CTLL2 cell proliferation assay.
  • Figure 193A-193C show human blood lymphocyte pStat5a responses in
  • FIG. 193 A shows pSTAT5 responses in CD4 + CD25 hi T reg cells.
  • Figure 193B shows pSTAT5 responses in CD4 + CD25 T COn cells.
  • Figure 193C shows pSTAT5 responses in CD8 + T COn cells.
  • Figure 194 is a graph showing the percentage different in DNA demethylation in NK cells (relative to unexposed NK cells) from two different donors following expansion with 7tl 5-21 s+ anti-tissue factor (TF)-antibody (IgGl) (50 nM).
  • TF tissue factor
  • IgGl antibody
  • the single-chain and multi-chain chimeric polypeptides include a linker domain positioned between two target-binding domains.
  • the linker domain is or includes a soluble tissue factor domain.
  • the linker domain can be recognized by a cognate IgGl antibody (e.g., a monoclonal antibody).
  • a single-chain or multi-chain chimeric polypeptide provided herein can be used to stimulate an immune cell, induce or increase proliferation of an immune cell, induce differentiation of an immune cell, or treat a subject in need thereof (e.g., a subject having cancer or an aging-related disease or condition).
  • any of the methods described herein include the use of any of the single chain chimeric polypeptides described herein.
  • kits described herein include any of the single-chain chimeric polypeptides described herein.
  • the single-chain chimeric polypeptides provided herein include a first target- binding domain, a linker domain, and a second target-binding domain, where the first target-binding domain and the second target-binding domain are each independently selected from the group consisting of a soluble interleukin or cytokine protein, an antigen-binding domain, and a soluble interleukin or cytokine receptor, and ligands of co stimulatory molecules.
  • the single-chain chimeric polypeptide can have a total length of about 50 amino acids to about 3000 amino acids, about 50 amino acids to about 2500 amino acids, about 50 amino acids to about 2000 amino acids, about 50 amino acids to about 1500 amino acids, about 50 amino acids to about 1000 amino acids, about 50 amino acids to about 950 amino acids, about 50 amino acids to about 900 amino acids, about 50 amino acids to about 850 amino acids, about 50 amino acids to about 800 amino acids, about 50 amino acids to about 750 amino acids, about 50 amino acids to about 700 amino acids, about 50 amino acids to about 650 amino acids, about 50 amino acids to about 600 amino acids, about 50 amino acids to about 550 amino acids, about 50 amino acids to about 500 amino acids, about 50 amino acids to about 480 amino acids, about 50 amino acids to about 460 amino acids, about 50 amino acids to about 440 amino acids, about 50 amino acids to about 420 amino acids, about 50 amino acids to about 400 amino acids, about 50 amino acids to about 50 amino acids to about 50 amino acids to about 3000 amino acids, about 50 amino acids
  • the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the linker domain e.g., any of the exemplary linker described herein
  • the single-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the linker domain (e.g., any of the exemplary linker domains described herein).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the linker domain e.g., any of the exemplary linker domains described herein
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the single-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the linker domain (e.g., any of the exemplary linker domains described herein) and the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the single-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the linker domain e.g., any of the exemplary linker domains described herein
  • the single-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the linker domain (e.g., any of the exemplary linker domains described herein or known in the art).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • Non-limiting aspects of these chimeric polypeptides, nucleic acids, vectors, cells, and methods are described below, and can be used in any combination without limitation. Additional aspects of these chimeric polypeptides, nucleic acids, vectors, cells, and methods are known in the art. Multi-Chain Chimeric Polypeptides
  • Some embodiments of any of the methods described herein include the use of any of the multi-chain chimeric polypeptides described herein. Some embodiments of any of the kits described herein include any of the multi-chain chimeric polypeptides described herein.
  • the multi-chain chimeric polypeptides provided herein include: (a) a first chimeric polypeptide including: (i) a first target-binding domain; (ii) a linker domain; and (iii) a first domain of a pair of affinity domains; and (b) a second chimeric polypeptide including: (i) a second domain of a pair of affinity domains; and (ii) a second target- binding domain, where the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains.
  • the total length of first chimeric polypeptide and/or the second chimeric polypeptide can each independently be about 50 amino acids to about 3000 amino acids, about 50 amino acids to about 2500 amino acids, about 50 amino acids to about 2000 amino acids, about 50 amino acids to about 1500 amino acids, about 50 amino acids to about 1000 amino acids, about 50 amino acids to about 950 amino acids, about 50 amino acids to about 900 amino acids, about 50 amino acids to about 850 amino acids, about 50 amino acids to about 800 amino acids, about 50 amino acids to about 750 amino acids, about 50 amino acids to about 700 amino acids, about 50 amino acids to about 650 amino acids, about 50 amino acids to about 600 amino acids, about 50 amino acids to about 550 amino acids, about 50 amino acids to about 500 amino acids, about 50 amino acids to about 480 amino acids, about 50 amino acids to about 460 amino acids, about 50 amino acids to about 440 amino acids, about 50 amino acids to about 420 amino acids, about 50 amino acids to about 400
  • the first target-binding domain e.g., any of the first target-binding domains described herein
  • the linker domain e.g., any of the exemplary linker domains described herein
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first target-binding domain (e.g., any of the exemplary first target-binding domains described herein) and the linker domain (e.g., any of the exemplary linker domains described herein) in the first chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the linker domain e.g., any of the exemplary linker domains described herein
  • the first domain of the pair of affinity domains e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein
  • the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the linker domain (e.g., any of the exemplary linker domains described herein) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the second domain of the pair of affinity domains e.g., any of the exemplary second domains of any of the exemplary pairs of affinity domains described herein
  • the second target-binding domain e.g., any of the exemplary second target-binding domains described herein
  • the second chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the second domain of the pair of affinity domains (e.g., any of the exemplary second domains of any of the exemplary pairs of affinity domains described herein) and the second target- binding domain (e.g., any of the exemplary second target-binding domains described herein) in the second chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • Human tissue factor is a 263 amino-acid transmembrane protein containing three domains: (1) a 2l9-amino acid N-terminal extracellular domain (residues 1-219); (2) a 22-amino acid transmembrane domain (residues 220-242); and (3) a 21 -amino acid cytoplasmic C-terminal tail (residues 242-263) ((UniProtKB Identifier Number: P13726).
  • the cytoplasmic tail contains two phosphorylation sites at Ser 253 and Ser 258 , and one S- palmitoylation site at Cys 245 . Deletion or mutation of the cytoplasmic domain was not found to affect tissue factor coagulation activity.
  • Tissue factor has one S-palmitoylation site in the intracellular domain of the protein at Cys 245 .
  • the Cys 245 is located at the amino acid terminus of the intracellular domain and close to the membrane surface.
  • the tissue factor transmembrane domain is composed of a single-spanning a-helix.
  • the extracellular domain of tissue factor composed of two fibronectin type III domains, is connected to the transmembrane domain through a six-amino acid linker.
  • Each tissue factor fibronectin type III module is composed of two overlapping b sheets with the top sheet domain containing three antiparallel b-strands and the bottom sheet containing four b-strands.
  • the b-strands are connected by b-loops between strand bA and bB, bE and b ⁇ , and bE and bE, all of which are conserved in conformation in the two modules.
  • a unique feature of tissue factor is a 17- amino acid b-hairpin between strand b ⁇ q and strand b ⁇ 1, which is not a common element of the fibronectin superfamily.
  • the N-terminal domain also contains a 12 amino acid loop between b6T and b70 that is not present in the C-terminal domain and is unique to tissue factor.
  • Such a fibronectin type III domain structure is a feature of the
  • immunoglobulin-like family of protein folds and is conserved among a wide variety of extracellular proteins.
  • the zymogen FVII is rapidly converted to FVIIa by limited proteolysis once it binds to tissue to form the active tissue factor-FVIIa complex.
  • the FVIIa which circulates as an enzyme at a concentration of approximately 0.1 nM (1% of plasma FVII), can also bind directly to tissue factor.
  • the allosteric interaction between tissue factor and FVIIa on the tissue factor-FVIIa complex greatly increases the enzymatic activity of FVIIa: an approximate 20- to lOO-fold increase in the rate of hydrolysis of small, chromogenic peptidyl substrates, and nearly a million-fold increase in the rate of activation of the natural macromolecular substrates FIX and FX.
  • tissue factor-FVIIa complex on phospholipid bilayer i.e., upon exposure of phosphatidyl-L-serine on membrane surfaces
  • FIX or FX activation increases the rate of FIX or FX activation, in a Ca 2+ -dependent manner, an additional 1, 000-fold.
  • the roughly million-fold overall increase in FX activation by tissue factor-FVIIa-phospholipid complex relative to free FVIIa is a critical regulatory point for the coagulation cascade.
  • FVII is a ⁇ 50 kDa, single-chain polypeptide consisting of 406 amino acid residues, with an N-terminal g-carboxyglutamate-rich (GLA) domain, two epidermal growth factor-like domains (EGF1 and EFG2), and a C-terminal serine protease domain.
  • GLA N-terminal g-carboxyglutamate-rich
  • EGF1 and EFG2 epidermal growth factor-like domains
  • C-terminal serine protease domain is activated to FVIIa by a specific proteolytic cleavage of the Ile- 154 -Arg 152 bond in the short linker region between the EGF2 and the protease domain. This cleavage results in the light and heavy chains being held together by a single disulfide bond of Cys 135 and Cys 262 .
  • FVIIa binds phospholipid membrane in a Ca 2+ -dependent manner through its N- terminal GLA-domain.
  • GLA domain Immediately C-terminal to the GLA domain is an aromatic stack and two EGF domains.
  • the aromatic stack connects the GLA to EGF1 domain which binds a single Ca 2+ ion. Occupancy of this Ca 2+ -binding site increases FVIIa amidolytic activity and tissue factor association.
  • the catalytic triad consist of His 193 , Asp 242 , and Ser 344 , and binding of a single Ca 2+ ion within the FVIIa protease domain is critical for its catalytic activity.
  • FVIIa Proteolytic activation of F VII to FVIIa frees the newly formed amino terminus at Ile 153 to fold back and be inserted into the activation pocket forming a salt bridge with the carboxylate of Asp 343 to generate the oxyanion hole. Formation of this salt bridge is critical for FVIIa activity. However, oxyanion hole formation does not occur in free FVIIa upon proteolytic activation. As a result, FVIIa circulates in a zymogen-like state that is poorly recognized by plasma protease inhibitors, allowing it to circulate with a half-life of approximately 90 minutes.
  • Tissue factor-mediated positioning of the FVIIa active site above the membrane surface is important for FVIIa towards cognate substrates.
  • Free FVIIa adopts a stable, extended structure when bound to the membrane with its active site positioned ⁇ 80A above the membrane surface.
  • the FVa active site Upon FVIIa binding to tissue factor, the FVa active site is repositioned ⁇ 6A closer to the membrane. This modulation may aid in a proper alignment of the FVIIa catalytic triad with the target substrate cleavage site.
  • GLA- domainless FVIIa it has been shown that the active site was still positioned a similar distance above the membrane, demonstrating that tissue factor is able to fully support FVIIa active site positioning even in the absence of FVIIa-membrane interaction.
  • tissue factor supported full FVIIa proteolytic activity as long as the tissue factor extracellular domain was tethered in some way to the membrane surface.
  • raising the active site of FVIIa greater than 8qA above the membrane surface greatly reduced the ability of the tissue factor-FVIIa complex to activate FX but did not diminish tissue factor-FVIIa amidolytic activity.
  • Alanine scanning mutagenesis has been used to assess the role of specific amino acid side chains in the tissue factor extracellular domain for interaction with FVIIa (Gibbs et ak, Biochemistry 33(47): 14003-14010, 1994; Schullek et ah, J Biol Chem 269(30): 19399-19403, 1994).
  • Alanine substitution identified a limited number of residue positions at which alanine replacements cause 5- to lO-fold lower affinity for FVIIa binding. Most of these residue side chains were found to be well-exposed to solvent in the crystal structure, concordant with macromolecular ligand interaction.
  • the FVIIa ligand-binding site is located over an extensive region at the boundary between the two modules.
  • residues Arg 135 and Phe 140 located on the protruding B-C loop provide an independent contact with FVIIa.
  • Leu 133 is located at the base of the fingerlike structure and packed into the cleft between the two modules. This provides continuity to a major cluster of important binding residues consisting of Lys 20 , Thr 60 , Asp 58 , and Ile 22 .
  • Thr 60 is only partially solvent-exposed and may play a local structural role rather than making a significant contact with ligand.
  • the binding site extends onto the concave side of the intermodule angle involving Glu 24 and Gln 110 , and potentially the more distant residue Val 207 .
  • the binding region extends from Asp58 onto a convex surface area formed by Lys 48 , Lys 46 , Gln 37 , Asp 44 , and Trp 45 .
  • Trp 45 and Asp 44 do not interact independently with FVIIa, indicating that the mutational effect at the Trp 45 position may reflect a structural importance of this side chain for the local packing of the adjacent Asp 44 and Gln 37 side chain.
  • the interactive area further includes two surface- exposed aromatic residues, Phe 76 and Tyr 78 , which form part of the hydrophobic cluster in the N-module.
  • tissue factor-FVIIa The known physiologic substrates of tissue factor-FVIIa are FVII, FIX, and FX and certain proteinase-activated receptors. Mutational analysis has identified a number of residues that, when mutated, support full FVIIa amidolytic activity towards small peptidyl substrates but are deficient in their ability to support macromolecular substrate (i.e., FVII, FIX, and FX) activation (Ruf et ak, J Biol Chem 267(31): 22206-22210, 1992; Ruf et ak, J Biol Chem 267(9): 6375-6381, 1992; Huang et ak, J Biol Chem 271(36): 21752-21757, 1996; Kirchhofer et ak, Biochemistry 39(25): 7380-7387, 2000).
  • FVII, FIX, and FX macromolecular substrate activation
  • tissue factor loop region at residues 159-165, and residues in or adjacent to this flexible loop have been shown to be critical for the proteolytic activity of the tissue factor-FVIIa complex.
  • Lys 165 and Lys 166 have also been demonstrated to be important for substrate recognition and binding. Mutation of either of these residues to alanine results in a significant decrease in the tissue factor co-factor function. Lys 165 and Lys 166 face away from each other, with Lys 165 pointing towards FVIIa in most tissue factor-FVIIa structures, and Lys 166 pointing into the substrate binding exosite region in the crystal structure. Putative salt bridge formation between Lys 165 of and Gla 35 of F Vila would support the notion that tissue factor interaction with the GLA domain of F Vila modulates substrate recognition.
  • the linker domain can be or include any antigen that is recognized by a cognate IgGl antibody (e.g., a monoclonal antibody).
  • IgGl antibodies are distinguished from other IgG classes of antibodies by their constant region, particularly in hinge regions and upper CH2 domains (see, e.g., Vadarsson et ak, IgG Subclasses and Allotypes: From Structure to Effector Functions, Front Immunol., 5, Article 520, 2014).
  • Human IgGl is the only known IgG subclass which binds to human CDl6a and activates the signaling of human CDl6a.
  • linker domains can be used in the single-chain chimeric polypeptides and multi-chain chimeric polypeptides provided herein.
  • a linker domain is recognized by an antibody (e.g., an IgGl antibody) or antibody fragment.
  • the linker domain is a kappa light chain of an antibody that is recognized by a cognate anti-kappa light chain IgGl antibody.
  • the linker domain is a lambda light chain of an antibody that is recognized by a cognate anti -lambda light chain human IgGl antibody.
  • the linker domain is or comprises a human polypeptide (e.g., a human kappa light chain of an antibody or a human lambda light chain of an antibody) that is recognized by a cognate human IgGl antibody (e.g., a monoclonal antibody).
  • a human polypeptide e.g., a human kappa light chain of an antibody or a human lambda light chain of an antibody
  • a cognate human IgGl antibody e.g., a monoclonal antibody
  • the cognate human IgGl antibody includes at least two antigen-binding domains, and each antigen-binding domain binds specifically to the linker domain. In some embodiments, the cognate human IgGl antibody includes at least two antigen-binding domains, and only a subset (e.g., one) of the antigen-binding domains bind specifically to the linker domain. In some
  • a linker domain can be any of the soluble tissue factor domains described herein.
  • an IgGl antibody construct can be an IgGl antibody (e.g., a monoclonal or a polyclonal IgGl antibody that binds specifically to the linker domain).
  • an IgGl antibody construct can be an antibody or an antibody fragment that includes an IgGl Fc region (e.g., a human IgGl Fc region) and that binds specifically to the linker domain.
  • an IgGl Fc region binds to CDl6a (FcRgammalll) (e.g., human CDl6a) and induces its intracellular signaling.
  • an IgGl antibody construct can be a single chain or a multi-chain polypeptide that includes an Fc region that is capable of binding specifically to CDl6a (FcRgammalll) (e.g., human CDl6a) and is capable of inducing its intracellular signaling in a natural killer cell (e.g., a human natural killer cell), and specifically binds to the linker domain.
  • an IgGl antibody construct can be a single chain or a multi-chain polypeptide that includes an Fc region that includes a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, or at least 99% identical) to a wildtype IgGl Fc domain (e.g., a wildtype human IgGl Fc domain, e.g., SEQ ID NO: 96) and is capable of binding specifically to CDl6a (FcRgammalll) (e.g., human CDl6a), and is capable of inducing its intracellular signaling in a natural killer cell (e.g., a human natural killer cell), and specifically binds to the linker domain.
  • a wildtype IgGl Fc domain e.g., a wildtype human IgGl Fc
  • the IgGl antibody construct can be an antibody or antibody fragment that specifically binds to the linker domain and includes a non-IgGl Fc region (e.g., an IgG2, IgG3, or IgG4 Fc region) that has been altered (e.g., by substituting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids in the wildtype non-IgGl Fc region) such that the non-IgGl Fc region is capable of binding to CDl6a (FcRgammalll) (e.g., human CDl6a) and inducing its intracellular signaling in a natural killer cell (e.g., a human natural killer cell).
  • a natural killer cell e.g., a human natural killer cell
  • the IgGl antibody construct binds specifically to the linker domain and includes a non-human Fc region (e.g., a Fc region from a non-human antibody) that has been altered (e.g., by substituting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids in the wildtype non-human Fc region) such that the non-human Fc region is capable of binding to human CDl6a (human FcRgammalll) and inducing its intracellular signaling in a natural killer cell (e.g., a human natural killer cell).
  • a non-human Fc region e.g., a Fc region from a non-human antibody
  • the linker domain can have a total length of about 20 amino acids to about 220 amino acids, about 20 amino acids to about 215 amino acids, about 20 amino acids to about 210 amino acids, about 20 amino acids to about 205 amino acids, about 20 amino acids to about 200 amino acids, about 20 amino acids to about 195 amino acids, about 20 amino acids to about 190 amino acids, about 20 amino acids to about 185 amino acids, about 20 amino acids to about 180 amino acids, about 20 amino acids to about 175 amino acids
  • the linker domain can be a soluble tissue factor domain.
  • the soluble tissue factor domain can be a wildtype tissue factor polypeptide lacking the signal sequence, the transmembrane domain, and the intracellular domain.
  • the soluble tissue factor domain can be a tissue factor mutant, wherein a wildtype tissue factor polypeptide lacking the signal sequence, the transmembrane domain, and the intracellular domain, and has been further modified at selected amino acids.
  • the soluble tissue factor domain can be a soluble human tissue factor domain.
  • the soluble tissue factor domain can be a soluble mouse tissue factor domain.
  • the soluble tissue factor domain can be a soluble rat tissue factor domain.
  • soluble human tissue factor domains a mouse soluble tissue factor domain, a rat soluble tissue factor domain, and mutant soluble tissue factor domains are shown below.
  • Exemplary Soluble Human Tissue Factor Domain SEQ ID NO: 1
  • a soluble tissue factor domain can include a sequence that is at least 70% identical, at least 72% identical, at least 74% identical, at least 76% identical, at least 78% identical, at least 80% identical, at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical to SEQ ID NO: 1, 3, 4, 5, or 6.
  • a soluble tissue factor domain can include a sequence of SEQ ID NO: 1, 3, 4, 5, or 6 with one to twenty amino acids (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids removed from its N-terminus and/or one to twenty amino acids (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids removed from its C-terminus.
  • amino acids e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20
  • mutation of amino acids that are conserved between different mammalian species is more likely to decrease the activity and/or structural stability of the protein, while mutation of amino acids that are not conserved between different mammalian species is less likely to decrease the activity and/or structural stability of the protein.
  • the soluble tissue factor domain is not capable of binding to Factor Vila. In some examples, the soluble tissue factor domain does not convert inactive Factor X into Factor Xa. In some embodiments, the single-chain chimeric polypeptide does not stimulate blood coagulation in a mammal.
  • the soluble tissue factor domain can be a soluble human tissue factor domain. In some embodiments, the soluble tissue factor domain can be a soluble mouse tissue factor domain. In some embodiments, the soluble tissue factor domain can be a soluble rat tissue factor domain.
  • the soluble tissue factor domain does not include one or more (e.g., two, three, four, five, six or seven) of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
  • a lysine at an amino acid position that corresponds to amino acid position 20
  • the mutant soluble tissue factor possesses the amino acid sequence of SEQ ID NO: 5 or SEQ ID NO: 6.
  • the soluble tissue factor domain can be encoded by a nucleic acid including a sequence that is at least 70% identical, at least 72% identical, at least 74% identical, at least 76% identical, at least 78% identical, at least 80% identical, at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical to SEQ ID NO: 2.
  • the soluble tissue factor domain can have a total length of about 20 amino acids to about 220 amino acids, about 20 amino acids to about 215 amino acids, about 20 amino acids to about 210 amino acids, about 20 amino acids to about 205 amino acids, about 20 amino acids to about 200 amino acids, about 20 amino acids to about 195 amino acids, about 20 amino acids to about 190 amino acids, about 20 amino acids to about 185 amino acids, about 20 amino acids to about 180 amino acids, about 20 amino acids to about 175 amino acids, about 20 amino acids to about 170 amino acids, about 20 amino acids to about 165 amino acids, about 20 amino acids to about 160 amino acids, about 20 amino acids to about 155 amino acids, about 20 amino acids to about 150 amino acids, about 20 amino acids to about 145 amino acids, about 20 amino acids to about 140 amino acids, about 20 amino acids to about 135 amino acids, about 20 amino acids to about 130 amino acids, about 20 amino acids to about 125 amino acids, about 20 amino acids to about 120 amino acids, about 20 amino acids to about 115 amino acids, about 20 amino acids to about
  • the linker sequence can be a flexible linker sequence.
  • linker sequences that can be used are described in Klein et ah, Protein Engineering, Design & Selection Vol. 27, No. 10, pp. 325-330, 2014; Priyanka et ah, Protein Sci., 2013 Feb; 22(2): 153-167.
  • the linker sequence is a synthetic linker sequence.
  • the polypeptide can include one, two, three, four, five, six, seven, eight, nine, or ten linker sequence(s) (e.g., the same or different linker sequences, e.g., any of the exemplary linker sequences described herein or known in the art).
  • the polypeptide can include one, two, three, four, five, six, seven, eight, nine, or ten linker sequence(s) (e.g., the same or different linker sequences, e.g., any of the exemplary linker sequences described herein or known in the art).
  • a linker sequence can have a total length of 1 amino acid to about 100 amino acids, 1 amino acid to about 90 amino acids, 1 amino acid to about 80 amino acids, 1 amino acid to about 70 amino acids, 1 amino acid to about 60 amino acids, 1 amino acid to about 50 amino acids, 1 amino acid to about 45 amino acids, 1 amino acid to about 40 amino acids, 1 amino acid to about 35 amino acids, 1 amino acid to about 30 amino acids, 1 amino acid to about 25 amino acids, 1 amino acid to about 24 amino acids, 1 amino acid to about 22 amino acids, 1 amino acid to about 20 amino acids,
  • 2 amino acids to about 22 amino acids about 2 amino acids to about 20 amino acids, about 2 amino acids to about 18 amino acids, about 2 amino acids to about 16 amino acids, about 2 amino acids to about 14 amino acids, about 2 amino acids to about 12 amino acids, about 2 amino acids to about 10 amino acids, about 2 amino acids to about 8 amino acids, about 2 amino acids to about 6 amino acids, about 2 amino acids to about 4 amino acids, about 4 amino acids to about 100 amino acids, about 4 amino acids to about
  • amino acids to about 80 amino acids about 4 amino acids to about 70 amino acids, about 4 amino acids to about 60 amino acids, about 4 amino acids to about 50 amino acids, about 4 amino acids to about 45 amino acids, about 4 amino acids to about 40 amino acids, about 4 amino acids to about 35 amino acids, about 4 amino acids to about 30 amino acids, about 4 amino acids to about 25 amino acids, about 4 amino acids to about 24 amino acids, about 4 amino acids to about 22 amino acids, about 4 amino acids to about 20 amino acids, about 4 amino acids to about 18 amino acids, about 4 amino acids to about 16 amino acids, about 4 amino acids to about 14 amino acids, about 4 amino acids to about 12 amino acids, about 4 amino acids to about 10 amino acids, about 4 amino acids to about 8 amino acids, about 4 amino acids to about 6 amino acids, about 6 amino acids to about 100 amino acids, about 6 amino acids to about 90 amino acids, about 6 amino acids to about 80 amino acids, about 6 amino acids to about 70 amino acids, about 6 amino acids to about 60 amino acids, about 6 amino acids to about 50 amino acids, about
  • the linker sequence is rich in glycine (Gly or G) residues.
  • the linker sequence is rich in serine (Ser or S) residues. In some embodiments, the linker sequence is rich in glycine and serine residues. In some embodiments, the linker sequence has one or more glycine-serine residue pairs (GS), e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GS pairs. In some embodiments, the linker sequence has one or more Gly-Gly-Gly-Ser (GGGS) sequences, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGGS sequences.
  • GS glycine-serine residue pairs
  • GGGS Gly-Gly-Gly-Ser
  • the linker sequence has one or more Gly-Gly-Gly-Gly-Ser (GGGGS) sequences, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGGGS sequences. In some embodiments, the linker sequence has one or more Gly- Gly-Ser-Gly (GGSG) sequences, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGSG sequences.
  • GGGGS Gly-Gly-Gly-Ser
  • the linker sequence can comprise or consist of
  • the linker sequence can be encoded by a nucleic acid comprising or consisting of:
  • the linker sequence can comprise or consist of:
  • the first target-binding domain, the second target-binding domain, and/or the additional one or more target-binding domains can be an antigen-binding domain (e.g., any of the exemplary antigen-binding domains described herein or known in the art), a soluble interleukin or cytokine protein (e.g., any of the exemplary soluble interleukin proteins or soluble cytokine proteins described herein or known in the art), a soluble interleukin or cytokine receptor (e.g., any of the exemplary soluble interleukin receptors or soluble cytokine receptors described herein or known in the art), and ligands of co-stimulatory molecules (e.g., any of the exemplary ligands of co-stimulatory molecules described herein or known in the art).
  • an antigen-binding domain e.g., any of the exemplary antigen-binding domains described herein or known in the art
  • one or more of the first target binding domain e.g., any of the exemplary first target binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary second target binding domains described herein or known in the art
  • the one or more additional target binding domains can each, independently, bind specifically to a target selected from the group of: CDl6a, CD28, CD3 (e.g., one or more of CD3a, CD3P, CD36, CD3e, and CD3y), CD33, CD20, CD 19, CD22, CD40, CD47, CD52, CD70, CD80, CD86, CD123, CD137, CD272, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, PDL-2, TIGIT, PD-l, TIM
  • the first target-binding domain, the second target-binding domain, and/or the one or more additional target-binding domains can be a soluble interleukin, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group of: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL- 12, IL-l 5, IL-l 7, IL-18, IL-21, PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP16- binding protein.
  • the first target-binding domain, the second target-binding domain, and/or the one or more additional target-binding domains can be a soluble interleukin receptor, a soluble cytokine receptor, or a soluble cell surface receptor.
  • the soluble interleukin receptor, the soluble cytokine receptor, or the soluble cell surface receptor is soluble TGF-b receptor II (TGF- b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, or a soluble CD28.
  • the first target-binding domain, the second target-binding domain, and/or the one or more additional target-binding domains can be a ligand of a co-stimulatory molecule.
  • ligands of a co-stimulatory molecule include soluble CD80, soluble CD86, soluble CD40, soluble ICOSL, soluble CD70, soluble OX40L, soluble 4-1BBL, soluble GITRL, soluble LIGHT, soluble TIM3, soluble TIM4, soluble ICAM1, soluble LFA3, soluble CDld, or soluble LLT-l.
  • the first target-binding domain, the second target-binding domain, and/or the one or more additional target-binding domains can each independent have a total number of amino acids of about 5 amino acids to about 1000 amino acids, about 5 amino acids to about 950 amino acids, about 5 amino acids to about 900 amino acids, about 5 amino acids to about 850 amino acids, about 5 amino acids to about 800 amino acids, about 5 amino acids to about 750 amino acids, about 5 amino acids to about 700 amino acids, about 5 amino acids to about 650 amino acids, about 5 amino acids to about 600 amino acids, about 5 amino acids to about 550 amino acids, about 5 amino acids to about 500 amino acids, about 5 amino acids to about 450 amino acids, about 5 amino acids to about 400 amino acids, about 5 amino acids to about 350 amino acids, about 5 amino acids to about 300 amino acids, about 5 amino acids to about 280 amino acids, about 5 amino acids to about 260 amino acids, about 5 amino acids to about 260 amino acids, about 5 amino acids to about 350 amino acids, about 5 amino acids to about 300 amino acids, about 5
  • any of the target-binding domains described herein can bind to its target with a dissociation equilibrium constant (KD) of less than 1 x 10 7 M, less than 1 x 10 8 M, less than 1 x 10 9 M, less than 1 x 10 10 M, less than 1 x 10 11 M, less than 1 x 10 12 M, or less than 1 x 10 13 M.
  • KD dissociation equilibrium constant
  • the antigen-binding protein constructs provided herein can bind to an identifying antigen with a KD of about 1 x 10 3 M to about 1 x 10 5 M, about 1 x 10 4 M to about 1 x 10 6 M, about 1 x 10 5 M to about 1 x 10 7 M, about 1 x 10 6 M to about 1 x 10 8 M, about 1 x 10 7 M to about 1 x 10 9 M, about 1 x 10 8 M to about 1 x 10 10 M, or about 1 x 10 9 M to about 1 x l0 u M (inclusive).
  • any of the target-binding domains described herein can bind to its target with a KD of between about 1 pM to about 30 nM (e.g., about 1 pM to about 25 nM, about 1 pM to about 20 nM, about 1 pM to about 15 nM, about 1 pM to about 10 nM, about 1 pM to about 5 nM, about 1 pM to about 2 nM, about 1 pM to about 1 nM, about 1 pM to about
  • 500 pM about 1 pM to about 450 pM, about 1 pM to about 400 pM, about 1 pM to about 350 pM, about 1 pM to about 300 pM, about 1 pM to about 250 pM, about 1 pM to about
  • any of the target-binding domains described herein can bind to its target with a KD of between about 1 nM to about 10 nM (e.g., about 1 nM to about 9 nM, about 1 nM to about 8 nM, about 1 nM to about 7 nM, about 1 nM to about 6 nM, about 1 nM to about 5 nM, about 1 nM to about 4 nM, about 1 nM to about 3 nM, about 1 nM to about 2 nM, about 2 nM to about 10 nM, about 2 nM to about 9 nM, about 2 nM to about 8 nM, about 2 nM to about 7 nM, about 2 nM to about 6 nM, about 2 nM to about 5 nM, about 2 nM to about 4 nM, about 2 nM to about 3 nM, about 3 nM to about 10 nM, about 3 nM to about 10
  • the first target-binding domain and the second target-binding domain bind specifically to the same antigen. In some embodiments of any of the single-chain chimeric polypeptides or any of the multi-chain chimeric polypeptides described herein, the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of any of the single-chain chimeric polypeptides or any of the multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain include the same amino acid sequence.
  • the first target-binding domain and the second target-binding domain bind specifically to different antigens.
  • first target-binding domain and the second target-binding domain is an antigen-binding domain.
  • first target-binding domain and the second target-binding domain are each an antigen-binding domain.
  • the antigen-binding domain includes or is a scFv or a single domain antibody (e.g., a VHH or a VNAR domain).
  • an antigen-binding domain e.g., any of the antigen-binding domains described herein
  • CD3 see, e.g., those described in U.S. Patent No. 9,226,962
  • CD33 see, e.g., those described in U.S. Patent No. 8,759,494
  • CD20 see, e.g., those described in WO 2014/026054
  • CD19 see, e.g., those described in U.S. Patent No. 9,701,758
  • CD22 see, e.g., those described in WO 2003/104425
  • CD123 see, e.g., those described in WO 2014/130635)
  • IL-1R see, e.g., those described in U.S. Patent No.
  • IL-l see, e.g., those described in WO 2014/095808
  • VEGF see, e.g., those described in U.S. Patent No. 9,090,684
  • IL-6R see, e.g., those described in U.S. Patent No. 7,482,436
  • IL-4 see, e.g., those described in U.S. Patent Application Publication No.
  • IL-10 see, e.g., those described in U.S. Patent Application Publication No. 2016/0340413
  • PDL-l see, e.g., those described in Drees et al., Protein Express. Purif 94:60-66, 2014
  • TIGIT see, e.g., those described in U.S. Patent Application Publication No. 2017/0198042
  • PD-l see, e.g., those described in U.S. Patent No.
  • TIM3 see, e.g., those described in U.S. Patent No. 8,552,156
  • CTLA4 see, e.g., those described in WO 2012/120125
  • MICA see, e.g., those described in WO 2016/154585
  • MICB see, e.g., those described in U.S. Patent No. 8,753,640
  • IL-6 see, e.g., those described in Gejima et al., Human Antibodies 11 (4) : 121 - 129, 2002
  • IL-8 see, e.g., those described in U.S. Patent No.
  • TNFa see, e.g., those described in Geng et al., Immunol. Res. 62(3):377-385, 2015
  • CD26a see, e.g., those described in WO 2017/189526
  • CD36 see, e.g., those described in U.S. Patent Application
  • ULBP2 see, e.g., those described in U.S. Patent No. 9,273,136
  • CD30 see, e.g., those described in Homach et al., Scand. J. Immunol.
  • CD200 see, e.g., those described in U.S. Patent No. 9,085,623
  • IGF-1R see, e.g., those described in U.S. Patent Application Publication No.
  • MUC4AC see, e.g., those described in WO 2012/170470
  • MUC5AC see, e.g., those described in U.S. Patent No. 9,238,084
  • Trop-2 see, e.g., those described in WO 2013/068946
  • CMET see, e.g., those described in Edwardraja et al., Biotechnol. Bioeng. l06(3):367-375, 2010
  • EGFR see, e.g., those described in Akbari et al., Protein Expr. Purif. 127:8-15, 2016
  • HER1 see, e.g., those described in U.S. Patent Application Publication No.
  • HER2 see, e.g., those described in Cao et al., Biotechnol. Lett. 37(7):l347-l354, 2015
  • HER3 see, e.g., those described in U.S. Patent No. 9,505,843
  • PSMA see, e.g., those described in Parker et al., Protein Expr. Purif. 89(2): 136-145, 2013
  • CEA see, e.g., those described in WO 1995/015341
  • B7H3 see, e.g., those described in U.S. Patent No.
  • EPCAM see, e.g., those described in WO 2014/159531
  • BCMA see, e.g., those described in Smith et al., Mol. Ther. 26(6): 1447-1456, 2018
  • P-cadherin see, e.g., those described in U.S. Patent No. 7,452,537
  • CEACAM5 see, e.g., those described in U.S. Patent No. 9,617,345)
  • ULl6-binding protein see, e.g., those described in WO 2017/083612
  • HLA-DR see, e.g., Pistillo et al., Exp. Clin. Immunogenet. 14(2): 123-130, 1997)
  • DLL4 see, e.g., those described in WO 2014/007513
  • TYR03 see, e.g., those described in WO 2016/166348
  • AXL see, e.g., those described in WO 2012/175692
  • MER see, e.g., those described in WO 2016/106221
  • CD122 see, e.g., those described in U.S. Patent Application
  • the antigen binding domains present in any of the single-chain chimeric polypeptides or any of the multi-chain polypeptides described herein are each independently selected from the group consisting of: a VHH domain, a VNAR domain, and a scFv.
  • the first target binding domain, the second target-binding domain, and/or one or more of the one or more additional antigen-binding domains can be an anti-CD3 scFv.
  • the anti-CD3 scFv can include a heavy chain variable domain including a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to
  • a scFv (e.g., any of the scFvs described herein) can include a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the heavy chain variable domain and the light chain variable domain.
  • the anti-CD3 scFv can include a heavy chain variable domain encoded by a nucleic acid including a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to CAAGTTCAGCTCCAGCAAAGCGGCGCCGAACTCGCTCGGCCCGGCGCTTCCG TGAAGATGTCTTGTAAGGCCTCCGGCTATACCTTCACCCGGTACACAATGCAC TGGGTCAAGCAACGGCCCGGTCAAGGTTTAGAGTGGATTGGCTATATCAACC CCTCCCGGGGCTATACCAACTACAACCAGAAGTTCAAGGACAAAGCCACCCT CACCACCGACAAGTCCAGCAGCACCGCTTACATGCAGCTGAGCTCTTTAACA TCCGAGGATTCCGCCGTGTACTACTGCGCTCGGTACTACGACGATCATTACTG CCTCGATTACTGGGGCCAAGGTACCACCACCACCACCG
  • an anti-CD3 scFv can include a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to QIVLT Q SP AIMS ASPGEK VTMT C S AS S S VS YMNW Y QQK SGTSPKRWIYDT SKL A S GVP AHFRGS GS GT S Y SLTI S GME AED A AT Y Y C QQ W S SNPFTF GS GTKLEINRGG GGSGGGGSGGGGSQVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQ RPGQGLEWIGYINP SRGYTNYN QKFKDK ATLTTDK S S S T A YMQL S SLT SED S A V YY C ARYYDDH Y CLD YW GQGTT
  • an anti-CD3 scFv can include a sequence encoded by a nucleic acid sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to CAGATCGTGCTGACCCAGTCCCCCGCTATTATGAGCGCTAGCCCCGGTGAAA AGGTGACTATGACATGCAGCGCCAGCTCTTCCGTGAGCTACATGAACTGGTA TCAGCAGAAGTCCGGCACCAGCCCTAAAAGGTGGATCTACGACACCAGCAA GCTGGCCAGCGGCGTCCCCGCTCACTTTCGGGGCTCCGGCTCCGGAACAAGC TACTCTCTGACCATCAGCGGCATGGAAGCCGAGGATGCCGCTACCTATTACT GTCAGCAGTGGAGCTCCAACCCCTTCACCTTTGGATCCGGCACCAAGCTCGA GAT T A AT C GT GG AGGC GG AGGT AGC GG AGG AGG AGG
  • the first target binding domain, the second target-binding domain, and/or one or more of the one or more additional antigen-binding domains can be an anti-CD28 scFv.
  • the anti-CD28 scFv can include a heavy chain variable domain including a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to
  • DIEMTQ SP AIMS ASLGERVTMTCT AS S S VS S S YFHW YQQKPGS SPKLCIYST SNL A S GVPPRF SGSGSTSYSLTIS SME AED A AT YF CHQ YHRSPTF GGGTKLETKR (SEQ ID NO: 22) and/or a light chain variable domain including a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to VQLQQSGPELVKPGASVKMSCKASGYTFTSYVIQWVKQKPGQGLEWIGSINPYN D YTKYNEKFKGK ATLT SDKS SIT AYMEF S SLT SED S AL Y Y C ARW GDGNYW GRG TTLTVSS (SEQ ID NO: 23).
  • the anti-CD28 scFv can include a heavy chain variable domain encoded by a nucleic acid including a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to a nucleic acid including a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to
  • a nucleic acid including a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to a nucleic acid including a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to
  • an anti-CD28 scFv can include a sequence that is at least
  • an anti-CD28 scFv can include the six CDRs present in SEQ ID NO: 26.
  • an anti-CD28 scFv can include a sequence encoded by a nucleic acid sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to
  • any of the antigen-binding domains described herein is a BiTe, a (scFv)2, a nanobody, a nanobody -HS A, a DART, a TandAb, a scDiabody, a scDiabody-CEB, scFv-CH-CL-scFv, a HSAbody, scDiabody-HAS, or a tandem-scFv.
  • Additional examples of antigen-binding domains that can be used in any of the single chain chimeric polypeptides or multi-chain chimeric polypeptides described herein are known in the art.
  • a VHH domain is a single monomeric variable antibody domain that can be found in camelids.
  • a VNAR domain is a single monomeric variable antibody domain that can be found in cartilaginous fish.
  • Non -limiting aspects of VHH domains and VNAR domains are described in, e.g., Cromie et al., Curr. Top. Med. Chem. 15:2543-2557, 2016; De Genst et al., Dev. Comp. Immunol. 30: 187-198, 2006; De Meyer et al., Trends
  • each of the antigen-binding domains in the single-chain chimeric polypeptides or multi-chain chimeric polypeptides described herein are both VHH domains, or at least one antigen-binding domain is a VHH domain. In some embodiments, each of the antigen-binding domains in the single-chain chimeric polypeptides or multi-chain chimeric polypeptides described herein are both VNAR domains, or at least one antigen-binding domain is a VNAR domain. In some
  • each of the antigen-binding domains in the single-chain chimeric polypeptides or multi-chain chimeric polypeptides described herein are both scFv domains, or at least one antigen-binding domain is a scFv domain.
  • DARTs are described in, e.g., Garber, Nature Reviews Drug Discovery 13:799-801, 2014.
  • the antigen-binding domain can bind to an antigen selected from the group consisting of: a protein, a carbohydrate, a lipid, and a combination thereof.
  • one or both of the first target-binding domain and the second target-binding domain can be a soluble interleukin protein, soluble cytokine protein, or soluble cell surface protein.
  • the soluble interleukin, soluble cytokine protein, or soluble cell surface protein is selected from the group of: IL-2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL-18, IL-21, PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP16-binding protein (e g., ULBP1, ULBP2, ULBP3, ULBP4, ULPB5, or ULBP6.
  • a ULP16-binding protein e g., ULBP1, ULBP2, ULBP3, ULBP4, ULPB5, or ULBP6.
  • Human Soluble IL-2 (SEQ ID NO: 28)
  • AAGAC AAAGATCAAACTGTGCATTTTACTCCACGCCTTTAGGATCCGGGCCG
  • VLRREPPHCP NSFRLEKILV SVGCTCVTPI VHHVA Human Soluble IL-18 SEQ ID NO: 41
  • RDTSATPQSASI KALRNANLRR DESNHLTDLY RRDETIQVKG NGYVQSPRFP NSYPRNLLLT WRLHSQENTR IQLVFDNQFG LEEAENDICR YDFVEVEDIS ETSTI IRGRW CGHKEVPPRI KSRTNQIKIT FKSDDYFVAK PGFKIYYSLL EDFQPAAASE TNWESVTSSI SGVSYNSPSV TDPTLIADAL DKKIAEFDTV EDLLKYFNPE SWQEDLENMY LDTPRYRGRS YHDRKSKVDL DRLNDDAKRY SCTPRNYSVN IREELKLANV VFFPRCLLVQ RCGGNCGCGT VNWRSCTCNS GKTVKKYHEV LQFEPGHIKR RGRAKTMALV DIQLDHHERC DCICSSRPPR
  • Exemplary soluble cell surface proteins include soluble MICA, MICB, and a ULP16 binding protein (e g., ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, or ULBP6)
  • a ULP16 binding protein e g., ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, or ULBP6
  • Exemplary sequences for soluble MICA, MICB, EILBP1, EILBP2, EILBP3, EiLBP4, EILBP5, and EILBP6 are listed below.
  • a soluble IL-12 protein can include a first sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 33, and a second sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 35.
  • the soluble IL-12 can further include a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first sequence and the second sequence.
  • a soluble IL-12 protein is encoded by a first nucleic acid encoding a first sequence at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 34, and a second nucleic acid sequence encoding a second sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 36.
  • the nucleic acid encoding a soluble IL-12 protein further includes a nucleic acid sequence encoding a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first nucleic acid and the second nucleic acid.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • a soluble IL-12 protein includes a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 37.
  • a soluble IL-12 protein is encoded by a nucleic acid including a sequence at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 38.
  • a soluble IL-18 protein can include a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 41.
  • a soluble IL-18 protein is encoded by a nucleic acid including a sequence at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 42.
  • one or both of the first target-binding domain and the second target-binding domain is a soluble interleukin receptor or a soluble cytokine receptor.
  • the soluble receptor is a soluble TGF-b receptor II (TGF-b RII) (see, e.g., those described in Yung et al., Am. J. Resp. Crit. Care Med.
  • a scTCR see, e.g., those described in Weber et al., Nature 356(6372):793-796, 1992
  • a soluble CD155 see, e.g., those described in Tahara-Hanaoka et al., Int. Immunol. l6(4):533-538, 2004
  • a soluble CD28 see, e.g., Hebbar et al., Clin. Exp. Immunol. 136:388-392, 2004.
  • a soluble TGF RII receptor can include a first sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to
  • the soluble TGF-b RII receptor can further include a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first sequence and the second sequence.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • a soluble TGF-b RII receptor is encoded by a first nucleic acid encoding a first sequence at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to
  • the nucleic acid encoding a soluble TGF-b RII receptor further includes a nucleic acid sequence encoding a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first nucleic acid and the second nucleic acid.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • a soluble TGF-b RII receptor includes a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to
  • a soluble TGF-b RII receptor is encoded by a nucleic acid including a sequence at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to
  • one or both of the first target-binding domain and the second target-binding domain is a ligand of a co-stimulatory molecule.
  • the ligand of a co-stimulatory molecule is a soluble CD80 (see, e.g., those described in Haile et al., J Immunol. 2013 Sep 1;191(5):2829-36, and those described W02004/076488 Al), a soluble CD86 (see, e.g., those described in Jeannin et al., Immunity. 2000 Sep;l3(3):303-l2, and those described in WO 2004/076488 Al), a soluble CD40 (see, e.g., those described in Elgueta et al., Immunological Reviews ,
  • a soluble ICOSL see, e.g., those described in Chattopadyhay et al., J. Immunol ., September 15, 2006, 111 (6) 3920-3929
  • a soluble CD70 see, e.g., those described in Miller et al., J. Neurosurg, 2010 Aug;l l3(2):280-5, and those described in US 2009/0148942 Al
  • a soluble OX40L see, e.g., those described in Kondo et al., Hum. Immunol ., 2007 Jul;68(7):563-7l.
  • a soluble 4-1BBL see, e.g., those described in Wang et al., Cancer Immunol Immunother., 2012 Apr;6l(4):489-95
  • a soluble GITRL see, e.g., those described in Stone et al., J Virol., 2006 Feb;80(4): l762- 72
  • a soluble LIGHT see, e.g., those described in Maeda et al., J. Immunol .. 2018 Jul 1;201(1):202-214
  • a soluble TIM3 see, e.g., those described in Clayton et al., J. Virol.,
  • a soluble TIM4 see, e.g., those described in Rhein et al., J. Virol., 2016 Jun 10;90(13):6097-6111
  • soluble a ICAM1 see, e.g., those described in Witkowsa and Borawska, Eur Cytokine Netw. 2004 Apr-Jun;l5(2):9l-8
  • a soluble LFA3 see, e.g., those described in Menshawy et al., Comparative Clinical Pathology, 27(3), 721-727, doi.org/l0.
  • l007/s00580-0l8-2657-x a soluble CDld (see, e.g., those described in Brennan et al., PNAS, August 1, 2017 114 (31) 8348-8353), or a soluble LLT-l (see, e.g., those described in Chalan et al., PLoS ONE, 10(7), e0l32436, doi.org/l0.l37l/journal.pone.0l32436).
  • a soluble CD80, a soluble CD86, a soluble CD40, a soluble ICOSL, a soluble CD70, a soluble OX40L, a soluble 4-1BBL, a soluble GITRL, a soluble LIGHT, a soluble TIM3, a soluble TIM4, a soluble ICAM1, a soluble LFA3, a soluble CDld, or a soluble LLT-l can include a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical) to the wild type sequence.
  • any of the single-chain chimeric polypeptides or multi- chain chimeric polypeptides described herein can further include one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) at its N- and/or C-terminus.
  • additional target-binding domains e.g., any of the exemplary target-binding domains described herein or known in the art
  • the single-chain chimeric polypeptide or multi-chain chimeric polypeptide can include one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domains (e.g., any of the exemplary target- binding domains described herein or known in the art) at its N-terminus.
  • additional target-binding domains e.g., any of the exemplary target- binding domains described herein or known in the art
  • one of the one or more additional target-binding domains at the N- terminus of the single-chain chimeric polypeptide or multi-chain chimeric polypeptide can directly abut the first target-binding domain (e.g., any of the exemplary target- binding domains described herein or known in the art), the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), or the linker domain (e.g., any of the exemplary linker domains described herein).
  • first target-binding domain e.g., any of the exemplary target- binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the linker domain e.g., any of the exemplary linker domains described herein.
  • the single-chain chimeric polypeptide or multi-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between one of the at least one additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) at the N-terminus of the single-chain chimeric polypeptide and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), or the linker domain (e.g., any of the exemplary linker domains described herein).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the polypeptide includes one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) at its C-terminus.
  • additional target-binding domains e.g., any of the exemplary target-binding domains described herein or known in the art
  • one of the one or more additional target-binding domains at the C-terminus of the single-chain chimeric polypeptide or the multi-chain chimeric polypeptide directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), or the linker domain (e.g., any of the exemplary linker domains described herein or known in the art).
  • the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the linker domain e.g., any of the exemplary linker domains described herein or known in the art.
  • the single-chain chimeric polypeptide or multi-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between one of the at least one additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) at the C-terminus of the single-chain chimeric polypeptide and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), or the linker domain (e.g., any of the exemplary linker domains described herein).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the polypeptide comprises one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) at its N-terminus and its C-terminus.
  • additional target binding domains e.g., any of the exemplary target-binding domains described herein or known in the art
  • one of the one or more additional antigen binding domains at the N-terminus of the single-chain chimeric polypeptide or the multi-chain chimeric polypeptide directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), or the linker domain (e.g., any of the exemplary linker domains described herein).
  • the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the linker domain e.g., any of the exemplary linker domains described herein.
  • the single-chain chimeric polypeptide or multi-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between one of the one or more additional antigen-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) at the N- terminus and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), or the linker domain (e.g., any of the exemplary linker domains).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • one of the one or more additional antigen binding domains at the C-terminus directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), or the linker domain (e.g., any of the exemplary linker domains).
  • the single- chain chimeric polypeptide or multi-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between one of the one or more additional antigen-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) at the C-terminus and the first target-binding domain(e.g., any of the exemplary target-binding domains described herein or known in the art), the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art), or the linker domain (e.g., any of the exemplary linker domains described herein).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the one or more additional target-binding domains bind specifically to the same antigen.
  • two or more (e.g., three, four, five, six, seven, eight, nine, or ten) of the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the one or more additional target-binding domains bind specifically to the same epitope.
  • two or more (e.g., three, four, five, six, seven, eight, nine, or ten) of the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the one or more additional target-binding domains include the same amino acid sequence.
  • the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the one or more e.g., two, three, four, five, six, seven, eight, nine, or ten
  • additional target-binding domains e.g., any of the exemplary target- binding domains described herein or known in the art
  • the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the one or more e.g., two, three, four, five, six, seven, eight, nine, or ten
  • additional target-binding domains e.g., any of the exemplary target- binding domains described herein or known in the art
  • the first target-binding domain, the second target-binding domain, and the one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domains each comprise the same amino acid sequence.
  • the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the one or more e.g., two, three, four, five, six, seven, eight, nine, or ten
  • additional target-binding domains e.g., any of the exemplary target- binding domains described herein or known in the art
  • one or more of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen-binding domain (e.g., any of the exemplary antigen-binding domains described herein or known in the art).
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen-binding domain (e.g., any of the exemplary antigen-binding domains described herein or known in the art).
  • the antigen-binding domain can include a scFv or a single domain antibody.
  • CD 19 CD22, CD40, CD47, CD52, CD70, CD80, CD86, CD123, CD137, CD272, IL-1R, IL-l, VEGF, IL-6R, IL-4, IL-10, PDL-l, PDL-2, TIGIT, PD-l, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNFa, CD26a, CD36, ULBP2, CD30, CD200, IGF-1R, MUC4AC, MUC5AC, Trop-2, CMET, EGFR, HER1, HER2, HER3, PSMA, CEA, B7H3, B7-H4, HVEM, EPCAM, BCMA, P-cadherin, CEACAM5, VISTA, a UL16-binding protein, HLA-DR, DLL4, TYR03, AXL, MER, CD122, CD155, PDGF-DD, ILT3, ILT4, TIGIT, MHCII, LAG3,
  • one or more of the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the one or more additional target- binding domains e.g., any of the exemplary target-binding domains described herein or known in the art
  • Non-limiting examples of soluble interleukin proteins, soluble cytokine proteins, or soluble cell surface proteins include: IL-l, IL-2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL- 17, IL- 18, IL-21 , PDGF-DD, SCF, FLT3L, MICA, MICB, and a ULP 16-binding protein.
  • one or more of the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
  • the one or more additional target binding domains is a soluble interleukin or cytokine receptor.
  • Non-limiting examples of soluble interleukin receptors and soluble cytokine receptors include: a soluble TGF-b receptor II (TGF-b RII), a soluble TGF-b RIII, a soluble NKG2D, a soluble NKp30, a soluble NKp44, a soluble NKp46, a soluble DNAM-l, a scMHCI, a scMHCII, a scTCR, a soluble CD155, a soluble CD122, a soluble CD3, or a soluble CD28.
  • TGF-b RII soluble TGF-b receptor II
  • a soluble TGF-b RIII soluble NKG2D
  • a soluble NKp30 a soluble NKp44, a soluble NKp46
  • a soluble DNAM-l a scMHCI, a scMHCII, a scTCR
  • the first chimeric polypeptide further includes one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domain(s) (e.g., any of the exemplary target-binding domains described herein or known in the art), where at least one of the one or more additional antigen-binding domain(s) is positioned between the linker domain (e.g., any of the exemplary linker domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein).
  • additional target-binding domain(s) e.g., any of the exemplary target-binding domains described herein or known in the art
  • the linker domain e.g., any of the exemplary linker domains described herein or known in the art
  • the first domain of the pair of affinity domains e.g., any of the exemplary first
  • the first chimeric polypeptide of a multi-chain chimeric polypeptide can further include a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the linker domain (e.g., any of the exemplary linker domains described herein) and the at least one of the one or more additional target-binding domain(s) (e.g., any of the exemplary target-binding domains described herein or known in the art), and/or a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the at least one of the one or more additional target-binding domain(s) (e.g., any of the exemplary target- binding domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein).
  • a linker sequence e.g., any
  • the first chimeric polypeptide further includes one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domains at the N-terminal and/or C-terminal end of the first chimeric polypeptide.
  • At least one of the one or more additional target-binding domains directly abuts the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide of a multi-chain chimeric polypeptide.
  • the first chimeric polypeptide of a multi-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the at least one of the one or more additional target-binding domains directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) in the first chimeric polypeptide of a multi- chain chimeric polypeptide.
  • the first chimeric polypeptide of a multi-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the at least one of the one or more additional target-binding domains (e.g., any of the exemplary target- binding domains described herein or known in the art) and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art).
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • At least one of the one or more additional target-binding domains is disposed at the N- and/or C-terminus of the first chimeric polypeptide, and at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) is positioned between the linker domain (e.g., any of the exemplary linker domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • the linker domain e.g., any of the exemplary linker domains described herein or known in the art
  • the first domain of the pair of affinity domains e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein
  • the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) of the one or more additional target-binding domains disposed at the N-terminus directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide of a multi-chain chimeric polypeptide.
  • the first chimeric polypeptide of a multi- chain chimeric polypeptide further comprises a linker sequence (e.g., any of the linker sequences described herein or known in the art) disposed between the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • a linker sequence e.g., any of the linker sequences described herein or known in the art
  • the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) of the one or more additional target-binding domains disposed at the C-terminus directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide of a multi-chain chimeric polypeptide.
  • the first chimeric polypeptide of a multi- chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) disposed between the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • the at least one of the one or more additional target-binding domains positioned between the linker domain (e.g., any of the exemplary linker domains described herein) and the first domain of the pair of affinity domains (e.g., any of the first domains described herein or any of the exemplary pairs of affinity domains described herein), directly abuts the linker domain and/or the first domain of the pair of affinity domains.
  • the first chimeric polypeptide of a multi-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) disposed (i) between the linker domain (e.g., any of the exemplary linker domains described herein) and the at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) positioned between the linker domain (e.g., any of the exemplary linker domains described herein) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein), and/or (ii) between the first domain of the pair of affinity domains and the at least one of the one or more additional target-binding domains positioned between the linker domain and the first domain of the pair of affinity domains.
  • a linker sequence e.g
  • the second chimeric polypeptide further includes one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) at the N- terminal end and/or the C-terminal end of the second chimeric polypeptide.
  • additional target-binding domains e.g., any of the exemplary target-binding domains described herein or known in the art
  • At least one of the one or more additional target-binding domains directly abuts the second domain of the pair of affinity domains (e.g., any of the exemplary second domains of any of the exemplary pairs of affinity domains described herein) in the second chimeric polypeptide of a multi-chain chimeric polypeptide.
  • the second domain of the pair of affinity domains e.g., any of the exemplary second domains of any of the exemplary pairs of affinity domains described herein
  • the second chimeric polypeptide of a multi-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between at least one of the one or more additional target- binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) and the second domain of the pair of affinity domains (e.g., any of the second domains described herein of any of the exemplary pairs of affinity domains described herein) in the second chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • At least one of the one or more additional target-binding domains directly abuts the second target- binding domain (e.g., any of the target-binding domains described herein or known in the art) in the second chimeric polypeptide of a multi-chain chimeric polypeptide.
  • the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between at least one of the one or more additional target-binding domains (e.g., any of the exemplary target binding domains described herein or known in the art) and the second target- binding domain (e.g., any of the exemplary target binding domains described herein or known in the art) in the second chimeric polypeptide.
  • a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
  • two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same antigen.
  • two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same epitope.
  • two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains include the same amino acid sequence.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same antigen.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same epitope.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each include the same amino acid sequence.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to different antigens.
  • one or more (e.g., two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen binding domain.
  • the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen-binding domain (e.g., a scFv or a single-domain antibody).
  • a multi-chain chimeric polypeptide includes: 1) a first chimeric polypeptide that includes a first domain of a pair of affinity domains, and 2) a second chimeric polypeptide that includes a second domain of a pair of affinity domains such that the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains.
  • the pair of affinity domains is a sushi domain from an alpha chain of an IL-15 receptor (ILl5Ra) (e.g., a human IL-15 receptor (IL-l5Ra)) and a soluble IL-15 (e.g., a human soluble IL-15).
  • a sushi domain also known as a short consensus repeat or type 1 glycoprotein motif, is a common motif in protein-protein interaction.
  • Sushi domains have been identified on a number of protein-binding molecules, including complement components Clr, Cls, factor H, and C2m, as well as the nonimmunologic molecules factor XIII and P2-glycoprotein.
  • Atypical Sushi domain has approximately 60 amino acid residues and contains four cysteines (Ranganathan, Pac. Symp Biocomput. 2000: 155-67). The first cysteine can form a disulfide bond with the third cysteine, and the second cysteine can form a disulfide bridge with the fourth cysteine.
  • the soluble IL-15 has a D8N or D8A amino acid substitution.
  • one member of the pair of affinity domains is an alpha chain of human IL-15 receptor (ILl5Ra)
  • the human ILl5Ra is a mature full-length ILl5Ra.
  • the pair of affinity domains is barnase and barnstar.
  • the pair of affinity domains is a PKA and an AKAP.
  • the pair of affinity domains is an adapter/docking tag module based on mutated RNase I fragments (Rossi, Proc Natl Acad Sci USA. 103:6841-6846, 2006;
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide includes a first domain of a pair of affinity domains and a second chimeric polypeptide of the multi-chain chimeric polypeptide includes a second domain of a pair of affinity domains, wherein the first domain of the pair of affinity domains and the second domain of the pair of affinity domains bind to each other with a dissociation equilibrium constant (KD) of less than 1 x 10 7 M, less than 1 x 10 8 M, less than 1 x 10 9 M, less than 1 x 10 10 M, less than 1 x 10 11 M, less than 1 x 10 12 M, or less than 1 x 10 13
  • KD dissociation equilibrium constant
  • the first domain of the pair of affinity domains and the second domain of the pair of affinity domains bind to each other with a KD of about 1 x 10 4 M to about 1 x 10 6 M, about 1 x 10 5 M to about 1 x 10 7 M, about 1 x 10 6 M to about 1 x 10 8 M, about 1 x 10 7 M to about 1 x 10 9 M, about 1 x 10 8 M to about 1 x 10 10 M, about 1 x 10 9 M to about 1 x 10 11 M, about 1 x 10 10 M to about 1 x 10 12 M, about 1 x 10 11 M to about 1 x 10 13 M, about 1 x 10 4 M to about 1 x 10 5 M, about 1 x 10 5 M to about 1 x 10 6 M, about 1 x 10 6 M to about 1 x 10 7 M, about 1 x 10 7 M to about 1 x 10 8 M, about 1 x 10 8 M to about 1 x 10 9 M, about 1 x 10 9 M to
  • any of a variety of different methods known in the art can be used to determine the KD value of the binding of the first domain of the pair of affinity domains and the second domain of the pair of affinity domains (e.g., an electrophoretic mobility shift assay, a filter binding assay, surface plasmon resonance, and a biomolecular binding kinetics assay, etc.).
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide includes a first domain of a pair of affinity domains and a second chimeric polypeptide of the multi-chain chimeric polypeptide includes a second domain of a pair of affinity domains, wherein the first domain of the pair of affinity domains, the second domain of the pair of affinity domains, or both is about 10 to 100 amino acids in length.
  • a first domain of a pair of affinity domains, a second domain of a pair of affinity domains, or both can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to 100 amino acids in length, about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to 100 amino acids in length, about 90 to 100 amino acids in length, about 95 to 100 amino acids in length, about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to 70 amino acids in length, about 10 to 65 amino acids in length
  • a soluble IL-15 can include one or more additional amino acids at the N-terminus and/or the C-terminus, while still retaining the ability to bind to a sushi domain from an alpha chain of human IL-15 receptor (ILl5Ra).
  • ILl5Ra human IL-15 receptor
  • a non-limiting example of a sushi domain from an alpha chain of IL-15 receptor alpha can include a sequence that is at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical to
  • a sushi domain from an alpha chain of ILl5Ra can be encoded by a nucleic acid including
  • a soluble IL-15 can include a sequence that is at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical to NW VN VI SDLKKIEDLIQ SMHID ATLYTE SD VHP SCK VTAMKCFLLELQ VI SLE SGD ASIHDTVENLIILANN SLS SNGNVTESGCKECEELEEKNIKEFLQSF VHIV QMFINT
  • a soluble IL-15 can be encoded by a nucleic acid including the sequence of
  • AACTGGGT GAACGT C ATC AGCGATTTAAAGAAGATCGAAGATTTAATTC AGTC CATGCATATCGACGCCACTTTATACACAGAATCCGACGTGCACCCCTCTTGTAA GGT GACCGCC AT GAAAT GTTTTTTACTGGAGCTGC AAGTTATCTCTTTAGAGAG CGGAGACGCTAGCATCCACGACACCGTGGAGAATTTAATCATTTTAGCCAATA ACTCTTTATCCAGCAACGGCAACGTGACAGAGTCCGGCTGCAAGGAGTGCGA AGAGCTGGAGGAGAAGAAC ATC AAGGAGTTTCTGCAATCCTTTGTGCACATTG TCCAGATGTTCATCAATACCTCC (SEQ ID NO: 110).
  • a single-chain chimeric polypeptide includes a signal sequence at its N-terminal end.
  • a signal sequence is an amino acid sequence that is present at the N-terminus of a number of endogenously produced proteins that directs the protein to the secretory pathway (e.g., the protein is directed to reside in certain intracellular organelles, to reside in the cell membrane, or to be secreted from the cell).
  • Signal sequences are an amino acid sequence that is present at the N-terminus of a number of endogenously produced proteins that directs the protein to the secretory pathway (e.g., the protein is directed to reside in certain intracellular organelles, to reside in the cell membrane, or to be secreted from the cell).
  • signal sequences are typically 16 to 30 amino acids in length and include a hydrophilic, usually positively charged N-terminal region, a central hydrophobic domain, and a C-terminal region that contains the cleavage site for signal peptidase.
  • a single-chain chimeric polypeptide includes a signal sequence having an amino acid sequence MKWVTFISLLFLFSSAYS (SEQ ID NO: 62). In some embodiments, a single chain chimeric polypeptide includes a signal sequence encoded by the nucleic acid sequence
  • a single-chain chimeric polypeptide includes a signal sequence having an amino acid sequence MKCLLYLAFLFLGVNC (SEQ ID NO: 66). In some embodiments, a single-chain chimeric polypeptide includes a signal sequence having an amino acid sequence
  • a single-chain chimeric polypeptide includes a signal sequence having an amino acid sequence
  • a single-chain chimeric polypeptide includes a signal sequence having an amino acid sequence MD SKGS SQKGSRLLLLLVV SNLLLCQGVV S (SEQ ID NO: 69).
  • Those of ordinary skill in the art will be aware of other appropriate signal sequences for use in a single-chain chimeric polypeptide.
  • a single-chain chimeric polypeptide includes a signal sequence that is about 10 to 100 amino acids in length.
  • a signal sequence can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to 100 amino acids in length, about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to 100 amino acids in length, about 90 to 100 amino acids in length, about 95 to 100 amino acids in length, about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to 70 amino acids in length.
  • any of the signal sequences disclosed herein can include one or more additional amino acids (e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids) at its N-terminus and/or C-terminus, so long as the function of the signal sequence remains intact.
  • additional amino acids e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids
  • MKWVTFISLLFLFSSAYS (SEQ ID NO: 62) can include one or more additional amino acids at the N-terminus or C-terminus, while still retaining the ability to direct the single- chain chimeric polypeptide to the secretory pathway.
  • a single-chain chimeric polypeptide includes a signal sequence that directs the single-chain chimeric polypeptide into the extracellular space. Such embodiments are useful in producing single-chain chimeric polypeptides that are relatively easy to be isolated and/or purified.
  • a multi-chain chimeric polypeptide includes a first chimeric polypeptide that includes a signal sequence at its N-terminal end. In some embodiments, a multi-chain chimeric polypeptide includes a second chimeric polypeptide that includes a signal sequence at its N-terminal end. In some embodiments, both the first chimeric polypeptide of a multi-chain chimeric polypeptide and a second chimeric polypeptide of the multi-chain chimeric polypeptide include a signal sequence.
  • a signal sequence is an amino acid sequence that is present at the N-terminus of a number of endogenously produced proteins that directs the protein to the secretory pathway (e.g., the protein is directed to reside in certain intracellular organelles, to reside in the cell membrane, or to be secreted from the cell).
  • Signal sequences are heterogeneous and differ greatly in their primary amino acid sequences. However, signal sequences are typically 16 to 30 amino acids in length and include a hydrophilic, usually positively charged N-terminal region, a central hydrophobic domain, and a C-terminal region that contains the cleavage site for signal peptidase.
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence encoded by the nucleic acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence that is about 10 to 100 amino acids in length.
  • a signal sequence can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to 100 amino acids in length, about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to 100 amino acids in length, about 90 to 100 amino acids in length, about 95 to 100 amino acids in length, about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to 70 amino acids in length, about
  • a signal sequence is about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or
  • any of the signal sequences disclosed herein can include one or more additional amino acids (e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids) at its N-terminus and/or C-terminus, so long as the function of the signal sequence remains intact.
  • additional amino acids e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids
  • MKCLLYLAFLFLGVNC (SEQ ID NO: 66) can include one or more additional amino acids at the N-terminus or C-terminus, while still retaining the ability to direct a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both to the secretory pathway.
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence that directs the multi-chain chimeric polypeptide into the extracellular space.
  • Such embodiments are useful in producing multi-chain chimeric polypeptides that are relatively easy to be isolated and/or purified.
  • a single-chain chimeric polypeptide includes a peptide tag (e.g., at the N-terminal end or the C-terminal end of the single-chain chimeric
  • a single-chain chimeric polypeptide includes two or more peptide tags.
  • Exemplary peptide tags that can be included in a single-chain chimeric polypeptide include, without limitation, AviTag (GLNDIFEAQKIEWHE; SEQ ID NO: 70), a calmodulin-tag (KRRWKKNFIAVS AANRFKKIS S SGAL; SEQ ID NO: 71), a polyglutamate tag (EEEEEE; SEQ ID NO: 72), an E-tag (GAPVPYPDPLEPR; SEQ ID NO: 73), a FLAG-tag (DYKDDDDK; SEQ ID NO: 74), an HA-tag, a peptide from hemagglutinin (YPYDVPDYA; SEQ ID NO: 75), a his-tag (HHHHH (SEQ ID NO: 76); HHHHHH (SEQ ID NO: 77); HHHHHHH (SEQ ID NO: 78); HHHHHHHH (SEQ ID NO: 79); HHHHHHHHH (SEQ ID NO: 80); or HHHHHHHH
  • tissue factor protein is a peptide tag.
  • Peptide tags that can be included in a single-chain chimeric polypeptide can be used in any of a variety of applications related to the single-chain chimeric polypeptide.
  • a peptide tag can be used in the purification of a single-chain chimeric polypeptide.
  • a single-chain chimeric polypeptide can include a myc tag; and can be purified using an antibody that recognizes the myc tag(s).
  • an antibody that recognizes a myc tag is 9E10, available from the non-commercial Developmental Studies Hybridoma Bank.
  • a single-chain chimeric polypeptide can include a histidine tag, and can be purified using a nickel or cobalt chelate.
  • a peptide tag is removed from the single-chain chimeric polypeptide after purification. In some embodiments, a peptide tag is not removed from the single-chain chimeric polypeptide after purification.
  • Peptide tags that can be included in a single-chain chimeric polypeptide can be used, for example, in immunoprecipitation of the single-chain chimeric polypeptide, imaging of the single-chain chimeric polypeptide (e.g., via Western blotting, ELISA, flow cytometry, and/or immunocytochemistry), and/or solubilization of the single-chain chimeric polypeptide.
  • a single-chain chimeric polypeptide includes a peptide tag that is about 10 to 100 amino acids in length.
  • a peptide tag can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to 100 amino acids in length, about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to 100 amino acids in length, about 90 to 100 amino acids in length, about 95 to 100 amino acids in length, about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to
  • Peptide tags included in a single-chain chimeric polypeptide can be of any suitable length.
  • peptide tags can be 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids in length.
  • the two or more peptide tags can be of the same or different lengths.
  • any of the peptide tags disclosed herein may include one or more additional amino acids (e.g., 1, 2, 3, 5, 6, 7, 8,
  • a multi-chain chimeric polypeptide includes a first chimeric polypeptide that includes a peptide tag (e.g., at the N-terminal end or the C- terminal end of the first chimeric polypeptide).
  • a multi-chain chimeric polypeptide includes a second chimeric polypeptide that includes a peptide tag (e.g., at the N-terminal end or the C-terminal end of the second chimeric polypeptide).
  • both the first chimeric polypeptide of a multi-chain chimeric polypeptide and a second chimeric polypeptide of the multi-chain chimeric polypeptide include a peptide tag.
  • a first chimeric polypeptide of a multi- chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both include two or more peptide tags.
  • Exemplary peptide tags that can be included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both include, without limitation, AviTag
  • EEEEE SEQ ID NO: 72
  • E-tag GAPVPYPDPLEPR; SEQ ID NO: 73
  • FLAG- tag DYKDDDDK; SEQ ID NO: 74
  • HA-tag a peptide from hemagglutinin
  • tissue factor protein is a peptide tag.
  • Peptide tags that can be included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both can be used in any of a variety of applications related to the multi- chain chimeric polypeptide.
  • a peptide tag can be used in the purification of a multi-chain chimeric polypeptide.
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide e.g., a recombinantly expressed first chimeric polypeptide
  • a second chimeric polypeptide of the multi-chain chimeric polypeptide e.g., a recombinantly expressed second chimeric polypeptide
  • both can include a myc tag
  • the multi-chain chimeric polypeptide that includes the myc-tagged first chimeric polypeptide, the myc-tagged second chimeric polypeptide, or both can be purified using an antibody that recognizes the myc tag(s).
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide e.g., a recombinantly expressed first chimeric polypeptide
  • a second chimeric polypeptide of the multi-chain chimeric polypeptide e.g., a recombinantly expressed second chimeric polypeptide
  • both can include a histidine tag
  • the multi-chain chimeric polypeptide that includes the histidine-tagged first chimeric polypeptide, the histidine-tagged second chimeric polypeptide, or both can be purified using a nickel or cobalt chelate.
  • a peptide tag is removed from the first chimeric polypeptide and/or the second chimeric polypeptide of the multi-chain chimeric polypeptide after purification. In some embodiments, a peptide tag is not removed from the first chimeric polypeptide and/or the second chimeric polypeptide of the multi-chain chimeric polypeptide after purification.
  • Peptide tags that can be included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both can be used, for example, in immunoprecipitation of the multi-chain chimeric polypeptide, imaging of the multi-chain chimeric polypeptide (e.g., via Western blotting, ELISA, flow cytometry, and/or immunocytochemistry), and/or solubilization of the multi-chain chimeric polypeptide.
  • a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a peptide tag that is about 10 to 100 amino acids in length.
  • a peptide tag can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to 100 amino acids in length, about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to 100 amino acids in length, about 90 to 100 amino acids in length, about 95 to 100 amino acids in length, about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to 70 amino acids in length, about 10 to 65 amino acids in length, about 10 to 60 amino acids in length, about 10 to 55 amino acids in length, about
  • Peptide tags included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both can be of any suitable length.
  • peptide tags can be 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids in length.
  • the two or more peptide tags can be of the same or different lengths.
  • any of the peptide tags disclosed herein may include one or more additional amino acids (e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids) at the N-terminus and/or C-terminus, so long as the function of the peptide tag remains intact.
  • a myc tag having the amino acid sequence EQKLISEEDL can include one or more additional amino acids (e.g., at the N-terminus and/or the C- terminus of the peptide tag), while still retaining the ability to be bound by an antibody (e.g., 9E10).
  • the first target-binding domain and/or the second target-binding domain can independently bind specifically to CD3 (e.g., human CD3) or CD28 (e.g., human CD28).
  • the first target-binding domain binds specifically to CD3 (e.g., human CD3) and the second target-binding domain binds specifically to CD28 (e.g., human CD28).
  • the first target-binding domain binds specifically to CD28 (e.g., human CD28) and the second target-binding domain binds specifically to CD3 (e.g., human CD3).
  • the first target- binding domain and the soluble tissue factor domain directly abut each other.
  • the single-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain.
  • the soluble tissue factor domain and the second target-binding domain directly abut each other.
  • the single-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the soluble tissue factor domain and the second target-binding domain.
  • first target-binding domain and the second target-binding domain is an antigen binding domain.
  • first target-binding domain and the second target-binding domain are each an antigen- binding domain (e.g., any of the exemplary antigen-binding domains described herein).
  • the antigen-binding domain includes a scFv or a single domain antibody.
  • a non-limiting example of an scFv that binds specifically to CD3 can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
  • an scFv that binds specifically to CD3 can be encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Cell Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Wood Science & Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Endocrinology (AREA)
  • Mycology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Virology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2019/049158 2018-08-30 2019-08-30 Single-chain and multi-chain chimeric polypeptides and uses thereof Ceased WO2020047473A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
CN201980069954.9A CN113015744B (zh) 2018-08-30 2019-08-30 单链嵌合多肽和多链嵌合多肽以及其用途
CA3109361A CA3109361A1 (en) 2018-08-30 2019-08-30 Single-chain and multi-chain chimeric polypeptides and uses thereof
EP19779635.2A EP3844182B1 (en) 2018-08-30 2019-08-30 Single-chain and multi-chain chimeric polypeptides and uses thereof
AU2019328575A AU2019328575B2 (en) 2018-08-30 2019-08-30 Single-chain and multi-chain chimeric polypeptides and uses thereof
EP25175073.3A EP4592314A3 (en) 2018-08-30 2019-08-30 Single-chain and multi-chain chimeric polypeptides and uses thereof
CN202510209794.0A CN120365435A (zh) 2018-08-30 2019-08-30 单链嵌合多肽和多链嵌合多肽以及其用途
JP2021536663A JP7474769B2 (ja) 2018-08-30 2019-08-30 一本鎖および多鎖キメラポリペプチドならびにその使用方法
IL280920A IL280920A (en) 2018-08-30 2021-02-16 Single-chain and multi-chain chimeric polypeptides and uses thereof
JP2024065081A JP7745032B2 (ja) 2018-08-30 2024-04-15 一本鎖および多鎖キメラポリペプチドならびにその使用方法
AU2024227260A AU2024227260B2 (en) 2018-08-30 2024-10-11 Single-chain and multi-chain chimeric polypeptides and uses thereof

Applications Claiming Priority (26)

Application Number Priority Date Filing Date Title
US201862724969P 2018-08-30 2018-08-30
US201862725043P 2018-08-30 2018-08-30
US201862725038P 2018-08-30 2018-08-30
US201862725010P 2018-08-30 2018-08-30
US62/725,010 2018-08-30
US62/725,043 2018-08-30
US62/725,038 2018-08-30
US62/724,969 2018-08-30
US201862746832P 2018-10-17 2018-10-17
US62/746,832 2018-10-17
US201862749007P 2018-10-22 2018-10-22
US62/749,007 2018-10-22
US201862749506P 2018-10-23 2018-10-23
US62/749,506 2018-10-23
US201962816683P 2019-03-11 2019-03-11
US62/816,683 2019-03-11
US201962817241P 2019-03-12 2019-03-12
US201962817244P 2019-03-12 2019-03-12
US201962817230P 2019-03-12 2019-03-12
US62/817,241 2019-03-12
US62/817,244 2019-03-12
US62/817,230 2019-03-12
US201962881088P 2019-07-31 2019-07-31
US201962881039P 2019-07-31 2019-07-31
US62/881,039 2019-07-31
US62/881,088 2019-07-31

Publications (1)

Publication Number Publication Date
WO2020047473A1 true WO2020047473A1 (en) 2020-03-05

Family

ID=67982166

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/US2019/049158 Ceased WO2020047473A1 (en) 2018-08-30 2019-08-30 Single-chain and multi-chain chimeric polypeptides and uses thereof
PCT/US2019/049142 Ceased WO2020047462A2 (en) 2018-08-30 2019-08-30 Methods of treating aging-related disorders

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/US2019/049142 Ceased WO2020047462A2 (en) 2018-08-30 2019-08-30 Methods of treating aging-related disorders

Country Status (8)

Country Link
US (4) US11730762B2 (https=)
EP (3) EP4592314A3 (https=)
JP (4) JP7474769B2 (https=)
CN (4) CN120365435A (https=)
AU (4) AU2019328575B2 (https=)
CA (2) CA3109361A1 (https=)
IL (2) IL280919B2 (https=)
WO (2) WO2020047473A1 (https=)

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021163298A1 (en) * 2020-02-11 2021-08-19 HCW Biologics, Inc. Methods of activating regulatory t cells
WO2021247003A1 (en) * 2020-06-01 2021-12-09 HCW Biologics, Inc. Methods of treating aging-related disorders
WO2021247604A1 (en) * 2020-06-01 2021-12-09 HCW Biologics, Inc. Methods of treating aging-related disorders
WO2022086988A1 (en) * 2020-10-20 2022-04-28 Cura Therapeutics, Inc. Multi-functional and multi-valent interleukin-tgf-beta receptor fusion polypeptides
US11401324B2 (en) 2018-08-30 2022-08-02 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
US11407814B2 (en) 2020-10-20 2022-08-09 Cura Therapeutics, Inc. Multi-functional and multi-valent interleukin-TGF-beta receptor fusion polypeptides
WO2022178033A1 (en) * 2021-02-17 2022-08-25 Cura Therapeutics, Inc. Anti-pathogen interleukin-tgf-beta receptor fusion polypeptides
US11471490B2 (en) 2017-07-03 2022-10-18 Torque Therapeutics, Inc. T cells surface-loaded with immunostimulatory fusion molecules and uses thereof
US11518792B2 (en) 2018-08-30 2022-12-06 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
US11672826B2 (en) 2018-08-30 2023-06-13 HCW Biologics, Inc. Methods of treating aging-related disorders
WO2023133357A3 (en) * 2022-01-10 2023-08-10 Expression Therapeutics, Llc Engineered t cells
US11738052B2 (en) 2019-06-21 2023-08-29 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
WO2023178333A1 (en) 2022-03-18 2023-09-21 WUGEN, Inc. Improved chimeric receptor constructs for nk cells
WO2023183853A1 (en) 2022-03-22 2023-09-28 WUGEN, Inc. Hybrid promoters, vectors containing same and methods of use
WO2023201221A1 (en) * 2022-04-11 2023-10-19 Duke University Recombinant tim-4 protein, chimeric antigen receptor (car) t cell delivery system and methods of making and using same
EP4326859A2 (en) * 2021-04-23 2024-02-28 SVAR Life Science AB Novel luciferases with improved properties
WO2024112866A1 (en) * 2022-11-22 2024-05-30 Expression Therapeutics, Llc Engineered t cells
US12024545B2 (en) 2020-06-01 2024-07-02 HCW Biologics, Inc. Methods of treating aging-related disorders
WO2024151784A1 (en) * 2023-01-10 2024-07-18 Expression Therapeutics, Llc Engineered t cells
US12115191B2 (en) 2020-02-11 2024-10-15 Immunitybio, Inc. Methods of treating age-related and inflammatory diseases
US12187763B2 (en) 2020-02-11 2025-01-07 Immunitybio, Inc. Chromatography resin and uses thereof
US12497462B2 (en) 2020-04-29 2025-12-16 Immunitybio, Inc. Anti-CD26 proteins and uses thereof
US12594323B2 (en) 2022-04-13 2026-04-07 Immunitybio, Inc. Methods of reducing neuroinflammation

Families Citing this family (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111315395A (zh) 2017-09-06 2020-06-19 耶鲁大学 白细胞介素-18变体和使用方法
CN114569708B (zh) * 2020-12-02 2023-07-04 四川大学华西医院 Nkg2d car-免疫细胞在抗衰老中应用
CN117222414A (zh) 2021-03-01 2023-12-12 脱落性治疗公司 用于激活恒定自然杀伤t-细胞的化合物和用于消除炎性衰老细胞的方法
US12180492B2 (en) * 2021-06-09 2024-12-31 Immunitybio, Inc. Methods and systems for producing a protein of interest in a plant
CN115477705B (zh) * 2021-06-16 2024-02-23 四川大学华西医院 一种基于颗粒酶b构建的嵌合抗原受体免疫细胞制备及其应用
WO2023006082A1 (zh) * 2021-07-30 2023-02-02 启愈生物技术(上海)有限公司 抗原靶向、抗cd16a和免疫效应细胞激活三功能融合蛋白及其应用
CN118632710A (zh) * 2021-11-08 2024-09-10 阿尔伯特爱因斯坦医学院 经由kir2dl5改变免疫细胞活性的方法、组合物和试剂盒
WO2023090901A1 (ko) * 2021-11-18 2023-05-25 의료법인 성광의료재단 기계 학습을 이용한 세포 노화의 마커를 선별하는 방법, 세포 노화 바이오 마커, 및 이를 이용한 세놀리틱 제제를 스크리닝 하는 방법
CN114262382B (zh) * 2021-12-20 2023-09-19 上海恩凯细胞技术有限公司 双特异性抗体及其应用
CN114349869B (zh) * 2021-12-20 2023-09-26 上海恩凯细胞技术有限公司 一种双特异性的nk细胞激动剂及制备方法和应用
CN116271008A (zh) * 2022-12-30 2023-06-23 广东天普生化医药股份有限公司 含有安柯瑞和卡瑞利珠单抗的药物组合物及其应用
AU2024298429A1 (en) * 2023-07-21 2026-01-29 Gaia Biomedicine Inc. Method for producing cell population
WO2026043906A1 (en) * 2024-08-19 2026-02-26 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
US20260049118A1 (en) * 2024-08-19 2026-02-19 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof

Citations (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995015341A1 (en) 1993-12-03 1995-06-08 Cancer Research Campaign Technology Limited Antibody against carcinoembryonic antigen (cea)
US6117980A (en) 1997-02-21 2000-09-12 Genentech, Inc. Humanized anti-IL-8 monoclonal antibodies
WO2001083755A2 (en) 2000-04-28 2001-11-08 La Jolla Institute For Allergy And Immunology Human anti-cd40 antibodies and methods of making and using same
WO2003104425A2 (en) 2002-06-07 2003-12-18 The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services Novel stable anti-cd22 antibodies
WO2004076488A1 (en) 2003-02-27 2004-09-10 Theravision Gmbh A molecule which binds cd80 and cd86
US20050014224A1 (en) * 2003-05-23 2005-01-20 Mary Collins GITR ligand and GITR ligand-related molecules and antibodies and uses thereof
US7452537B2 (en) 2005-04-26 2008-11-18 Agouron Pharmaceuticals, Inc. P-cadherin antibodies
US7482436B2 (en) 2002-08-30 2009-01-27 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute Human antihuman interleukin-6 antibody and fragment of antibody
US7488802B2 (en) 2002-12-23 2009-02-10 Wyeth Antibodies against PD-1
US20090148942A1 (en) 2005-04-19 2009-06-11 Mcdonagh Charlotte Humanized anti-cd70 binding agents and uses thereof
US7723482B2 (en) 2000-12-26 2010-05-25 Institut National De La Sante Et De La Recherche Medicale (Inserm) Anti-CD28 antibody
US20120171197A1 (en) 2007-12-21 2012-07-05 Medimmune Limited Binding members for interleukin-4 receptor alpha (IL-4Ra) - 173
WO2012120125A1 (en) 2011-03-09 2012-09-13 Antitope Ltd Humanised anti ctla-4 antibodies
WO2012170470A1 (en) 2011-06-06 2012-12-13 Board Of Regents Of The University Of Nebraska Compositions and methods for detection and treatment of cancer
WO2012175692A1 (en) 2011-06-22 2012-12-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-axl antibodies and uses thereof
WO2013068946A2 (en) 2011-11-11 2013-05-16 Rinat Neuroscience Corp. Antibodies specific for trop-2 and their uses
US8552156B2 (en) 2010-06-11 2013-10-08 Kyowa Hakko Kirin Co., Ltd Anti-TIM-3 antibody
US20130274446A1 (en) 2010-08-12 2013-10-17 Tohoku University Fragment of humanized anti-egfr antibody substituted-lysine variable fragment and use thereof
WO2014007513A1 (en) 2012-07-02 2014-01-09 Hanwha Chemical Corporation Novel monoclonal antibody binding specifically to dll4 and use thereof
WO2014026054A2 (en) 2012-08-10 2014-02-13 University Of Southern California CD20 scFv-ELPs METHODS AND THERAPEUTICS
US8741604B2 (en) 2008-11-07 2014-06-03 Medimmune Limited Nucleic acid molecule encoding a specific IL-1R1 antibody
US8753640B2 (en) 2011-05-31 2014-06-17 University Of Washington Through Its Center For Commercialization MIC-binding antibodies and methods of use thereof
US8759494B2 (en) 2009-09-25 2014-06-24 Gemoab Monoclonals Gmbh Anti-CD33 antibodies and use thereof for immunotargeting in treating CD33-associated illnesses
WO2014095808A1 (en) 2012-12-17 2014-06-26 Delenex Therapeutics Ag Antibodies against il-1 beta
WO2014130635A1 (en) 2013-02-20 2014-08-28 Novartis Ag Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
US20140242077A1 (en) * 2013-01-23 2014-08-28 Abbvie, Inc. Methods and compositions for modulating an immune response
WO2014159531A1 (en) 2013-03-14 2014-10-02 The Board Of Regents Of The University Of Texas System Monoclonal antibodies targeting epcam for detection of prostate cancer lymph node metastases
US9035026B2 (en) 2005-05-26 2015-05-19 Affimed Gmbh Anti-CD16 binding molecules
US9085623B2 (en) 2010-02-11 2015-07-21 Alexion Pharmaceuticals, Inc. Therapeutic methods using anti-CD200 antibodies
US9090684B2 (en) 2008-06-25 2015-07-28 Esbatech, An Alcon Biomedical Research Unit Llc Stable and soluble antibodies inhibiting VEGF
US20150259429A1 (en) 2012-08-28 2015-09-17 Institut Curie Cluster of differentiation 36 (cd36) as a therapeutic target for hiv infection
US9226962B2 (en) 2002-09-10 2016-01-05 Affimed Gmbh Human CD3-specific antibody with immunosuppressive properties
US9238084B2 (en) 2003-06-16 2016-01-19 Immunomedics, Inc. Anti-mucin antibodies for early detection and treatment of pancreatic cancer
US9273136B2 (en) 2008-08-04 2016-03-01 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Fully human anti-human NKG2D monoclonal antibodies
US9371395B2 (en) 2011-04-25 2016-06-21 Daiichi Sankyo Company, Limited Anti B7-H3 antibody
WO2016106221A1 (en) 2014-12-22 2016-06-30 The Rockefeller University Anti-mertk agonistic antibodies and uses thereof
US9441034B2 (en) 2008-03-27 2016-09-13 Zymogenetics, Inc. Compositions and methods for inhibiting PDGFRβ and VEGF-A
WO2016154585A1 (en) 2015-03-26 2016-09-29 Charles Sentman Anti-mica antigen binding fragments, fusion molecules, cells which express and methods of using
WO2016166348A1 (en) 2015-04-17 2016-10-20 Elsalys Biotech Anti-tyro3 antibodies and uses thereof
US20160340413A1 (en) 2012-08-08 2016-11-24 Roche Glycart Ag Interleukin-10 fusion proteins and uses thereof
US9505843B2 (en) 2014-01-29 2016-11-29 Samsung Electronics Co., Ltd. Anti-Her3 scFV fragment and bispecific anti-c-Met/anti-Her3 antibodies comprising the same
US20160367664A1 (en) 2015-08-06 2016-12-22 Agency For Science, Technology And Research IL2Rbeta/Common Gamma Chain Antibodies
US20170051063A1 (en) 2011-04-19 2017-02-23 Merrimack Pharmaceuticals, Inc. Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies
US9617345B2 (en) 2012-11-20 2017-04-11 Sanofi Anti-CEACAM5 antibodies and uses thereof
WO2017083612A1 (en) 2015-11-13 2017-05-18 Dana-Farber Cancer Institute, Inc. An nkg2d-ig fusion protein for cancer immunotherapy
US9701758B2 (en) 2013-05-24 2017-07-11 Board Of Regents, The University Of Texas System Anti-CD19 scFv (FMC63) polypeptide
US20170198042A1 (en) 2014-08-19 2017-07-13 Merck Sharp & Dohme Corp. Anti-tigit antibodies
WO2017149538A1 (en) 2016-03-01 2017-09-08 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Antibodies specific to human poliovirus receptor (pvr)
WO2017189526A1 (en) 2016-04-25 2017-11-02 Musc Foundation For Research Development Activated cd26-high immune cells and cd26-negative immune cells and uses thereof
US20180200366A1 (en) * 2016-10-21 2018-07-19 Altor Bioscience Corporation Multimeric il-15-based molecules

Family Cites Families (53)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6749853B1 (en) 1992-03-05 2004-06-15 Board Of Regents, The University Of Texas System Combined methods and compositions for coagulation and tumor treatment
AU702250B2 (en) 1994-07-11 1999-02-18 Board Of Regents, The University Of Texas System Methods and compositions for the specific coagulation of vasculature
US20060235209A9 (en) 1997-03-10 2006-10-19 Jin-An Jiao Use of anti-tissue factor antibodies for treating thromboses
US20030109680A1 (en) 2001-11-21 2003-06-12 Sunol Molecular Corporation Antibodies for inhibiting blood coagulation and methods of use thereof
JP2001206899A (ja) 1999-11-18 2001-07-31 Japan Tobacco Inc TGF−βII型受容体に対するヒトモノクローナル抗体及びその医薬用途
AU2270101A (en) 1999-12-20 2001-07-03 Merck & Co., Inc. Pharmaceutical kit
PT1355919E (pt) 2000-12-12 2011-03-02 Medimmune Llc Moléculas com semivida longa, composições que as contêm e suas utilizações
US20040204481A1 (en) * 2001-04-12 2004-10-14 Pnina Fishman Activation of natural killer cells by adenosine A3 receptor agonists
TWI338009B (en) 2001-10-29 2011-03-01 Genentech Inc Antibodies for inhibiting blood coagulation and methods of use thereof
US9321832B2 (en) 2002-06-28 2016-04-26 Domantis Limited Ligand
KR20060015482A (ko) 2003-03-21 2006-02-17 와이어쓰 인터루킨-21/인터루킨-21 수용체의 작용제를 이용한면역장애의 치료
JP2005124568A (ja) 2003-10-01 2005-05-19 Junichi Masuyama 細胞活性化方法及びこれを用いる細胞製造方法並びに医薬組成物
NZ549040A (en) 2004-02-17 2009-07-31 Schering Corp Use for interleukin-33 (IL33) and the IL-33 receptor complex
ES2375481T3 (es) 2004-03-30 2012-03-01 Yissum Research Development Company Of The Hebrew University Of Jerusalem Anticuerpos biespecíficos para elegir como diana células que participan en reacciones de tipo alérgico, composiciones y usos de los mismos.
US7393833B2 (en) 2005-03-09 2008-07-01 The Board Of Regents Of The University Of Oklahoma Chimeric proteins with phosphatidylserine binding domains
AU2006224313B2 (en) 2005-03-17 2011-08-11 Ucl Biomedica Plc Method for actvating Natural Killer cells by tumor cell preparation in vitro
ATE459648T1 (de) 2005-05-11 2010-03-15 Philogen Spa Fusionsprotein von antikörper l19 gegen fibronectin ed-b und interleukin 12
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
EP1777294A1 (en) 2005-10-20 2007-04-25 Institut National De La Sante Et De La Recherche Medicale (Inserm) IL-15Ralpha sushi domain as a selective and potent enhancer of IL-15 action through IL-15Rbeta/gamma, and hyperagonist (IL15Ralpha sushi -IL15) fusion proteins
US20100310504A1 (en) * 2007-09-26 2010-12-09 Lowe Scott W Methods for treating fibrosis by modulating cellular senescence
NZ603698A (en) 2008-07-08 2014-03-28 Abbvie Inc Prostaglandin e2 dual variable domain immunoglobulins and uses thereof
AU2009333580B2 (en) 2008-12-09 2016-07-07 Genentech, Inc. Anti-PD-L1 antibodies and their use to enhance T-cell function
KR20120060877A (ko) 2009-09-01 2012-06-12 아보트 러보러터리즈 이원 가변 도메인 면역글로불린 및 이의 용도
AU2010306677B2 (en) 2009-10-15 2013-05-23 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
UY32979A (es) 2009-10-28 2011-02-28 Abbott Lab Inmunoglobulinas con dominio variable dual y usos de las mismas
WO2011127324A2 (en) 2010-04-08 2011-10-13 JN Biosciences, LLC Antibodies to cd122
US8735546B2 (en) 2010-08-03 2014-05-27 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
CN107880136B (zh) 2010-09-21 2021-11-12 阿尔托生物科学有限公司 多聚体il-15可溶性融合分子与其制造与使用方法
CN102153653B (zh) 2010-12-30 2012-08-15 厦门大学 肿瘤血管靶向多肽与组织因子的融合蛋白及其制备方法
SG10201603962TA (en) 2011-05-25 2016-07-28 Innate Pharma Sa Anti-kir antibodies for the treatment of inflammatory disorders
EP2537933A1 (en) 2011-06-24 2012-12-26 Institut National de la Santé et de la Recherche Médicale (INSERM) An IL-15 and IL-15Ralpha sushi domain based immunocytokines
JP2015030666A (ja) 2013-07-31 2015-02-16 学校法人順天堂 抗ヒトcd26モノクローナル抗体又はその抗原結合性断片
CN103709251B (zh) 2013-12-19 2016-04-13 江苏众红生物工程创药研究院有限公司 全人源抗cd26抗体及其应用
EP3099717B1 (en) * 2014-01-31 2019-03-27 Novartis AG Antibody molecules to tim-3 and uses thereof
FR3021970B1 (fr) 2014-06-06 2018-01-26 Universite Sciences Technologies Lille Anticorps dirige contre la galectine 9 et inhibiteur de l'activite suppressive des lymphocytes t regulateurs
MY193723A (en) 2014-08-29 2022-10-27 Hoffmann La Roche Combination therapy of tumor-targeted il-2 variant immunocytokines and antibodies against human pd-l1
KR101778439B1 (ko) 2015-04-27 2017-09-14 울산대학교 산학협력단 자연살해세포 활성화제를 유효성분으로 함유하는 면역증강 및 항암활성증진용 조성물
KR20180061226A (ko) 2015-09-11 2018-06-07 와이즈에이씨가부시키가이샤 항cd26 항체와 다른 항암제를 조합한 암 치료용 조성물
CA2994858C (en) 2015-09-25 2024-01-23 Genentech, Inc. Anti-tigit antibodies and methods of use
ES3014658T3 (en) 2016-10-05 2025-04-23 Univ Central Florida Res Found Inc Methods and compositions related to nk cell and anti-pdl1 cancer therapies
MX2019007981A (es) 2017-01-03 2019-10-15 Bioatla Llc Terapeutica de proteinas para el tratamiento de celulas senescentes.
CN110461357A (zh) 2017-02-28 2019-11-15 阿菲姆德股份有限公司 抗cd16a抗体与细胞因子的组合
CN117986384A (zh) 2017-03-06 2024-05-07 艾尔特生物科技公司 与il-12和il-18的基于il-15的融合物
EP3601538A4 (en) 2017-03-27 2021-03-10 Nantcell, Inc. ANK AND IL-12 COMPOSITIONS AND METHODS
EP3676289B1 (en) 2017-08-28 2026-03-04 Altor BioScience, LLC Il-15-based fusions to il-7 and il-21
US11401324B2 (en) 2018-08-30 2022-08-02 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
CA3109361A1 (en) 2018-08-30 2020-03-05 HCW Biologics, Inc. Single-chain and multi-chain chimeric polypeptides and uses thereof
US11518792B2 (en) 2018-08-30 2022-12-06 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
CN120924491A (zh) 2019-06-21 2025-11-11 免疫生物公司 多链嵌合多肽和其用途
WO2021163299A1 (en) 2020-02-11 2021-08-19 HCW Biologics, Inc. Chromatography resin and uses thereof
CA3169243A1 (en) 2020-02-11 2021-08-19 HCW Biologics, Inc. Methods of activating regulatory t cells
AU2021220870A1 (en) 2020-02-11 2022-08-04 Immunitybio, Inc. Methods of treating age-related and inflammatory diseases
US12024545B2 (en) 2020-06-01 2024-07-02 HCW Biologics, Inc. Methods of treating aging-related disorders

Patent Citations (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995015341A1 (en) 1993-12-03 1995-06-08 Cancer Research Campaign Technology Limited Antibody against carcinoembryonic antigen (cea)
US6117980A (en) 1997-02-21 2000-09-12 Genentech, Inc. Humanized anti-IL-8 monoclonal antibodies
WO2001083755A2 (en) 2000-04-28 2001-11-08 La Jolla Institute For Allergy And Immunology Human anti-cd40 antibodies and methods of making and using same
US7723482B2 (en) 2000-12-26 2010-05-25 Institut National De La Sante Et De La Recherche Medicale (Inserm) Anti-CD28 antibody
WO2003104425A2 (en) 2002-06-07 2003-12-18 The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services Novel stable anti-cd22 antibodies
US7482436B2 (en) 2002-08-30 2009-01-27 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute Human antihuman interleukin-6 antibody and fragment of antibody
US9226962B2 (en) 2002-09-10 2016-01-05 Affimed Gmbh Human CD3-specific antibody with immunosuppressive properties
US7488802B2 (en) 2002-12-23 2009-02-10 Wyeth Antibodies against PD-1
WO2004076488A1 (en) 2003-02-27 2004-09-10 Theravision Gmbh A molecule which binds cd80 and cd86
US20050014224A1 (en) * 2003-05-23 2005-01-20 Mary Collins GITR ligand and GITR ligand-related molecules and antibodies and uses thereof
US9238084B2 (en) 2003-06-16 2016-01-19 Immunomedics, Inc. Anti-mucin antibodies for early detection and treatment of pancreatic cancer
US20090148942A1 (en) 2005-04-19 2009-06-11 Mcdonagh Charlotte Humanized anti-cd70 binding agents and uses thereof
US7452537B2 (en) 2005-04-26 2008-11-18 Agouron Pharmaceuticals, Inc. P-cadherin antibodies
US9035026B2 (en) 2005-05-26 2015-05-19 Affimed Gmbh Anti-CD16 binding molecules
US20120171197A1 (en) 2007-12-21 2012-07-05 Medimmune Limited Binding members for interleukin-4 receptor alpha (IL-4Ra) - 173
US9441034B2 (en) 2008-03-27 2016-09-13 Zymogenetics, Inc. Compositions and methods for inhibiting PDGFRβ and VEGF-A
US9090684B2 (en) 2008-06-25 2015-07-28 Esbatech, An Alcon Biomedical Research Unit Llc Stable and soluble antibodies inhibiting VEGF
US9273136B2 (en) 2008-08-04 2016-03-01 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Fully human anti-human NKG2D monoclonal antibodies
US8741604B2 (en) 2008-11-07 2014-06-03 Medimmune Limited Nucleic acid molecule encoding a specific IL-1R1 antibody
US8759494B2 (en) 2009-09-25 2014-06-24 Gemoab Monoclonals Gmbh Anti-CD33 antibodies and use thereof for immunotargeting in treating CD33-associated illnesses
US9085623B2 (en) 2010-02-11 2015-07-21 Alexion Pharmaceuticals, Inc. Therapeutic methods using anti-CD200 antibodies
US8552156B2 (en) 2010-06-11 2013-10-08 Kyowa Hakko Kirin Co., Ltd Anti-TIM-3 antibody
US20130274446A1 (en) 2010-08-12 2013-10-17 Tohoku University Fragment of humanized anti-egfr antibody substituted-lysine variable fragment and use thereof
WO2012120125A1 (en) 2011-03-09 2012-09-13 Antitope Ltd Humanised anti ctla-4 antibodies
US20170051063A1 (en) 2011-04-19 2017-02-23 Merrimack Pharmaceuticals, Inc. Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies
US9371395B2 (en) 2011-04-25 2016-06-21 Daiichi Sankyo Company, Limited Anti B7-H3 antibody
US8753640B2 (en) 2011-05-31 2014-06-17 University Of Washington Through Its Center For Commercialization MIC-binding antibodies and methods of use thereof
WO2012170470A1 (en) 2011-06-06 2012-12-13 Board Of Regents Of The University Of Nebraska Compositions and methods for detection and treatment of cancer
WO2012175692A1 (en) 2011-06-22 2012-12-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-axl antibodies and uses thereof
WO2013068946A2 (en) 2011-11-11 2013-05-16 Rinat Neuroscience Corp. Antibodies specific for trop-2 and their uses
WO2014007513A1 (en) 2012-07-02 2014-01-09 Hanwha Chemical Corporation Novel monoclonal antibody binding specifically to dll4 and use thereof
US20160340413A1 (en) 2012-08-08 2016-11-24 Roche Glycart Ag Interleukin-10 fusion proteins and uses thereof
WO2014026054A2 (en) 2012-08-10 2014-02-13 University Of Southern California CD20 scFv-ELPs METHODS AND THERAPEUTICS
US20150259429A1 (en) 2012-08-28 2015-09-17 Institut Curie Cluster of differentiation 36 (cd36) as a therapeutic target for hiv infection
US9617345B2 (en) 2012-11-20 2017-04-11 Sanofi Anti-CEACAM5 antibodies and uses thereof
WO2014095808A1 (en) 2012-12-17 2014-06-26 Delenex Therapeutics Ag Antibodies against il-1 beta
US20140242077A1 (en) * 2013-01-23 2014-08-28 Abbvie, Inc. Methods and compositions for modulating an immune response
WO2014130635A1 (en) 2013-02-20 2014-08-28 Novartis Ag Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
WO2014159531A1 (en) 2013-03-14 2014-10-02 The Board Of Regents Of The University Of Texas System Monoclonal antibodies targeting epcam for detection of prostate cancer lymph node metastases
US9701758B2 (en) 2013-05-24 2017-07-11 Board Of Regents, The University Of Texas System Anti-CD19 scFv (FMC63) polypeptide
US9505843B2 (en) 2014-01-29 2016-11-29 Samsung Electronics Co., Ltd. Anti-Her3 scFV fragment and bispecific anti-c-Met/anti-Her3 antibodies comprising the same
US20170198042A1 (en) 2014-08-19 2017-07-13 Merck Sharp & Dohme Corp. Anti-tigit antibodies
WO2016106221A1 (en) 2014-12-22 2016-06-30 The Rockefeller University Anti-mertk agonistic antibodies and uses thereof
WO2016154585A1 (en) 2015-03-26 2016-09-29 Charles Sentman Anti-mica antigen binding fragments, fusion molecules, cells which express and methods of using
WO2016166348A1 (en) 2015-04-17 2016-10-20 Elsalys Biotech Anti-tyro3 antibodies and uses thereof
US20160367664A1 (en) 2015-08-06 2016-12-22 Agency For Science, Technology And Research IL2Rbeta/Common Gamma Chain Antibodies
WO2017083612A1 (en) 2015-11-13 2017-05-18 Dana-Farber Cancer Institute, Inc. An nkg2d-ig fusion protein for cancer immunotherapy
WO2017149538A1 (en) 2016-03-01 2017-09-08 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Antibodies specific to human poliovirus receptor (pvr)
WO2017189526A1 (en) 2016-04-25 2017-11-02 Musc Foundation For Research Development Activated cd26-high immune cells and cd26-negative immune cells and uses thereof
US20180200366A1 (en) * 2016-10-21 2018-07-19 Altor Bioscience Corporation Multimeric il-15-based molecules

Non-Patent Citations (69)

* Cited by examiner, † Cited by third party
Title
AKBARI ET AL., PROTEIN EXPR. PURIF., vol. 127, 2016, pages 8 - 15
BAI LIU ET AL: "A Novel Fusion of ALT-803 (Interleukin (IL)-15 Superagonist) with an Antibody Demonstrates Antigen-specific Antitumor Responses", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 291, no. 46, 20 September 2016 (2016-09-20), pages 23869 - 23881, XP055566201, ISSN: 0021-9258, DOI: 10.1074/jbc.M116.733600 *
BISHWAJIT ET AL., CELLULAR IMMUNOL., vol. 170, no. 1, 1996, pages 25 - 33
BRENNAN ET AL., PNAS, vol. 114, no. 31, 1 August 2017 (2017-08-01), pages 8348 - 8353
CAO ET AL., BIOTECHNOL. LETT., vol. 37, no. 7, 2015, pages 1347 - 1354
CHALAN ET AL., PLOS ONE, vol. 10, no. 7, pages e0132436
CHATTOPADYHAY ET AL., J. IMMUNOL., vol. 177, no. 6, 15 September 2006 (2006-09-15), pages 3920 - 3929
CLAYTON ET AL., J. VIROL., vol. 89, no. 7, April 2015 (2015-04-01), pages 3723 - 36
COSMAN ET AL., IMMUNITY, vol. 14, no. 2, 2001, pages 123 - 133
COSTA ET AL., FRONT. IMMUNOL., vol. 9, 29 May 2018 (2018-05-29)
CROMIE ET AL., CURR. TOP. MED. CHEM., vol. 15, 2016, pages 2543 - 2557
DE GENST ET AL., DEV. COMP. IMMUNOL., vol. 30, 2006, pages 187 - 198
DE MEYER ET AL., TRENDS BIOTECHNOL., vol. 32, 2014, pages 263 - 270
DEYEV ET AL., NAT BIOTECHNOL., 2003, pages 1486 - 1492
DREES ET AL., PROTEIN EXPRESS. PURIF., vol. 94, 2014, pages 60 - 66
EDWARDRAJA ET AL., BIOTECHNOL. BIOENG., vol. 106, no. 3, 2010, pages 367 - 375
ELGUETA ET AL., IMMUNOLOGICAL REVIEWS, vol. 229, no. 1
GARBER, NATURE REVIEWS DRUG DISCOVERY, vol. 13, 2014, pages 799 - 801
GEJIMA ET AL., HUMAN ANTIBODIES, vol. 11, no. 4, 2002, pages 121 - 129
GENG ET AL., IMMUNOL. RES., vol. 62, no. 3, 2015, pages 377 - 385
GIBBS ET AL., BIOCHEMISTRY, vol. 33, no. 47, 1994, pages 14003 - 14010
GUO YIN ET AL: "Immunobiology of the IL-15/IL-15R[alpha] complex as an antitumor and antiviral agent", CYTOKINE AND GROWTH FACTOR REVIEWS, vol. 38, 1 September 2017 (2017-09-01), pages 10 - 21, XP085253997, ISSN: 1359-6101, DOI: 10.1016/J.CYTOGFR.2017.08.002 *
HAILE ET AL., J IMMUNOL., vol. 191, no. 5, 1 September 2013 (2013-09-01), pages 2829 - 36
HEBBAR ET AL., CLIN. EXP. IMMUNOL., vol. 136, 2004, pages 388 - 392
HENG ET AL., PLACENTA, vol. 57, 2017, pages 320
HOMACH ET AL., SCAND. J. IMMUNOL., vol. 48, no. 5, 1998, pages 497 - 501
HUANG ET AL., JBIOL CHEM, vol. 271, no. 36, 1996, pages 21752 - 21757
JEANNIN ET AL., IMMUNITY, vol. 13, no. 3, September 2000 (2000-09-01), pages 303 - 12
KIJANKA ET AL., NANOMEDICINE, vol. 10, 2015, pages 161 - 174
KIRCHHOFER ET AL., BIOCHEMISTRY, vol. 39, no. 25, 2000, pages 7380 - 7387
KLEIN ET AL., PROTEIN ENGINEERING, DESIGN & SELECTION, vol. 27, no. 10, 2014, pages 325 - 330
KONDO ET AL., HUM. IMMUNOL., vol. 68, no. 7, July 2007 (2007-07-01), pages 563 - 71
KOVALEVA ET AL., EXPERT. OPIN. BIOL. THER., vol. 14, 2014, pages 1527 - 1539
KRAH ET AL., IMMUNOPHARMACOL. IMMUNOTOXICOL., vol. 38, 2016, pages 21 - 28
MAEDA ET AL., J. IMMUNOL., vol. 201, no. 1, 1 July 2018 (2018-07-01), pages 202 - 214
MANDELBOIM ET AL., NATURE, vol. 409, 2001, pages 1055 - 1060
MENSHAWY ET AL., COMPARATIVE CLINICAL PATHOLOGY, vol. 27, no. 3, pages 721 - 727
MILLER ET AL., J. NEUROSURG., vol. 113, no. 2, August 2010 (2010-08-01), pages 280 - 5
MUJIC-DELIC ET AL., TRENDS PHARMACOL. SCI., vol. 35, 2014, pages 247 - 255
MUYLDERMANS ET AL., TRENDS BIOCHEM. SCI., vol. 26, 2001, pages 230 - 235
MUYLDERMANS, ANN. REV. BIOCHEM., vol. 82, 2013, pages 775 - 797
MUYLDERMANS, J. BIOTECHNOL., vol. 74, 2001, pages 277 - 302
PARKER ET AL., EXPR. PURIF., vol. 89, no. 2, 2013, pages 136 - 145
PISTILLO ET AL., EXP. CLIN. IMMUNOGENET., vol. 14, no. 2, 1997, pages 123 - 130
PRIYANKA ET AL., PROTEIN SCI., vol. 22, no. 2, February 2013 (2013-02-01), pages 153 - 167
QIYUE HU ET AL: "Discovery of a novel IL-15 based protein with improved developability and efficacy for cancer immunotherapy", SCIENTIFIC REPORTS, vol. 8, no. 1, 16 May 2018 (2018-05-16), XP055491167, DOI: 10.1038/s41598-018-25987-4 *
RAHBARIZADEH ET AL., IMMUNOL. INVEST., vol. 40, 2011, pages 299 - 338
RANGANATHAN, PAC. SYMP BIOCOMPUT., 2000, pages 155 - 67
RHEIN ET AL., J. VIROL., vol. 90, no. 13, 10 June 2016 (2016-06-10), pages 6097 - 6111
ROSSI ET AL., TRENDS PHARMACOL SCI., vol. 33, 2012, pages 474 - 481
ROSSI, PROC NATLACAD SCI USA, vol. 103, 2006, pages 6841 - 6846
RUF ET AL., JBIOL CHEM, vol. 267, no. 31, 1992, pages 22206 - 22210
SCHULLEK ET AL., JBIOL CHEM, vol. 269, no. 30, 1994, pages 19399 - 19403
SHARKEY ET AL., CANCER RES., vol. 68, 2008, pages 5282 - 5290
SMITH ET AL., MOL. THER., vol. 26, no. 6, 2018, pages 1447 - 1456
SMITH ET AL.: "Antigen Nature and Complexity Influence Human Antibody Light Chain Usage and Specificity", VACCINE, vol. 34, no. 25, 2016, pages 2813 - 2820, XP029549736, doi:10.1016/j.vaccine.2016.04.040
STONE ET AL., J. VIROL., vol. 80, no. 4, February 2006 (2006-02-01), pages 1762 - 72
TAHARA-HANAOKA ET AL., INT. IMMUNOL., vol. 16, no. 4, 2004, pages 533 - 538
VADARSSON ET AL.: "IgG Subclasses and Allotypes: From Structure to Effector Functions", FRONT IMMUNOL., 2014, pages 5
VAN AUDENHOVE ET AL., EBIOMEDICINE, vol. 8, 2016, pages 40 - 48
VAN BOCKSTAELE ET AL., CURR. OPIN. INVESTIG. DRUGS, vol. 10, 2009, pages 1212 - 1224
VAN DEN BERGH JOHAN MJ ET AL: "IL-15 receptor alpha as the magic wand to boost the success of IL-15 antitumor therapies: The upswing of IL-15 transpresentation", PHARMACOLOGY AND THERAPEUTICS, ELSEVIER, GB, vol. 170, 21 October 2016 (2016-10-21), pages 73 - 79, XP029895045, ISSN: 0163-7258, DOI: 10.1016/J.PHARMTHERA.2016.10.012 *
VINCKE ET AL., METHODS MOL. BIOL., vol. 911, 2012, pages 15 - 26
WANG ET AL., CANCER IMMUNOL IMMUNOTHER., vol. 61, no. 4, April 2012 (2012-04-01), pages 489 - 95
WASHBURN ET AL., PLOS ONE, vol. 6, no. 3, 2011, pages el8439
WEBER ET AL., NATURE, vol. 356, no. 6372, 1992, pages 793 - 796
WESOLOWSKI ET AL., MED. MICROBIOL. IMMUNOL., vol. 198, 2009, pages 157 - 174
WITKOWSABORAWSKA, EUR CYTOKINE NETW., vol. 15, no. 2, April 2004 (2004-04-01), pages 91 - 8
YUNG ET AL., AM. J. RESP. CRIT. CARE MED., vol. 194, no. 9, 2016, pages 1140 - 1151

Cited By (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11471490B2 (en) 2017-07-03 2022-10-18 Torque Therapeutics, Inc. T cells surface-loaded with immunostimulatory fusion molecules and uses thereof
US12269854B2 (en) 2018-08-30 2025-04-08 Immunitybio, Inc. Multi-chain chimeric polypeptides and uses thereof
US11987619B2 (en) 2018-08-30 2024-05-21 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
US12516112B2 (en) 2018-08-30 2026-01-06 Immunitybio, Inc. Single-chain chimeric polypeptides and uses thereof
US11401324B2 (en) 2018-08-30 2022-08-02 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
US12509494B2 (en) 2018-08-30 2025-12-30 Immunitybio, Inc. Multi-chain chimeric polypeptides and uses thereof
US12398186B2 (en) 2018-08-30 2025-08-26 Immunitybio, Inc. Multi-chain chimeric polypeptides and uses thereof
US12018071B2 (en) 2018-08-30 2024-06-25 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
US11518792B2 (en) 2018-08-30 2022-12-06 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
US11884712B2 (en) 2018-08-30 2024-01-30 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
US11672826B2 (en) 2018-08-30 2023-06-13 HCW Biologics, Inc. Methods of treating aging-related disorders
US11738052B2 (en) 2019-06-21 2023-08-29 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
US12479899B2 (en) 2019-06-21 2025-11-25 Immunitybio, Inc. Multi-chain chimeric polypeptides and uses thereof
US12115191B2 (en) 2020-02-11 2024-10-15 Immunitybio, Inc. Methods of treating age-related and inflammatory diseases
US12398189B2 (en) 2020-02-11 2025-08-26 HCW Biologics, Inc. Methods of activating regulatory T cells
US12187763B2 (en) 2020-02-11 2025-01-07 Immunitybio, Inc. Chromatography resin and uses thereof
WO2021163298A1 (en) * 2020-02-11 2021-08-19 HCW Biologics, Inc. Methods of activating regulatory t cells
US12497462B2 (en) 2020-04-29 2025-12-16 Immunitybio, Inc. Anti-CD26 proteins and uses thereof
WO2021247604A1 (en) * 2020-06-01 2021-12-09 HCW Biologics, Inc. Methods of treating aging-related disorders
WO2021247003A1 (en) * 2020-06-01 2021-12-09 HCW Biologics, Inc. Methods of treating aging-related disorders
US12024545B2 (en) 2020-06-01 2024-07-02 HCW Biologics, Inc. Methods of treating aging-related disorders
US12258383B2 (en) 2020-10-20 2025-03-25 Cura Therapeutics Inc. Multi-functional and multi-valent interleukin-TGF-beta receptor fusion polypeptides
WO2022086988A1 (en) * 2020-10-20 2022-04-28 Cura Therapeutics, Inc. Multi-functional and multi-valent interleukin-tgf-beta receptor fusion polypeptides
US11407814B2 (en) 2020-10-20 2022-08-09 Cura Therapeutics, Inc. Multi-functional and multi-valent interleukin-TGF-beta receptor fusion polypeptides
US12329803B2 (en) 2021-02-17 2025-06-17 Cura Therapeutics Inc. Method of reducing or treating fibrosis by administering an interleukin-2/TGF-beta receptor fusion polypeptide
EP4294422A4 (en) * 2021-02-17 2025-04-02 Cura Therapeutics, Inc. ANTI-PATHOGEN INTERLEUKIN-TGF-BETA RECEPTOR FUSION POLYPEPTIDES
US11672844B2 (en) 2021-02-17 2023-06-13 Cura Therapeutics, Inc. Method of treating or ameliorating a pathogenic infection by administering an interleukin-2/TGF-β receptor fusion polypeptide
WO2022178033A1 (en) * 2021-02-17 2022-08-25 Cura Therapeutics, Inc. Anti-pathogen interleukin-tgf-beta receptor fusion polypeptides
EP4326859A2 (en) * 2021-04-23 2024-02-28 SVAR Life Science AB Novel luciferases with improved properties
WO2023133357A3 (en) * 2022-01-10 2023-08-10 Expression Therapeutics, Llc Engineered t cells
WO2023178333A1 (en) 2022-03-18 2023-09-21 WUGEN, Inc. Improved chimeric receptor constructs for nk cells
WO2023183853A1 (en) 2022-03-22 2023-09-28 WUGEN, Inc. Hybrid promoters, vectors containing same and methods of use
WO2023201221A1 (en) * 2022-04-11 2023-10-19 Duke University Recombinant tim-4 protein, chimeric antigen receptor (car) t cell delivery system and methods of making and using same
US12594323B2 (en) 2022-04-13 2026-04-07 Immunitybio, Inc. Methods of reducing neuroinflammation
WO2024112866A1 (en) * 2022-11-22 2024-05-30 Expression Therapeutics, Llc Engineered t cells
WO2024151784A1 (en) * 2023-01-10 2024-07-18 Expression Therapeutics, Llc Engineered t cells

Also Published As

Publication number Publication date
JP7773577B2 (ja) 2025-11-19
CN120267819A (zh) 2025-07-08
IL280919B2 (en) 2026-02-01
JP2021534835A (ja) 2021-12-16
AU2019328575A1 (en) 2021-02-25
AU2019328575B2 (en) 2024-07-11
CN120365435A (zh) 2025-07-25
JP2021535225A (ja) 2021-12-16
CA3109361A1 (en) 2020-03-05
EP4592314A3 (en) 2025-11-05
US11672826B2 (en) 2023-06-13
CA3109139A1 (en) 2020-03-05
EP4592314A2 (en) 2025-07-30
US20230398151A1 (en) 2023-12-14
AU2025210777A1 (en) 2025-08-21
JP2024096876A (ja) 2024-07-17
JP7449292B2 (ja) 2024-03-13
AU2019328567A1 (en) 2021-02-25
AU2024227260A1 (en) 2024-11-28
AU2024227260B2 (en) 2026-04-09
IL280920A (en) 2021-04-29
US20230372399A1 (en) 2023-11-23
JP2024063153A (ja) 2024-05-10
CN112888445A (zh) 2021-06-01
JP7745032B2 (ja) 2025-09-26
WO2020047462A3 (en) 2020-07-23
CN112888445B (zh) 2025-06-10
IL280919B1 (en) 2025-10-01
JP7474769B2 (ja) 2024-04-25
WO2020047462A2 (en) 2020-03-05
CN113015744B (zh) 2025-03-21
EP3843756A2 (en) 2021-07-07
AU2019328567B2 (en) 2025-07-10
EP3844182A1 (en) 2021-07-07
US20210060064A1 (en) 2021-03-04
IL280919A (en) 2021-04-29
US20210100840A1 (en) 2021-04-08
EP3844182B1 (en) 2025-05-14
US11730762B2 (en) 2023-08-22
CN113015744A (zh) 2021-06-22

Similar Documents

Publication Publication Date Title
US20230398151A1 (en) Methods for stimulating proliferation or differentiation of an immune cell with a multi-chain chimeric polypeptide
US12024545B2 (en) Methods of treating aging-related disorders
AU2021283199B2 (en) Methods of treating aging-related disorders
CA2919725A1 (en) An il-15 and il-15r.aplha. sushi domain based modulokines
CN114514244A (zh) T细胞活化抗体
WO2021247003A1 (en) Methods of treating aging-related disorders
AU2026202388A1 (en) Methods of treating aging-related disorders
CN117120072A (zh) 治疗老化相关病症的方法
HK40128378A (zh) 对δ样配体3(DLL3)具有特异性的抗体和嵌合抗原受体
HK40004449B (en) Il-15 and il-15ralpha sushi domain based modulokines
HK40048595A (en) Single-chain and multi-chain chimeric polypeptides and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19779635

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3109361

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019328575

Country of ref document: AU

Date of ref document: 20190830

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021536663

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019779635

Country of ref document: EP

Effective date: 20210330

WWG Wipo information: grant in national office

Ref document number: 201980069954.9

Country of ref document: CN

WWG Wipo information: grant in national office

Ref document number: 2019779635

Country of ref document: EP