WO2019241628A1 - General amyloid interaction motif (gaim) - Google Patents

General amyloid interaction motif (gaim) Download PDF

Info

Publication number
WO2019241628A1
WO2019241628A1 PCT/US2019/037179 US2019037179W WO2019241628A1 WO 2019241628 A1 WO2019241628 A1 WO 2019241628A1 US 2019037179 W US2019037179 W US 2019037179W WO 2019241628 A1 WO2019241628 A1 WO 2019241628A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
gaim
amyloid
polypeptide
disease
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/037179
Other languages
English (en)
French (fr)
Inventor
Rajaraman Krishnan
Eva ASP
Ming PROSCHITSKY
Richard Fisher
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Proclara Biosciences Inc
Original Assignee
Proclara Biosciences Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to ES19739769T priority Critical patent/ES2960493T3/es
Priority to EP23188404.0A priority patent/EP4389154A3/en
Priority to EP19739769.8A priority patent/EP3806884B1/en
Priority to JP2020569166A priority patent/JP7549536B2/ja
Priority to CA3102841A priority patent/CA3102841C/en
Priority to AU2019287623A priority patent/AU2019287623B2/en
Priority to MX2020013525A priority patent/MX2020013525A/es
Priority to SG11202012091WA priority patent/SG11202012091WA/en
Priority to PL19739769.8T priority patent/PL3806884T3/pl
Priority to CN201980049538.2A priority patent/CN112672755A/zh
Priority to US17/251,351 priority patent/US11692017B2/en
Priority to EA202190048A priority patent/EA202190048A1/ru
Application filed by Proclara Biosciences Inc filed Critical Proclara Biosciences Inc
Priority to BR112020025111-9A priority patent/BR112020025111A2/pt
Publication of WO2019241628A1 publication Critical patent/WO2019241628A1/en
Priority to IL279333A priority patent/IL279333B2/en
Anticipated expiration legal-status Critical
Priority to ZA2021/00071A priority patent/ZA202100071B/en
Priority to US18/320,697 priority patent/US12247055B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2795/00Bacteriophages
    • C12N2795/00011Details
    • C12N2795/14011Details ssDNA Bacteriophages
    • C12N2795/14111Inoviridae
    • C12N2795/14122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2795/00Bacteriophages
    • C12N2795/00011Details
    • C12N2795/14011Details ssDNA Bacteriophages
    • C12N2795/14111Inoviridae
    • C12N2795/14133Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory

Definitions

  • the invention relates to polypeptides comprising a variant of the general amyloid interaction motif (GAIM) of filamentous bacteriophage gene 3 protein (“g3p,” also known as“p3” or“pill”) such that the polypeptides are partially or fully deimmunized and demonstrate superior potency, superior structural stability, and increased binding specificity to amyloid proteins relative to the prior art.
  • GIM general amyloid interaction motif
  • Nucleic acid molecules and constructs encoding such polypeptides, host cells transformed with such nucleic acid molecules, and methods of making such polypeptides recombinantly are encompassed.
  • the invention relates to diagnostic and pharmaceutical compositions comprising the polypeptides disclosed herein, to the use of diagnostic compositions to detect amyloid aggregates and/or to diagnose a disease associated with misfolded and/or aggregated protein, and to the therapeutic and/or prophylactic use of pharmaceutical compositions to decrease amyloid load, prevent aggregation, disaggregate amyloid, or otherwise treat or prevent a disease associated with misfolded and/or aggregated amyloid protein, such as systemic and peripheral amyloid diseases, neurodegenerative diseases including neurodegenerative tauopathies, and transmissible spongiform encephalopathies (prion-associated diseases).
  • Polypeptides of the invention include fusion proteins and amyloid-binding portions thereof. [003] Bacteriophage g3p directly binds amyloid fibers, and
  • bacteriophage-mediated amyloid disaggregation (e.g., remodeling) is dependent upon this initial binding step. See, e.g., WO 2013/082114 A1 , hereby
  • GAM general amyloid interaction motif
  • compositions thereof that are capable of binding to amyloid protein and/or disaggregating amyloid proteins.
  • the g3p polypeptides disclosed in WO 2013/082114 A1 and WO 2014/055515 A1 are effective for the prevention or treatment of diseases associated with misfolded and/or aggregated amyloid proteins. Id.
  • these g3p polypeptides also comprise human T-cell epitopes that may elicit an unwanted immune response in patients.
  • Partially deimmunized g3p polypeptides were therefore developed, comprising mutations that remove up to four of the five T-cell epitopes present in native g3p. See WO 2014/193935 A1 , hereby incorporated by reference in its entirety.
  • g3p polypeptides that bind amyloid— and are useful for detection, diagnosis, prevention, or treatment of amyloid-related diseases or conditions— was limited by the presence of a potential N-glycosylation site.
  • improved g3p polypeptides, including partially deimmunized g3p polypeptides, were generated in which the potential N-glycosylation site was removed by one or more mutations. See WO 2016/090022 A8, hereby incorporated by reference in its entirety.
  • the open-stabilized polypeptides described herein demonstrate potent amyloid-binding and remodeling activities across a wide array of amyloids while maintaining protein stability and binding specificity.
  • the present invention relates to open-stabilized variants of GAIM (GAIM), GAIM-immunoglobulin (GAIM-lg) fusion proteins, or pharmaceutical compositions thereof, that are at least partially deimmunized and have superior amyloid-binding activity, amyloid-binding specificity, and amyloid remodeling activity.
  • these open-stabilized GAIM variants, GAIM-lg fusion proteins, or pharmaceutical compositions thereof are fully deimmunized without sacrificing potent and specific amyloid binding and without sacrificing structural stability.
  • the open-stabilized GAIM variants and GAIM-lg fusions described herein are capable of engaging and removing amyloids in brain and peripheral organs and constitute a novel set of polypeptides with superior ability to detect, diagnose, prevent, delay onset of and/or treat diseases associated with misfolded and/or aggregated amyloid protein.
  • Fig. 1 A is a graphical representation of the tertiary structure of the GAIM N1 and N2 domains (shown using PDB structure 2G3P). b-strands subjected to site-directed mutagenesis are shown in dark grey. Arrows indicate the location of polar residues in N1 and hydrophobic residues in N2.
  • Fig. 1 B is a graphical representation of a GAIM-lg fusion of the invention.
  • Fig. 1C is a graphical representation of a GAIM dimer.
  • Fig. 2 depicts results of hydrogen/deuterium (H/D) exchange studies showing the GAIM-interacting sequences in ⁇ Ab42.
  • Fig. 3A compares corresponding portions of the amino acid sequence of the N1 portion of g3p from fd phage (SEQ ID NO:1 ) and the corresponding N1 portion of g3p from IF1 phage (SEQ ID NO:2).
  • FIG. 3B is a graphical representation of the tertiary structure of the GAIM N1 and N2 domains (shown using PDB structure 2G3P).
  • the open box in Fig. 3B shows the location of SEQ ID NO:3 in fd g3p.
  • Fig. 3C is a graphical representation of three slow-folding loops (also referred to as“turns”) implicated in stabilization of the N2 domain.
  • T1 Turn 1 (FQNN; SEQ ID NO: 5);
  • T2 Turn 2 (RQGA; SEQ ID NO: 6);
  • T3 Turn 3 (QGTDPVK; SEQ ID NO: 7).
  • removing one or more of T1 , T2, or T3 by mutagenesis stabilizes the N2 domain.
  • Fig. 3D depicts changes in binding and stability based on select amino acid substitutions of T50.
  • Figs. 4A and 4B show representative data from thermal melting experiments of a GAIM-lg fusion compared to a GAIM dimer or monomer.
  • Tm1 Thermal melting
  • Figs. 5A and 5B depict fluorescence emission spectra of GAIM at 0 M guanidine hydrochloride (GuFICI) (broken lines), 2 M GuFICI (continuous lines), and 5 M GuFICI (dotted lines) excited at 295 nm (Fig. 5A) and 280 nm (Fig. 5B).
  • Fig. 5C depicts equilibrium unfolding of GAIM dimer by GuHCI.
  • Fig. 5C shows two transitions, the first between 1 M and 2 M GuHCI and the second between 2 M and 4 M GuHCI.
  • Relative fluorescence intensities at 340 nm (excitation 280 nm) were plotted at various concentrations of GuHCI.
  • Fig. 5D depicts N2 domain unfolding at 1.5 M GuHCI.
  • Fig. 5E depicts N1 domain unfolding at 2.6 M GuHCI.
  • Figs. 6A and 6B depict the mapping of GAIM residues that modulate amyloid binding.
  • the GAIM scaffold PB120 is represented by a grey triangle and variants are represented by circles.
  • a decrease in Tm1 indicates a more open conformation of GAIM, resulting in increased binding, whereas stabilized variants with higher Tm1 tend to lose binding activity.
  • Fig. 7A and 7B show amyloid binding for select GAIM-lg fusion proteins.
  • Fig. 7A compares amyloid binding for the GAIM scaffold (closed circle) and stabilized variants thereof.
  • FQGN, VNGV, and QGGK are SEQ ID NOs:8- 10, respectively.
  • Fig. 7B shows the superior binding of open-stabilized (but not super-stabilized) GAIM-lg fusion proteins.
  • Open-stabilized polypeptides, (other than the super-stabilized polypeptide PB113, shown on the far right), are indicated within the open box.
  • FIG. 8A-8D shows binding of a representative open-stabilized GAIM-lg fusion (circles) to various Ab fibers, compared to binding of the control scaffold to those Ab fibers (squares).
  • Fig. 8A shows binding to Ab3-42-RgG0 fibers;
  • Fig. 8B shows binding to Ab1 -42 E22Q fibers;
  • Fig. 8C shows binding to Ab11 -42 fibers;
  • Fig. 8D shows binding to Ab11 -42-Pyro fibers.
  • Fig. 9 shows the effect of N2-stabilizing mutations on off-target binding to collagen.
  • Figs. 10A-10D address the remodeling efficiencies of different GAIM-lg fusion proteins incubated with Ab42 fibers.
  • Fig. 10B further demonstrates the correlation between Ab42 binding and remodeling by various GAIM-lg fusion proteins. Open-stabilized GAIM-lg-fusions are represented by dark grey upside-down triangles. The GAIM scaffold is depicted by a light grey right-side-up triangle. Circles represent other tested GAIM-lg fusions.
  • Fig. 10A-10D address the remodeling efficiencies of different GAIM-lg fusion proteins incubated with Ab42 fibers.
  • Fig. 10B further demonstrates the correlation between Ab42 binding and remodeling by various GAIM-lg fusion proteins. Open-stabilized
  • Fig. 10D shows transmission electron microscopy (TEM) images showing Ab42 fibers before (left) and after (right) incubation with 0.8 mM PB108 at 37°C for six days. [019]
  • Figs. 11A-11C address the remodeling efficiencies of different GAIM-lg fusion proteins incubated with tau fibers.
  • FIG. 11A compares the remodeling efficiencies of representative open-stabilized GAIM-lg fusion protein PB108 and the super-stabilized fusion protein PB113. Remodeling is indicated by the presence of tauKL monomers and dimers (middle panel) in treated aggregates.
  • Fig. 11B compares the remodeling efficiencies of two
  • Fig. 11C shows TEM images showing tauKL fibers before (left) and after (right) incubation with 100 nM PB108 at 37°C for three days.
  • Figs. 12A-12D depict inhibition of amyloid assembly by GAIM-lg fusion proteins of the invention. Error bars represent standard deviation from three or more independent experiments.
  • Fig. 12A shows concentration- dependent inhibition of Ab42 fiber assembly.
  • PB120 control scaffold
  • Fig. 12B compares inhibition of Ab42 fiber assembly at 250 nM GAIM fusion.
  • Fig. 12C shows concentration-dependent inhibition of tauKL fiber assembly.
  • PB120 (control scaffold) is represented by circles, PB108 by squares, and PB116 by triangles.
  • Fig. 12D compares inhibition of tauKL fiber assembly at 250 nM GAIM fusion.
  • SEQ ID NO:1 AETVESCLAKPHTENSFTNVWKDDKTLDRYAN
  • SEQ ID NO:2 ATTDAECLSKPAFDGTLSNVWKEGDSRYAN
  • the articles“a” and“an” refer to one or to more than one (i.e. , to at least one) of the grammatical object of the article.
  • the term“or” means, and is used
  • g3p when used alone or in terms such as“g3p- derived” or“g3p fusion” refers to any wild type or recombinant filamentous phage g3p protein, including fragments, variants, and mutants of g3p that retain the ability to bind to amyloid. These terms should not be construed as limited to any particular filamentous bacteriophage g3p.
  • filamentous bacteriophage “filamentous bacteriophage,”“bacteriophage,” and “phage” are used interchangeably herein and include both wild type and recombinant filamentous bacteriophage.
  • wild type filamentous bacteriophage refers to filamentous bacteriophage found in nature, filamentous bacteriophage that have been indicated as“wild type” in any nucleotide or amino acid sequence database, filamentous bacteriophage that are commercially available and characterized as“wild type,” and filamentous bacteriophage that have acquired non-recombinant mutations relative to any of the foregoing through passaging.
  • domain means a region of a
  • a domain may contain the sequence of the distinctive physical feature of the polypeptide or it may contain a fragment of the physical feature that retains its binding characteristics (e.g., it retains the ability to bind to a second domain).
  • a domain may be associated with another domain. For example, the g3p N2 domain binds F-pili and the g3p N1 domain binds TolA.
  • “general amyloid interaction motif” or“GAIM” refers to a two-domain polypeptide (N1 and N2 domains of g3p) that mediates amyloid binding using a combination of both hydrophobic and polar residues lining the inner surfaces of the molecule.
  • GAIM monomer have an asymmetric distribution of aromatic amino acids.
  • GAIM N2 domain contains 11 Tyrosine (Tyr) residues and 1 exposed Tryptophan (Trp) residue; the N1 domain contains 3 Trp and 3 Tyr residues.
  • the N1 and N2 domains adopt an inverted horseshoe conformation and are held together in a closed conformation (locked conformation) by an intricate network of hydrogen bonds (Weininger et al. , 2009).
  • a cis-trans isomerization of the prolines in the inter-domain linker leads to progressive breakage of the hydrogen-bonds and partial opening of the two domains.
  • The“opening” rearrangement of the N1 and N2 domains of GAIM exposes b-strands 4 and 5 of N1 (comprising polar residues) and b-strands 9 and 10 of N2 (comprising aromatic/hydrophobic residues) and allows for binding to amyloid. See Fig. 1A.
  • control scaffold or“GAIM scaffold” corresponds to the GAIM-lg fusion protein PB120, having the amino acid sequence of SEQ ID NO: 11.
  • the GAIM portion of the GAIM scaffold has the amino acid sequence of SEQ ID NO: 12.
  • PB120 is derived from PB106, having the amino acid sequence of SEQ ID NO: 13.
  • the GAIM portion of PB106 has the amino acid sequence of SEQ ID NO:14.
  • “PB106 + EDGS” (“EDGS” disclosed as SEQ ID NO:54) represents an open-conformation polypeptide having the amino acid sequence as provided by SEQ ID NO: 15.
  • the GAIM portion of“PB106 + EDGS” (“EDGS” disclosed as SEQ ID NO:54) has the amino acid sequence of SEQ ID NO:16.
  • “super-stabilized” GAIM or GAIM fusion refers to the GAIM-lg fusion PB113, having the amino acid sequence of SEQ ID NO: 17.
  • the GAIM portion of PB113 has the amino acid sequence of SEQ ID NO: 18.
  • the terms“GAIM-lg fusion,”“GAIM-lg fusion protein,” and“GAIM fusion” are herein used interchangeably and refer to a polypeptide comprising a g3p GAIM domains connected directly to or through a small linker to an immunoglobulin constant region. As shown in Fig. 1 B, the Fc region of the GAIM-lg fusions of the invention dimerize, resulting in a complex that comprises two copies of GAIM attached directly or through a small linker to an
  • a GAIM fusion of the invention may further comprising a signal sequence.
  • the present invention contemplates GAIM fusions with any immunoglobulin constant region, for example, the
  • the GAIM-lg fusion is an open-stabilized GAIM-lg fusion. In some aspects, the GAIM-lg fusion is partially or fully deimmunized.
  • GAIM dimer refers to the two GAIM domains of a GAIM-lg fusion described herein.
  • a GAIM dimer is graphically represented by Fig. 1 C.
  • the terms“open-stabilized fusion,”“open-stabilized GAIM-lg fusion,”“open-stabilized variant,” and“open-stabilized GAIM-lg variant” are used interchangeably herein and refer to a GAIM-lg fusion comprising at least one open conformation mutation and at least one stabilizing mutation in the GAIM portion of the fusion.
  • the open-conformation mutation of the open-stabilized variants described herein is a substitution of SEQ ID NO:3 (DDKTLD; amino acids 24-29 relative to SEQ ID NO:13 and SEQ ID NO:15) with SEQ ID NO:4 (EGDS).
  • a stabilizing mutation may be an N2-stabilizing mutation, for example, selected from substitution of SEQ ID NO:5 (FQNN; amino acids 137-140 relative to SEQ ID NO: 13; amino acids 135-138 relative to SEQ ID NO: 15) with SEQ ID NO:8 (FQGN), substitution of SEQ ID NO:6 (RQGA; amino acids 145-148 relative to SEQ ID NO: 13; amino acids 143-146 relative to SEQ ID NO: 15) with SEQ ID NO:9 (VNGV), substitution of SEQ ID NO:7 (QGTDPVK; amino acids 158-164 relative to SEQ ID NO: 13; amino acids 156-162 relative to SEQ ID NO: 15) to SEQ ID NO: 10 (QGGK), or a combination thereof.
  • Open-stabilized fusions as described herein may further comprise one or more substitutions, insertions, or deletions.
  • an open-stabilized GAIM-lg fusion may be further modified to reduce or eliminate immunogenicity, to remove a potential glycosylation site, or to further modulate binding activity or specificity to amyloid protein.
  • a GAIM-lg fusion protein of the invention that “consists essentially” of a given amino acid sequence may further include a small linker connecting the GAIM domain and Fc domain of the fusion, an N-terminal signal sequence or a fragment thereof, a deletion of the N-terminal methionine (DM1 ) or a deletion of both the N-terminal methionine and alanine (DM1 and DA2), and/or a deletion of the C-terminal lysine (K) of the Fc domain of the fusion.
  • DM1 N-terminal methionine
  • DM1 and DA2 deletion of both the N-terminal methionine and alanine
  • K C-terminal lysine
  • a“small linker” refers to a peptide linker up to 25 amino acids in length, which connects the GAIM domain and the Fc domain of a GAIM-lg fusion.
  • an exemplary“small linker” connecting the GAIM and Fc domains of a GAIM-lg fusion may comprise a GS- rich sequence or may comprise the amino acid sequence ARS.
  • a“signal sequence” refers to a short peptide of approximately 16 to 30 amino acids present at the N-terminus of a polypeptide of the invention.
  • the signal sequence may comprise the 18-amino acid N-terminal sequence of GenBank Ref Seq NP_510891.1.
  • a signal sequence is used by a eukaryotic cell to secrete a polypeptide of the invention.
  • amyloid or“amyloid fiber” is used herein as a generic term for a tertiary structure that is formed by misfolding or aggregation of any of several different proteins and that comprises an ordered arrangement of b- sheets stacked perpendicular to a fiber axis.
  • Amyloid as used herein, can be formed from any of the following proteins: Androgen receptor; apolipoprotein Al; apolipoprotein All; apolipoprotein AIV; aposerum amyloid A; Ab; ABri; ADan; Atrophin-1 ; atrial natriuretic factor; ataxin; calcitonin; g-crystallin; cystatin C; fibrinogen; gelsolin; huntingtin; insulin; islet amyloid polypeptide; immunoglobulin kappa light chain; immunoglobulin lambda light chain; kerato-epithelin; keratin; lactahedrin; lactoferrin; lysozyme; lung surfactant protein C; medin; odontogenic ameloblast-associated protein; prion protein; procalcitonin; prolactin; semenogelin I; serum amyloid A;
  • Amyloid as used herein, can also be formed from truncated or post-translationally modified forms of any of the above proteins. “Amyloid” or“amyloid fiber” includes different or multiple conformations or morphologies of amyloid.
  • “toxic oligomer” refers to a small assembly or aggregate of monomers that is typically on-pathway for formation of amyloid.
  • Exemplary amyloid includes amyloid-b aggregates formed in
  • Alzheimer's disease which comprises beta-amyloid peptide "Ab," 39-43 amino acid internal fragments cleaved from the human amyloid precursor protein (hAPP).
  • Ab includes truncated and post-translationally modified forms.
  • Ab40 is a short form of Ab
  • Ab42 is a long form.
  • Further examples of Ab include, but are not limited to, N-truncated Ab11 -42, Ab11-42-Pyro, Ab3-424 ⁇ G0, and Ab1-42-E220-Ou ⁇ oIi mutation. See Levy et al, 1990; Van Broeckhoven et al, 1990.
  • Other exemplary amyloid proteins include a-synuclein (associated with Parkinson's disease), huntingtin (associated with Huntington's disease), tau (associated with Alzheimer's
  • amyloidosis diseases the abnormal conformation of the prion protein, PrP Sc , and amyloid associated with various amyloidosis diseases, including but not limited to:
  • immunoglobulin light chain (kappa or lambda), transthyretin, gelsolin, and islet amyloid polypeptide. Additional examples are provided throughout the description and are known to those of skill in the art (see, e.g., Aguzzi (2010), and Eichner and Radford, Mol. Cell (2011 ) 43:8-18). Unless a protein or peptide is specified, use of the terms "amyloid” or “amyloid fibers” should not be construed as limited to any particular protein, morphology, disease, or condition.
  • beta amyloid peptide is synonymous with “b-amyloid peptide,” bAR,” “bA,” and “Ab.” All of these terms refer to an amyloid forming peptide derived from the human amyloid precursor protein (hAPP).
  • PrP protein refers to polypeptides that are capable under appropriate conditions of inducing the formation of aggregates responsible for protein misfolding diseases.
  • PrP c normal cellular prion protein
  • PrP Sc scrapie isoform
  • diseases such as, but not limited to, bovine spongiform encephalopathy (BSE) (mad cow disease), feline spongiform encephalopathy of cats, kuru, Creutzfeldt- Jakob Disease (CJD), Gerstmann-Straussler-Scheinker disease (GSS), and fatal familial insomnia (FFI).
  • BSE bovine spongiform encephalopathy
  • CJD Creutzfeldt- Jakob Disease
  • GSS Gerstmann-Straussler-Scheinker disease
  • FFI fatal familial insomnia
  • a“disease associated with misfolded and/or aggregated amyloid protein” includes but is not limited to Alzheimer’s disease; early onset Alzheimer's disease; late onset Alzheimer's disease; presymptomatic Alzheimer's disease; AL amyloidosis; amyotrophic lateral sclerosis (ALS);
  • Amyotrophic lateral sclerosis/parkinsonism-dementia complex Argyrophilic grain dementia; Aortic medial amyloidosis; ApoAI amyloidosis; ApoAII amyloidosis; ApoAIV amyloidosis; Atrial amyloidosis; British/Danish dementia; Cataract;
  • cystatin C plaque-related disease cystatin C plaque-related coronary disease
  • cystatin C plaque-related kidney disease cystatin C plaque-related kidney disease
  • cutaneous lichen amyloidosis cystatin C plaque-related disease
  • amyloid aggregate formation i.e., misfolded and/or aggregated proteins
  • a polypeptide, composition, formulation, or nucleic acid that "reduces amyloid” does one or more of the following: inhibits amyloid formation, causes amyloid disaggregation, causes amyloid remodeling, promotes amyloid clearance, inhibits amyloid aggregation, blocks and/or prevents the formation of toxic oligomers, and/or promotes the clearance of toxic oligomers.
  • Disaggregating reduce aggregates that have already formed.
  • Disaggregation can be measured by the filter trap assay (Wanker et al. , Methods Enzymol (1999) 309:375-86) or other methods known in the art.
  • the filter trap assay can be used both to detect aggregates and to monitor disaggregation mediated by compositions of the invention.
  • Disaggregation is detected as decreased retention of amyloid on the filter, as shown by a decrease in staining, in the presence of increasing concentrations of the disaggregating agent.
  • Products or compositions of the invention described as "protecting neurons from amyloid damage” may be taken prophylactically. Whether or not a product or composition protects neurons from amyloid damage may be measured by a neuronal cell culture cytotoxicity assay as described in WO 2014/055515, hereby incorporated by reference in its entirety.
  • Remodeling may be measured through denaturation studies using urea (e.g., for forms of Ab) or a sarkosyl solubility assay (e.g., for forms of tau). Increased remodeling may be detected by the loss or failure of amyloid to bind Thioflavin T (ThT), resulting in reduced ThT fluorescence. Remodeling may also be detected using transmission electron microscopy (TEM).
  • urea e.g., for forms of Ab
  • a sarkosyl solubility assay e.g., for forms of tau
  • Increased remodeling may be detected by the loss or failure of amyloid to bind Thioflavin T (ThT), resulting in reduced ThT fluorescence. Remodeling may also be detected using transmission electron microscopy (TEM).
  • TEM transmission electron microscopy
  • Polypeptides, nucleic acids, or compositions of the invention described as“inhibiting amyloid aggregation” partially or completely prevent aggregation of amyloid. Inhibition of amyloid aggregation may be measured by a ThT fluorescence assay (e.g., lower fluorescence indicating a lower percentage of amyloid aggregation).
  • bacteriophage, protein, polypeptide, or amino acid sequence refers to a corresponding substance that contains at least one amino acid difference (at least one mutation, being a substitution, insertion, or deletion) as compared to the reference substance.
  • a "variant" has high amino acid sequence homology and/or conservative amino acid substitutions, deletions, and/or insertions as compared to the reference sequence.
  • a variant has no more than 25, 20, 17, 15, 12, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid differences as compared to the reference sequence.
  • a variant as described herein may preserve or increase: amyloid-binding activity, amyloid-binding specificity, and/or protein quality as compared to the reference sequence.
  • a variant as described herein may be deglycosylated.
  • a variant as described herein may reduce or eliminate immunogenicity.
  • a “conservative substitution” refers to the replacement of a first amino acid by a second amino acid that does not substantially alter the chemical, physical and/or functional properties of the g3p protein or amyloid binding fragment of g3p (e.g., the g3p protein or amyloid binding fragment retains the same charge, structure, polarity, hydrophobicity/hydrophilicity, and/or preserves functions such as the ability to recognize, bind to, and/or reduce amyloid).
  • conservative amino acid modifications are based on the relative similarity of the amino acid side-chain substituents, for example, their
  • Exemplary sets of amino acids which are interchangeable as conservative substitutions, and which take various of the foregoing characteristics into consideration, are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine, and isoleucine.
  • the term "immunogenic” or“immunogenicity” is used herein to refer to the ability of a composition to elicit an immune response in a mammal that has been exposed to the composition.
  • the present invention relates to polypeptides or compositions with reduced immunogenicity or that are fully deimmunized.
  • Full deimmunization indicates the removal of all five of the T-cell recognition epitopes present in the native GAIM amino acid sequence by one or more mutations in those epitopic sequences.
  • Such deimmunizing mutations may constitute a substitution, insertion, or deletion of one or more amino acid residues in an epitope, or may constitute partially or fully deleting the epitopic sequence.
  • the general amyloid interaction motif is a two-domain polypeptide comprising the N1 and N2 domains of g3p.
  • the GAIM N2 domain consists of three distinct structural elements: a globular part resembling N1 in structure (Holliger et al. (1999) J Mol Biol, 288:649-57), an alpha-helix, and a disordered region that forms an extensive network of H-bonds with the N1 domain.
  • the N2 hinge region also contains several proline residues, one of which (P213) has been implicated in maintaining GAIM in an open, TolA binding- competent state.
  • the N1 and the N2 domains of the GAIM monomer have an asymmetric distribution of aromatic amino acids.
  • the GAIM N2 domain contains 11 Tyrosine (Tyr) residues and 1 exposed Tryptophan (Trp) residue; the N1 domain contains 3 Trp and 3 Tyr residues.
  • Tyrosine residues Tyrosine residues
  • Trp Tryptophan residue
  • the intrinsic fluorescence of tyrosine and tryptophan residues allow specific monitoring of conformational changes in N2 and N1 domains, respectively (Martin and Schmid (2003) J Mol Biol, 405:989-1003), allowing for detection of an open conformation of GAIM.
  • H/D exchange studies show that GAIM binds to the central core of Ab42 fibers. As demonstrated by Fig. 2, H/D exchange studies also show that GAIM engages discontinuous sequences on the fibril-core and binds both sequences rich in aromatic residues (e.g., residues 17-25 in Ab42) and aliphatic residues (e.g., residues 31 -40 in Ab42). This results in robust inhibition of amyloid assembly and efficient remodeling of fibers into amorphous aggregates (Krishnan et al. (2014) J Mol Biol, 426:2500-19).
  • a polypeptide or composition comprising the polypeptide comprises a GAIM variant.
  • a GAIM variant has no more than 25 amino acid differences as compared to the reference sequence. In some embodiments, a GAIM variant has no more than 17 amino acid differences as compared to the reference sequence. In some
  • a GAIM variant has no more than 10 amino acid differences as compared to the reference sequence. In some embodiments, a variant has no more than 7 amino acid differences as compared to the reference sequence.
  • the reference sequence is SEQ ID NO: 12 (GAIM portion of PB120). In some embodiments, the reference sequence is SEQ ID NO:14 (GAIM portion of PB106). In some embodiments, the reference sequence is SEQ ID NO: 16 (GAIM portion of“PB106 + EDGS” ("EDGS" disclosed as SEQ ID NO:54)).
  • all GAIM amino acid sequence numbering is based on the amino acid sequence of SEQ ID NO:16 and all GAIM-lg amino acid sequence numbering is based on the amino acid sequence of SEQ ID NO: 15, which constitutes SEQ ID NO: 16 fused at the C-terminal end to a human lgG1-Fc amino acid sequence by the short linker ARS.
  • Polypeptides of the invention comprise any of the GAIM variants described herein.
  • the GAIM variants disclosed herein comprise a substitution of SEQ ID NO:3 (DDKTLD; amino acids 24-29 relative to SEQ ID NO: 13) with SEQ ID NO:4 (EGDS). This substitution is present in reference sequence SEQ ID NO: 16 and results in the GAIM variants of the invention having an open- conformation (“open” or“unlocked”) GAIM variant.
  • the GAIM variants of the invention also include at least one additional set of amino acid changes selected from (i) alternative T-cell epitope 1 -deimmunizing changes, (ii) T-cell epitope 2-deimmunizing changes, and (iii) N2-stabilizing changes.
  • the at least one other set of amino acid changes increases amyloid affinity while still being deimmunized in T-cell epitope 1.
  • deimmunized T-cell epitope 1 spans from amino acids G47 to H55. The H55 in that sequence causes the deimmunization; wild- type g3p (in which T-cell epitope 1 is not deimmunized) has a threonine at the corresponding position.
  • amyloid affinity remains significant for g3p polypeptide variants comprising the threonine-to-histidine change at amino acid 55 of SEQ ID NO: 16, this affinity is somewhat reduced relative to wild-type.
  • a GAIM variant of the invention comprises a T50 substitution accompanied by a H55T substitution.
  • the T50 substitution is T50R, T50K, T50G, or T50H. In at least one aspect of these embodiments, the T50 substitution is T50H.
  • the at least one other set of amino acid changes deimmunizes T-cell epitope 2 without significantly altering amyloid affinity.
  • T-cell epitope 2 spans from amino acid M134 to N142 (see U.S. Patent No. 9,988,444 B2 and U.S. Patent Publication US 2018/0207231 A1 , each incorporated by reference in its entirety), and is unchanged as compared to the corresponding wild-type g3p sequence.
  • a GAIM variant of the invention comprises a substitution of N142.
  • the N142 substitution is N142A.
  • a GAIM variant of the invention comprises a substitution of N137.
  • the N137 substitution is N137G.
  • a GAIM variant of the invention comprises a substitution of N137 and a substitution of N142.
  • the N137 substitution is N137G and the N142 substitution is N142A.
  • the at least one other set of amino acid changes increases the stability of N2.
  • These changes target one or more of the so-called slow folding loops present in SEQ ID NO: 16, which span amino acids 135-138 (FQNN; SEQ ID NO:5; Turn 1 ), 143-146 (RQGA; SEQ ID NO:6; Turn 2), and 156-162 (QGTDPVK; SEQ ID NO:7; Turn 3), as depicted by Fig. 3C.
  • SEQ ID NO: 16 span amino acids 135-138
  • RQGA SEQ ID NO:6; Turn 2
  • QGTDPVK QGTDPVK
  • SEQ ID NO:7 Turn 3
  • At least one other set of amino acid changes is selected from: (i) N137G; (ii) R143V, Q144N, and, optionally, A146V, A146T, or A146K; and (iii) V161 G, deletion of T158, D159, and P160, optionally, Q156V or Q156Y, and, optionally, G157N.
  • N137G substitution that stabilizes N2 by removing the slow-folding loop at Turn 1 also deimmunizes T-cell epitope 2.
  • the GAIM variant comprises amino acid changes in only one of Turn 1 , Turn 2, and Turn 3, e.g., one of: (i) N137G; (ii) R143V, Q144N, and, optionally, A146V, A146T, or A146K; and (iii) V161 G, deletion of T158, D159, and P160, optionally, Q156V or Q156Y, and, optionally, G157N.
  • the GAIM variant comprises amino acid changes in at least two of the turns, e.g., two of (i) N137G; (ii)
  • the amino acid change is N137G, resulting in SEQ ID NO:8 at amino acids 135-138. In some aspects of these embodiments, the amino acid change is R143V, Q144N, and A146V, resulting in SEQ ID NO:9 at amino acids 143-146.
  • the amino acid change is deletion of T158, D159, and P160, and the substitution V161 G, resulting in SEQ ID NO: 10 as a replacement for amino acids 156-162.
  • the GAIM variant does not comprise amino acid changes in all three of the turns.
  • a polypeptide of the invention comprises a GAIM variant having at least one set of amino acid changes selected from any of the above-described alternative T-cell epitope 1 -deimmunizing changes and at least one set of amino acid changes selected from any of the above-described T- cell epitope 2-deimmunizing changes.
  • the GAIM variants has at least one set of amino acid changes selected from any of the above-described alternative T-cell epitope 1 -deimmunizing changes and at least one set of amino acid changes selected from any of the above-described N2-stabilizing changes.
  • the GAIM variant has at least one set of amino acid changes selected from any of the above-described T-cell epitope 2- deimmunizing changes and at least one set of amino acid changes selected from any of the above-described N2-stabilizing changes.
  • the GAIM variant has at least one set of amino acid changes selected from any of the above-described alternative T-cell epitope 1 -deimmunizing changes, at least one set of amino acid changes selected from any of the above-described T-cell epitope 2-deimmunizing changes, and at least one set of amino acid changes selected from any of the above-described N2-stabilizing changes.
  • T-cell epitope 1 of SEQ ID NO: 16 is deimmunized by a T55H substitution relative to wild-type g3p. Mutations in T-cell epitope 1 in the open-stabilized GAIM-lg fusions represent alternative deimmunizing substitutions.
  • the polypeptides of the invention comprise a deglycosylated GAIM variant.
  • the reference sequence SEQ ID NO: 16 is deglycosylated because it comprises a T40G mutation relative to wild-type g3p, thus altering the native NAT glycosylation signal to NAG. Examples of other deglycosylated g3p mutants and/or variants can be found in U.S. Patent Publication US 2018/0207231 A1 .
  • GAIM variants that have different and/or additional deglycosylating mutations in the native glycosylation signal are also part of the present invention.
  • the three amino acid sequence NX(T/S), where X is any amino acid is a known glycosylation signal.
  • a GAIM variant described herein comprises a substitution of N38 with any amino acid other than cysteine as compared to SEQ ID NO: 16, and further comprises one or more of an alternative T-cell epitope 1 -deimmunizing change, a T-cell epitope 2-deimmunizing change, and/or an N2-stabilizing change.
  • the substitution of N38 is N38A.
  • the GAIM variant further comprises a substitution of G40 to any amino acid other than cysteine.
  • a GAIM variant described herein comprises a substitution of G40 with any amino acid other than cysteine, threonine, or serine as compared to SEQ ID NO: 16, and further comprises one or more of a T-cell epitope 1 -deimmunizing change, a T-cell epitope 2- deimmunizing change, and/or an N2-stabilizing change.
  • SEQ ID NO: 16 includes the N-terminal amino acids M1 and A2. Recombinant production of GAIM in animal cell lines can result in polypeptides that are missing M1 or both M1 and A2 (an“N-terminal truncation”). Such N- terminal truncations do not affect amyloid-binding activity.
  • a GAIM variant optionally lacks amino acid 1 (DM1 ) or both amino acids 1 and 2 (DM1 and DA2) of SEQ ID NO: 16, in addition to comprising one or more of a T-cell epitope 1 -deimmunizing change, a T-cell epitope 2- deimmunizing change, and/or an N2-stabilizing change.
  • a GAIM variant lacking amino acid 1 or both amino acid 1 or 2 may refer to an N-terminal truncation (i.e. , removal after translation) or a deletion mutation.
  • the GAIM variant is a variant of SEQ ID NO: 16 comprising the substitution N137G. In some aspects of these
  • the GAIM variant lacks amino acid 1 (e.g., DM1 ). In some aspects of these embodiments, the GAIM variant lacks amino acids 1 and 2 (e.g., DM1 and DA2). In some aspects of these embodiments, the GAIM variant further comprises a substitution of N38 with any amino acid other than cysteine, a substitution of G40 with any amino acid other than cysteine, threonine, or serine, or both a substitution of N38 with any amino acid other than cysteine and a substitution of G40 with any amino acid other than cysteine. In at least one aspect of these embodiments, the N38 substitution is N38A.
  • the GAIM variant is a variant of SEQ ID NO: 1
  • the GAIM variant is a variant of SEQ ID NO: 16 comprising R143V, Q144N, and, optionally, A146V, A146T, or A146K.
  • the GAIM variant is a variant of SEQ ID NO: 16 comprising R143V, Q144N, and A146V.
  • the GAIM variant additionally lacks amino acid 1 (e.g., DM1 ).
  • the GAIM variant additionally lacks amino acids 1 and 2 (e.g.,
  • the GAIM variant further comprises a substitution of N38 with any amino acid other than cysteine, a substitution of G40 with any amino acid other than cysteine, threonine, or serine, or both a substitution of N38 with any amino acid other than cysteine and a substitution of G40 with any amino acid other than cysteine.
  • the N38 substitution is N38A.
  • the GAIM variant is a variant of SEQ ID NO: 16 comprising a substitution of T50 with any other amino acid
  • the substitution of T50 is selected from T50H, T50G, T50K, and T50R. In at least one aspect of these embodiments, the substitution of T50 is T50H.
  • the GAIM variant further (i) comprises an N142A substitution; (ii) comprises a deglycosylating mutation of N38 and/or G40; (iii) lacks amino acid 1 or both amino acids 1 and 2; or (iv) any combination thereof.
  • the GAIM variant lacks amino acid 1 (e.g., DM1 ).
  • the GAIM variant lacks amino acids 1 and 2 (e.g., DM1 and DA2).
  • the GAIM variant further comprises a substitution of N38 with any amino acid other than cysteine, a substitution of G40 with any amino acid other than cysteine, threonine, or serine, or both a substitution of N38 with any amino acid other than cysteine and a substitution of G40 with any amino acid other than cysteine.
  • the N38 substitution is N38A.
  • the GAIM variant is a variant of SEQ ID NO: 16 comprising the substitutions N137G and N142A.
  • the GAIM variant further (i) comprises a substitution of T50 with any other amino acid as well as the substitution H55T; (ii) comprises a deglycosylating mutation of N38 and/or G40; (iii) lacks amino acid 1 or both amino acids 1 and 2; or (iv) any combination thereof.
  • the substitution of T50 is selected from T50H, T50G, T50K, and T50R. In at least one aspect of these embodiments, the substitution of T50 is T50H.
  • the GAIM variant lacks amino acid 1 (e.g., DM1 ). In some aspects of these embodiments, the GAIM variant lacks amino acids 1 and 2 (e.g., DM1 and DA2). In some aspects of these embodiments, the GAIM variant further comprises a substitution of N38 with any amino acid other than cysteine, a substitution of G40 with any amino acid other than cysteine, threonine, or serine, or both a substitution of N38 with any amino acid other than cysteine and a substitution of G40 with any amino acid other than cysteine. In at least one aspect of these embodiments, the N38 substitution is N38A.
  • the GAIM variant is a variant of SEQ ID NO:16 comprising the following substitutions: N142A, R143V, Q144N, and, optionally, A146V, A146T, or A146K.
  • the GAIM variant is a variant of SEQ ID NO:16 comprising the following substitutions: N142A, R143V, Q144N, and A146V.
  • the GAIM variant further (i) comprises a substitution of T50 with any other amino acid as well as the substitution H55T; (ii) comprises a deglycosylating mutation of N38 and/or G40; (iii) lacks amino acid 1 or both amino acids 1 and 2; or (iv) any combination thereof.
  • the substitution of T50 is selected from T50H, T50G, T50K, and T50R. In at least one aspect of these embodiments, the substitution of T50 is T50H. In some aspects of these embodiments, the GAIM variant lacks amino acid 1 (DM1 ). In some aspects of these embodiments, the GAIM variant lacks amino acids 1 and 2 (DM1 and DA2). In some aspects of these embodiments, the GAIM variant further comprises a substitution of N38 with any amino acid other than cysteine, a substitution of G40 with any amino acid other than cysteine, threonine, or serine, or both a substitution of N38 with any amino acid other than cysteine and a substitution of G40 with any amino acid other than cysteine. In at least one aspect of these embodiments, the N38 substitution is N38A.
  • the GAIM variant is a variant of SEQ ID NO: 1
  • the GAIM variant is a variant of SEQ ID NO: 16 comprising the following substitutions: DT158, D ⁇ 159, DR160, V161 G and, optionally, (i) Q156V or Q156Y and/or (ii) G157N.
  • the GAIM variant is a variant of SEQ ID NO: 16 comprising the following substitutions: DT 158, D ⁇ 159, DR160, and V161 G.
  • the GAIM variant further (i) comprises a substitution of T50 with any other amino acid as well as the substitution H55T;
  • T50 comprises a deglycosylating mutation of N38 and/or G40; (iii) lacks amino acid 1 or both amino acids 1 and 2; or (iv) any combination thereof.
  • the substitution of T50 is selected from T50H,
  • the substitution of T50 is T50H.
  • the GAIM variant lacks amino acid 1 (DM1 ). In some aspects of these embodiments, the GAIM variant lacks amino acids 1 and 2 (DM1 and DA2). In some aspects of these embodiments, the GAIM variant further comprises a substitution of N38 with any amino acid other than cysteine, a substitution of G40 with any amino acid other than cysteine, threonine, or serine, or both a substitution of N38 with any amino acid other than cysteine and a substitution of G40 with any amino acid other than cysteine. In at least one aspect of these embodiments, the N38 substitution is N38A.
  • a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO: 19. In at least one embodiment, a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO:20. In at least one embodiment, a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO:21. In at least one embodiment, a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO:22. In at least one embodiment, a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO:23.
  • a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO:24. In at least one embodiment, a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO:25. In at least one embodiment, a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO:24. In at least one embodiment, a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO:25. In at least one embodiment, a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO:24. In at least one embodiment, a polypeptide of the present invention comprises a GAIM variant having the amino acid sequence of SEQ ID NO:25.
  • any of the above-described GAIM variants may be fused at the C- terminal end, directly or through a short linker, to an immunoglobulin constant region, to yield a GAIM-lg fusion protein.
  • the immunoglobulin constant region of the GAIM-lg fusion proteins described herein may be the immunoglobulin constant region of IgG (including lgG1 , lgG2, lgG3, and lgG4), IgA, IgD, IgE, or IgM.
  • the immunoglobulin constant region is IgG.
  • the IgG is IgGl
  • the IgG is lgG2.
  • the immunoglobulin constant region is a human immunoglobulin constant region.
  • the immunoglobulin constant region is the Fc portion of a human IgG, or a fragment thereof.
  • Fc portions of a human IgG suitable for the fusion proteins of the invention include wild-type or modified Fc portions.
  • a suitable modified Fc portion of a human IgG may stabilize the fusion protein and/or increase its half-life relative to wild-type Fc.
  • modified Fc include those disclosed in US Patent No. 7,083,784, US Patent No. 7,217,797, US Patent No. 7,217,798, US Patent Application No. 14/214, 146, and WO-1997034631.
  • the immunoglobulin constant region is the Fc portion of human lgG1. In at least one embodiment, the immunoglobulin constant region is the Fc portion of human lgG2. In some embodiments, the immunoglobulin constant region of the GAIM- lg fusion protein comprises a C-terminal lysine (e.g., K485). In other words,
  • the GAIM-lg fusion lacks a C-terminal lysine (e.g., DK485).
  • the GAIM-lg fusion protein consists essentially of a polypeptide comprising any GAIM variant disclosed herein and the Fc portion of a human IgG (e.g., human lgG1 ). In at least one embodiment, the GAIM-lg fusion protein consists essentially of a sequence at least 95%, 96%, 97%, 98%, or 99% identical to that described by SEQ ID NO: 19 and the Fc portion of a human IgG (e.g., human lgG1 ). In some aspects of this
  • the amino acid sequence of the GAIM portion of the GAIM-lg fusion protein differs from that described by SEQ ID NO: 19 by 10-15, 1 -10, or 1 - 5 conservative substitutions.
  • the GAIM-lg fusion protein consists essentially of SEQ ID NO: 19 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the GAIM-lg fusion protein consists essentially of the amino acid sequence of SEQ ID NO:29 (PB108).
  • the GAIM-lg fusion protein consists essentially of a variant of SEQ ID NO:29 in which the variant lacks amino acid 1 (DM1 ), amino acids 1 and 2 (DM1 and DA2), amino acid 485 (DK485), amino acids 1 and 485 (DM1 and DK485), or amino acids 1 , 2, and 485 (DM1 , DA2, and DK485).
  • the GAIM-lg fusion protein consists essentially of a sequence at least 95%, 96%, 97%, 98%, or 99% identical to that described by SEQ ID NO:20 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the amino acid sequence of the GAIM portion of the GAIM-lg fusion protein differs from that described by SEQ ID NO: 20 by 10-15, 1 -10, or 1 -5 conservative substitutions.
  • the GAIM-lg fusion protein consists essentially of SEQ ID NO:20 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the GAIM-lg fusion protein consists essentially of the amino acid sequence of SEQ ID NO:30 (PB122).
  • the GAIM-lg fusion protein consists essentially of a variant of SEQ ID NO:30 in which the variant lacks amino acid 1 (DM1 ), amino acids 1 and 2 (DM1 and DA2), amino acid 485 (DK485), amino acids 1 and 485 (DM1 and DK485), or amino acids 1 , 2, and 485 (DM1 , DA2, and DK485).
  • the GAIM-lg fusion protein consists essentially of a sequence at least 95%, 96%, 97%, 98%, or 99% identical to that described by SEQ ID NO:21 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the amino acid sequence of the GAIM portion of the GAIM-lg fusion protein differs from that described by SEQ ID NO: 21 by 10-15, 1 -10, or 1 -5 conservative substitutions.
  • the GAIM-lg fusion protein consists essentially of SEQ ID NO:21 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the GAIM-lg fusion protein consists essentially of the amino acid sequence of SEQ ID NO:31 (PB116).
  • the GAIM-lg fusion protein consists essentially of a variant of SEQ ID NO:31 in which the variant lacks amino acid 1 (DM1 ), amino acids 1 and 2 (DM1 and DA2), amino acid 485 (DK485), amino acids 1 and 485 (DM1 and DK485), or amino acids 1 , 2, and 485 (DM1 , DA2, and DK485).
  • the GAIM-lg fusion protein consists essentially of a sequence at least 95%, 96%, 97%, 98%, or 99% identical to that described by SEQ ID NO:22 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the amino acid sequence of the GAIM portion of the GAIM-lg fusion protein differs from that described by SEQ ID NO: 22 by 10-15, 1 -10, or 1 -5 conservative substitutions.
  • the GAIM-lg fusion protein consists essentially of SEQ ID NO:22 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the GAIM-lg fusion protein consists essentially of the amino acid sequence of SEQ ID NO:32 (PB114).
  • the GAIM-lg fusion protein consists essentially of a variant of SEQ ID NO:32 in which the variant lacks amino acid 1 (DM1 ), amino acids 1 and 2 (DM1 and DA2), amino acid 485 (DK485), amino acids 1 and 485 (DM1 and DK485), or amino acids 1 , 2, and 485 (DM1 , DA2, and DK485).
  • the GAIM-lg fusion protein consists essentially of a sequence at least 95%, 96%, 97%, 98%, or 99% identical to that described by SEQ ID NO:23 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the amino acid sequence of the GAIM portion of the GAIM-lg fusion protein differs from that described by SEQ ID NO: 23 by 10-15, 1 -10, or 1 -5 conservative substitutions.
  • the GAIM-lg fusion protein consists essentially of SEQ ID NO:23 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the GAIM-lg fusion protein consists essentially of the amino acid sequence of SEQ ID NO:33 (PB109).
  • the GAIM-lg fusion protein consists essentially of a variant of SEQ ID NO:33 in which the variant lacks amino acid 1 (DM1 ), amino acids 1 and 2 (DM1 and DA2), amino acid 485 (DK485), amino acids 1 and 485 (DM1 and DK485), or amino acids 1 , 2, and 485 (DM1 , DA2, and DK485).
  • the GAIM-lg fusion protein consists essentially of a sequence at least 95%, 96%, 97%, 98%, or 99% identical to that described by SEQ ID NO:24 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • GAIM portion of the GAIM-lg fusion protein differs from that described by SEQ ID NO: 1
  • the GAIM-lg fusion protein consists essentially of SEQ ID NO:24 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the GAIM-lg fusion protein consists essentially of the amino acid sequence of SEQ ID NO:34 (PB110).
  • the GAIM-lg fusion protein consists essentially of a variant of SEQ ID NO:34 in which the variant lacks amino acid 1 (DM1 ), amino acids 1 and 2 (DM1 and DA2), amino acid 485 (DK485), amino acids 1 and 485 (DM1 and DK485), or amino acids 1 , 2, and 485 (DM1 , DA2, and DK485).
  • the GAIM-lg fusion protein consists essentially of a sequence at least 95%, 96%, 97%, 98%, or 99% identical to that described by SEQ ID NO:25 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the amino acid sequence of the GAIM portion of the GAIM-lg fusion protein differs from that described by SEQ ID NO: 25 by 10-15, 1 -10, or 1 -5 conservative substitutions.
  • the GAIM-lg fusion protein consists essentially of SEQ ID NO:25 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the GAIM-lg fusion protein consists essentially of the amino acid sequence of SEQ ID NO:35 (PB105).
  • the GAIM-lg fusion protein consists essentially a variant of SEQ ID NO:35 in which the variant lacks amino acid 1 (DM1 ), amino acids 1 and 2 (DM1 and DA2), amino acid 485 (DK485), amino acids 1 and 485 (DM1 and DK485), or amino acids 1 , 2, and 485 (DM1 , DA2, and DK485).
  • the GAIM-lg fusion protein consists essentially of a sequence at least 95%, 96%, 97%, 98%, or 99% identical to that described by SEQ ID NO:26 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the amino acid sequence of the GAIM portion of the GAIM-lg fusion protein differs from that described by SEQ ID NO: 26 by 10-15, 1 -10, or 1 -5 conservative substitutions.
  • the GAIM-lg fusion protein consists essentially of SEQ ID NO:26 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the GAIM-lg fusion protein consists essentially of the amino acid sequence of SEQ ID NO:36 (PB127).
  • the GAIM-lg fusion protein consists essentially of a variant of SEQ ID NO:36 in which the variant lacks amino acid 1 (DM1 ), amino acids 1 and 2 (DM1 and DA2), amino acid 485 (DK485), amino acids 1 and 485 (DM1 and DK485), or amino acids 1 , 2, and 485 (DM1 , DA2, and DK485).
  • the GAIM portion and Ig portion of the GAIM-lg fusions described herein are connected by a small linker.
  • the small linker is rich in glycine, serine, and/or threonine, comprising at least 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% glycine, serine, and/or threonine.
  • the small linker comprises at least or about 50%, 55%, 60%, 70%, or 75% glycine, serine, and/or threonine.
  • the small linker is comprised
  • a small linker of a GAIM-lg fusion may be up to 25 amino acids in length, for example, from 1 to 5 amino acids in length, from 1 to 20 amino acids in length, from 5 to 10 amino acids in length, from 5 to 25 amino acids in length, or from 10 to 25 amino acids in length. Small linkers may have, for example, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 ,
  • the small linker does not contain a human T-cell epitope or create a human T-cell epitope with either the GAIM variant or Fc domain to which it is bound.
  • Exemplary small linkers include linkers having various numbers of repeats of the sequence GGGGS (4GS; SEQ ID NO:27) or GGGS (3GS; SEQ ID NO:28), such as from 2, 3, 4, to 5 repeats of such a sequence.
  • Exemplary small linkers may include one or more lysine residues.
  • Other exemplary small linkers include the amino acid sequence ARS.
  • the GAIM-lg fusions of the invention address the previously unmet need for a composition that can target a variety of amyloid proteins, as these fusions are capable of engaging various Ab aggregates, even aggregates having different morphologies and aggregation properties.
  • the GAIM-lg fusions disclosed herein bind, among other aggregates, the truncated 11 -42 Ab aggregates and/or post-translationally- modified pyro-glutamate Ab aggregates, both of which are clinically relevant to Alzheimer’s disease.
  • the GAIM-lg fusions of the invention target multiple types of amyloid protein, including but not limited to Ab aggregates, N-terminal truncated Ab aggregates, tau, multiple conformers of transthyretin (TTR), and diverse morphologies of immunoglobulin light chain (LC) aggregates. These targets include amyloid protein found in patients at risk of or suffering from diseases described herein.
  • Antibody-related therapies of the prior art may also fail in the clinic because they fail to block aggregation of phosphorylated tau and/or fail to block tau’s spread from one region of the brain to another.
  • the open-stabilized GAIM-lg fusions of the present invention address this need.
  • the GAIM-lg fusions of the invention cause remodeling of tau, thus preventing tau aggregates from seeding soluble tau and blocking tau aggregate propagation.
  • GAIM-lg fusions disclosed herein present a unique approach to prevent or remove pathological amyloid aggregates.
  • the open-stabilized GAIM fusions described herein show greater potency, structural stability, and specificity to amyloid, including both Ab and tau fibers, and are also either partially or fully deimmunized.
  • Polypeptides of the invention can be synthesized using techniques well known in the art.
  • the polypeptides of the invention can be synthesized recombinantly in cells (see, e.g., Sambrook et al. 1989, Molecular Cloning A Laboratory Manual, Cold Spring Harbor Laboratory, N.Y. and Ausubel et al. 1989, Current Protocols in Molecular Biology, Greene
  • polypeptides of the invention can be synthesized using known synthetic methods such as solid phase synthesis. Synthetic techniques are well known in the art (see, e.g., Merrifield, 1973, Chemical Polypeptides, (Katsoyannis and Panayotis eds.) pp. 335-61 ; Merrifield 1963, J. Am. Chem. Soc. 85:2149; Davis et al. 1985, Biochem. Inti. 10:394; Finn et al. 1976, The Proteins (3d ed.) 2:105; Erikson et al. 1976, The Proteins (3d ed.) 2:257; U.S. Patent No.
  • the final construct may share essentially the same function as a recombinantly produced fusion protein, but simply be produced using non-recombinant techniques, such as ligation chemistry.
  • Components of the fusion proteins may be prepared using the same general methodology described for g3p expression and g3p mutations.
  • the polypeptide may be fused to a marker sequence, such as a peptide that facilitates purification of the fused polypeptide (either alone or in addition to fusion to another protein or incorporation of a carrier molecule).
  • the marker amino acid sequence may be a hexa-histidine peptide (SEQ ID NO:53) such as the tag provided in a pQE vector (Qiagen, Mississauga, Ontario, Canada), among others, many of which are commercially available.
  • a hexa-histidine SEQ ID NO:53
  • hemagglutinin (HA) tag corresponds to an epitope derived from the influenza HA protein. (Wilson et al., (1984) Cell 37:767).
  • the invention provides a pharmaceutical composition comprising any polypeptide comprising a GAIM variant described herein, optionally together with a pharmaceutically acceptable carrier, diluent or excipient.
  • a pharmaceutical composition refers to a therapeutically effective amount of a composition as described herein with a physiologically suitable carrier and/or excipient.
  • a pharmaceutical composition does not cause significant irritation to an organism.
  • physiologically suitable carrier and “pharmaceutically acceptable carrier” may be used interchangeably to refer to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered composition.
  • excipient refers to an inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient.
  • examples include, saline, calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20.
  • compositions for use in accordance with the present invention may be formulated in a conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into compositions which can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen and upon the nature of the composition delivered (e.g., size and solubility of the polypeptide).
  • the pharmaceutical composition is formulated for injection or infusion into the bloodstream of a patient.
  • the pharmaceutical composition is formulated for direct administration to the brain or central nervous system of the patient, for example, by direct intramedullary, intrathecal, or intraventricular injection.
  • compositions described herein may be formulated for parenteral administration, e.g., by bolus injection or continuous infusion.
  • compositions for parenteral administration include aqueous solutions of the composition in water-soluble form. Additionally, suspensions of the active ingredients may be prepared as oily or water-based injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acids esters such as ethyl oleate, triglycerides or liposomes. Aqueous injection suspensions may contain substances, which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol or dextran.
  • the suspension may also contain suitable stabilizers or agents (e.g., surfactants such as polysorbate (Tween 20)) which increase the solubility of the active ingredients to allow for the preparation of highly-concentrated solutions.
  • suitable stabilizers or agents e.g., surfactants such as polysorbate (Tween 20)
  • a protein-based agent such as, for example, albumin may be used to prevent adsorption of polypeptide of the invention to the delivery surface (i.e. , IV bag, catheter, needle, etc.).
  • compositions can be formulated by combining the polypeptides described herein with
  • Formulations may be presented in unit dosage form, e.g., in vials, ampoules or in multidose containers with optionally, an added preservative.
  • the compositions may be suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • Single dosage forms may be in a liquid or a solid form. Single dosage forms may be administered directly to a patient without modification or may be diluted or reconstituted prior to administration.
  • a single dosage form may be administered in bolus form, e.g., single injection, single oral dose, including an oral dose that comprises multiple tablets, capsule, pills, etc.
  • a single dosage form may be administered over a period of time, such as by infusion, or via an implanted pump, such as an ICV pump.
  • the single dosage form may be an infusion bag or pump reservoir pre-filled with the appropriate amount of a polypeptide comprising a GAIM variant.
  • the infusion bag or pump reservoir may be prepared just prior to administration to a patient by mixing an appropriate dose of the polypeptide comprising a GAIM variant with the infusion bag or pump reservoir solution.
  • Another aspect of the invention includes methods for preparing a pharmaceutical composition of the invention.
  • Techniques for formulation of drugs may be found, for example, in "Remington's Pharmaceutical Sciences,” Mack Publishing Co., Easton, Pa., latest edition, which is incorporated herein by reference in its entirety.
  • compositions suitable for use in the context of the present invention include compositions wherein the active ingredients are contained in an amount effective to achieve the intended purpose.
  • Dosage amount and interval may be adjusted individually to provide brain levels of the phage display vehicle which are sufficient to treat or diagnose a particular brain disease, disorder, or condition (minimal effective concentration, MEC).
  • MEC minimum effective concentration
  • the MEC will vary for each preparation but can be estimated from in vitro data. Dosages necessary to achieve the MEC will depend on individual characteristics.
  • Dosage intervals can also be determined using the MEC value. Preparations should be administered using a regimen that maintains brain levels above the MEC for 10-90% of the time, preferably between 30-90% of the time and most preferably 50-90% of the time.
  • dosing can be of a single or a plurality of administrations, with a course of treatment lasting from several days to several weeks or until cure is effected or diminution of the disease state is achieved.
  • compositions to be administered will, of course, be dependent on the subject being treated or diagnosed, the severity of the affliction, the judgment of the prescribing physician, etc.
  • compositions of the present invention may, if desired, be presented in a pack or dispenser device, such as an FDA approved kit, which may contain one or more unit dosage forms containing the active ingredient.
  • the pack may, for example, comprise metal or plastic foil, such as a blister pack.
  • the pack or dispenser device may be accompanied by instructions for
  • the pack or dispenser may also be accommodated by a notice associated with the container in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals, which notice is reflective of approval by the agency of the form of the compositions or human or veterinary administration.
  • a notice associated with the container in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals, which notice is reflective of approval by the agency of the form of the compositions or human or veterinary administration.
  • Such notice for example, may be of labelling approved by the U.S. Food and Drug Administration for prescription drugs or of an approved product insert.
  • Compositions comprising a preparation of the invention formulated in a compatible pharmaceutical carrier may also be prepared, placed in an appropriate container, and labelled for treatment of an indicated disease, as further detailed herein.
  • Another aspect of the invention relates to the use of any of the polypeptides, nucleic acid molecules, or compositions of the invention, in the treatment one or more diseases associated with misfolded and/or aggregated amyloid protein, including, but not limited to, those diseases involving any of: transthyretin, immunoglobulin light chain (kappa or lambda), ⁇ Ab42, fasyn, fNM, or ftau.
  • diseases associated with misfolded and/or aggregated amyloid protein including, but not limited to, those diseases involving any of: transthyretin, immunoglobulin light chain (kappa or lambda), ⁇ Ab42, fasyn, fNM, or ftau.
  • a patient is a human who is positive for a biomarker associated with a protein misfolding disease.
  • the patient exhibits b-amyloid deposits as detected by PET imaging with florbetapir.
  • treating refers to reducing, slowing, or reversing the progression of a disease in a patient exhibiting one or more clinical symptoms of a disease. “Treating” also refers to reducing, slowing, or reversing the symptoms of a disease in a patient exhibiting one more clinical symptoms of a disease.
  • the patient exhibits b-amyloid deposits as detected by PET imaging with florbetapir and the number of b-amyloid deposits is reduced by the treatment.
  • the patient exhibits b-amyloid deposits as detected by the polypeptide or polypeptide compositions of the present invention and the number of b-amyloid deposits are reduced or maintained by the treatment.
  • the patient exhibits any type of amyloid deposits as detected by PET imaging and the cognitive function of the patient is improved by the treatment. Improvement in cognitive function may be assayed by the methods and tests of McKhann et al. , Alzheimer’s & Dementia 7(3):263-9(2011 ).
  • “Prophylaxis” or“prevention” is distinct from treating and refers to administration of a polypeptide, nucleic acid, or composition to an individual before the onset of any clinical symptoms.
  • Prophylaxis using any of the polypeptides, nucleic acids, or compositions thereof of the present invention is encompassed.
  • Prophylaxis may be implicated in individuals who are known to be at increased risk for a disease, or who are certain to develop a disease, solely on the basis of one or more genetic markers. Many genetic markers have been identified for the various protein misfolding diseases. For example, individuals with one or more of the Swedish mutation, Indiana mutation, or London mutation in hAPP are at increased risk for developing early-onset Alzheimer’s Disease and so are candidates for
  • prophylaxis individuals with the trinucleotide CAG repeats in the huntingtin gene, particularly those with 36 or more repeats, will eventually develop Huntington’s Disease and so are candidates for prophylaxis.
  • misfolded and/or aggregated amyloid protein encompass diseases associated with (e.g., caused or correlated at least in part by) misfolded amyloid protein, aggregated amyloid protein, or both misfolded and aggregated amyloid protein.
  • diseases associated with e.g., caused or correlated at least in part by
  • misfolded amyloid protein e.g., caused or correlated at least in part by
  • aggregated amyloid protein e.g., aggregated amyloid protein
  • aggregated amyloid protein e.g., aggregated amyloid protein.
  • Peptides or proteins that may form amyloid are described above.
  • amyloid is formed by Ab, including but not limited to Ab40, Ab42, N-truncated Ab11 -42, Ab11-42-Pyro, Ab3-42 ⁇ G0, Ab1 -42-E220- ⁇ u ⁇ o ⁇ mutation, or a combination thereof.
  • amyloid is formed a prion protein, e.g., PrP Sc .
  • amyloid is formed by transthyretin.
  • amyloid is formed by immunoglobulin light chain, for example immunoglobulin kappa light chain and/or immunoglobulin lambda light chain.
  • amyloid is formed by tau.
  • amyloid is formed by a-synuclein.
  • misfolded and/or aggregated amyloid protein are described above. Many of the above misfolded and/or aggregated amyloid protein diseases occur in the central nervous system (CNS).
  • CNS central nervous system
  • diseases occurring in the CNS are Parkinson’s Disease; Alzheimer’s Disease; frontotemporal dementia (FTD) including those patients having the following clinical syndromes: behavioral variant FTD
  • bvFTD progressive non-fluent aphasia
  • SD semantic dementia
  • FTLDs frontotemporal lobar degenerations
  • Fluntington’s Disease The polypeptides, nucleic acids, and compositions of the invention may be used to treat diseases characterized by misfolded and/or aggregated amyloid protein that occur in the central nervous system (CNS).
  • CNS central nervous system
  • AA Amyloidosis A
  • SAA serum acute phase apolipoprotein
  • myeloma precursor proteins immunoglobulin light and/or heavy chain
  • amyloid formed by a2-microglobulin, transthyretin (e.g., FAP, FAC, SSA), (apo)serum AA, apolipoproteins Al, All, and AIV, gelsolin (e.g., Finnish form of FAP), immunoglobulin light chain (kappa or lambda), lysozyme, fibrinogen, cystatin C (e.g., Cerebral Amyloid Angiopathy, Flereditary Cerebral Flemorrhage with Amyloidosis, Icelandic Type), calcitonin, procalcitonin, islet amyloid polypeptide (e.g., IAPP amyloidosis), atrial natriuretic factor, prolactin, insulin, lactahedrin, kerato-epithelin, lactoferrin, odontogenic ameloblast-associated protein, and semenogelin I.
  • tauopathies are microtubule-associated proteins expressed in axons of both central and peripheral nervous system neurons.
  • Neurodegenerative tauopathies (sometimes referred to as tauopathies) are encompassed. Examples of tauopathies include Alzheimer’s Disease, Amyotrophic lateral sclerosis/parkinsonism-dementia complex,
  • Argyrophilic grain dementia Corticobasal degeneration, Creutzfeldt-Jakob disease, Dementia pugilistica, diffuse neurofibrillary tangles with calcification, Down’s syndrome
  • Frontotemporal dementias including frontotemporal dementia with parkinsonism linked to chromosome 17, Gerstmann-Straussler-Scheinker disease, Hallervorden-Spatz disease, Myotonic dystrophy, Niemann-Pick disease type C, Non-Guamanian motor neuron disease with neurofibrillary tangles, Pick’s disease, Postencephalitic parkinsonism, Prion protein cerebral amyloid angiopathy, Progressive subcortical gliosis, Progressive supranuclear palsy, Subacute sclerosing panencephalitis, and Tangle only dementia.
  • Some of these diseases may also include deposits of fibrillar amyloid b peptides.
  • Alzheimer’s disease exhibits both amyloid b deposits and tau lesions.
  • prion-mediated diseases such as Creutzfeldt-Jakob disease, prion protein cerebral amyloid angiopathy, and Gerstmann-Straussler-Scheinker syndrome may have also have tau lesions.
  • an indication that a disease is a“tauopathy” should not be interpreted as excluding the disease from other neurodegenerative or misfolded and/or aggregated amyloid protein disease classifications or groupings, which are provided merely as a convenience.
  • the polypeptides and compositions of the invention may be used to treat
  • composition, or formulation is for use in a method of reducing amyloid in a patient exhibiting symptoms related to the presence of amyloid or that is positive for a biomarker associated with a protein misfolding disease, comprising administering to the patient an effective amount of a pharmaceutical composition or formulation as described herein.
  • a polypeptide, pharmaceutical composition, or formulation is for use in a method of maintaining the level of amyloid in a patient exhibiting symptoms related to the presence of amyloid or that is positive for a biomarker associated with a protein misfolding disease, comprising administering to the patient an effective amount of a pharmaceutical composition or formulation as described herein.
  • the biomarker is b-amyloid, which can be detected with the radiopharmaceutical agent florbetapir (AV-45, Eli Lilly).
  • the route of administration is intrathecal injection or infusion, direct intraventricular injection or infusion, intraparenchymal injection or infusion, or intravenous injection or infusion.
  • a polypeptide, pharmaceutically acceptable salt, or pharmaceutically acceptable salt thereof [0160] In some embodiments, a polypeptide, pharmaceutically acceptable salt thereof.
  • composition, or formulation is for use in a method of disaggregating or remodeling amyloid in a patient.
  • a polypeptide, pharmaceutical composition, or formulation is for use in a method of reducing amyloid formation in the brain.
  • a polypeptide, pharmaceutical composition, or formulation of the invention is for use in a method for promoting amyloid clearance in the brain.
  • a polypeptide, pharmaceutical composition, or formulation of the invention is for use in a method for inhibiting amyloid aggregation in the brain.
  • a polypeptide, pharmaceutical composition, or formulation of the invention is for use in a method for clearing toxic oligomers in the brain.
  • a polypeptide, pharmaceutical composition, or formulation of the invention is for use in a method for preventing the formation of toxic oligomers in the brain.
  • a polypeptide, pharmaceutical composition, or formulation of the invention is for use in method for protecting neurons from amyloid damage.
  • a polypeptide, pharmaceutical composition, or formulation is for use in a method of reducing cell-to-cell propagation of a-synuclein aggregates. In some embodiments, a polypeptide, pharmaceutical composition, or formulation is for use in a method of blocking cell-to-cell propagation of a-synuclein aggregates. In some aspects of these embodiments, the polypeptide, pharmaceutical composition, or formulation is administered to a patient in need thereof by intrathecal injection or infusion, direct intraventricular injection or infusion, intraparenchymal injection or infusion, or intravenous injection or infusion.
  • a polypeptide, pharmaceutically acceptable salt, or administrados in a form comprising: (a) aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe, pharmaceutically acceptable salt, or a pharmaceutically acceptable salt.
  • composition, or formulation of the invention is for use in a method of causing disaggregation of Ab-amyloid deposits in the brain, comprising injecting directly into the brain of a patient in need thereof an effective amount of the polypeptide, pharmaceutical composition, or formulation, thus causing a reduction in Ab- amyloid deposits in the brain.
  • a polypeptide In other embodiments, a polypeptide,
  • composition, or formulation of the invention is for use in a method of causing disaggregation of Ab-amyloid deposits in the brain, comprising injecting by intravenous delivery into a patient in need thereof an effective amount of the polypeptide, pharmaceutical composition, or formulation, thus causing a reduction in Ab-amyloid deposits in the brain.
  • a pharmaceutical composition or formulation of the invention for use in protecting neurons from amyloid damage is given prophylactically.
  • the patient is positive for a biomarker associated with a protein misfolding and/or aggregation disease.
  • the biomarker is b-amyloid and the agent used to detect b-amyloid is florbetapir (AV45, Eli Lilly).
  • a polypeptide, pharmaceutical composition, or formulation of the invention is for use in a method of remodeling amyloid.
  • the route of administration is intrathecal injection or infusion, direct intraventricular injection or infusion, intraparenchymal injection or infusion, or intravenous injection or infusion.
  • the polypeptides disclosed herein bind to amyloid at least as effectively as M13 phage, g3p, or a variant or fusion protein of g3p disclosed in the prior art. In some embodiments, the polypeptides disclosed herein bind to amyloid more effectively than M13 phage, g3p, or a variant or fusion protein of g3p disclosed in the prior art. In some embodiments, the polypeptides disclosed herein remodel amyloid more effectively than do M13 phage, g3p, or a variant or fusion protein of g3p disclosed in the prior art. In some embodiments, the polypeptides disclosed herein inhibit amyloid
  • the polypeptides disclosed herein clear toxic oligomers more effectively than do M13 phage, g3p, or a variant or fusion protein of g3p disclosed in the prior art. In some embodiments, the polypeptides disclosed herein clear toxic oligomers more effectively than do M13 phage, g3p, or a variant or fusion protein of g3p disclosed in the prior art. In some
  • the polypeptides disclosed herein reduce cell-to-cell propagation of a-synuclein aggregates more effectively than do M13 phage, g3p, or a variant or fusion protein of g3p disclosed in the prior art. In some embodiments, the polypeptides disclosed herein detect amyloid more effectively than do M13 phage, g3p, or a variant or fusion protein of g3p disclosed in the prior art. In some embodiments, the polypeptides disclosed herein prevent a disease associated with misfolded and/or aggregated amyloid protein more effectively than do M13 phage, g3p, or a variant or fusion protein of g3p disclosed in the prior art.
  • the polypeptides disclosed herein treat a disease associated with misfolded and/or aggregated amyloid protein more effectively than do M13 phage, g3p, or a variant or fusion protein of g3p disclosed in the prior art. In some embodiments, the polypeptides disclosed herein elicit a smaller immune response in a patient as compared to M13 phage, g3p, or a variant or fusion protein of g3p disclosed in the prior art. In at least one embodiment, the polypeptides disclosed herein do not elicit an immune response in a patient.
  • any of the diseases described above may be treated by administration of a nucleic acid molecule of the invention (i.e. , encoding a polypeptide comprising a GAIM variant that exhibits reduced or no immunogenicity and that possesses the ability to bind amyloid,
  • nucleic acid molecule encoding the polypeptide comprising a GAIM variant may be DNA or RNA.
  • Diagnostic compositions are encompassed by the present invention and may comprise any of the above-described polypeptides of the invention (e.g., a polypeptide comprising a GAIM variant, such as a polypeptide comprising a GAIM-lg fusion.
  • a polypeptide comprising a GAIM variant such as a polypeptide comprising a GAIM-lg fusion.
  • the polypeptides, pharmaceutical compositions, and formulations described herein are used in diagnostic applications associated with the various diseases described herein.
  • binding of a polypeptide of the invention to amyloid protein may be used to detect the bound amyloid protein.
  • binding of a polypeptide of the invention when used as an imaging agent in vivo or in vitro may be part of a diagnosis of a protein-misfolding, protein-aggregation, or neurodegenerative disease described herein.
  • a polypeptide described herein is used as an amyloid-imaging agent, wherein the imaging agent can detect amyloid protein and diagnose a disease associated with misfolded and/or aggregated amyloid protein. Because the polypeptides described herein bind amyloid irrespective of the type of fiber, they can image and detect any amyloid aggregate (Ab, tau, a- synuclein, transthyretin, immunoglobulin light chain, etc.) and may diagnose a wide range of amyloid-associated diseases and conditions. In some
  • the polypeptide used as an amyloid-imaging agent further comprises a detectable label.
  • Various labels can be attached to a polypeptide comprising a GAIM variant as described herein using standard techniques for labeling proteins.
  • labels include fluorescent labels and radiolabels.
  • radiolabels There are a wide variety of radiolabels that can be used, but in general the label is often selected from radiolabels including, but not limited to, 18 F, 11 C, and 123 l.
  • radioisotopes can be attached to the protein using well known chemistry.
  • the label is detected using positron emission tomography (PET).
  • PET positron emission tomography
  • any other suitable technique for detection of radioisotopes may also be used to detect the radiotracer.
  • the polypeptides and compositions of the invention may be used as diagnostic imaging agents in combination with an imaging agent that is specific for b-amyloid such as, for example, F18-AV-45, Eli Lilly. Because the use of a diagnostic composition of the invention together with a b-amyloid- specific imaging agent will result in the detection of hoh-b-amyloid aggregates based on differential detection, in one embodiment, a diagnostic composition of the invention is used as an imaging agent in combination with a b-amyloid imaging agent to detect hoh-b-amyloid aggregates.
  • an imaging agent that is specific for b-amyloid such as, for example, F18-AV-45, Eli Lilly. Because the use of a diagnostic composition of the invention together with a b-amyloid- specific imaging agent will result in the detection of hoh-b-amyloid aggregates based on differential detection, in one embodiment, a diagnostic composition of the invention is used as an imaging agent in combination with a b-amyloid imaging agent to detect hoh
  • polypeptides described herein, or compositions thereof are used to detect b-amyloid in the CNS, including the brain.
  • Diagnostic compositions of the invention may be administered using the same routes described for therapeutic compositions.
  • the route of administration is intrathecal injection or infusion, direct intraventricular injection or infusion, intraparenchymal injection or infusion, or intravenous injection or infusion.
  • the present invention relates to oligonucleotides comprising a nucleic acid sequence that encodes a polypeptide of the invention.
  • the present invention relates to a nucleic acid sequence encoding polypeptides comprising a GAIM variant, including polypeptides comprising a GAIM variant attached directly or through a small linker to an immunoglobulin constant region, as disclosed herein.
  • nucleic acids encoding a polypeptide comprising a GAIM variant or GAIM-lg fusion are prepared using conventional recombinant DNA techniques, such as cloning of mutant GAIM domains, direct DNA synthesis, or by isolating the corresponding DNA from a library using, for example, the M13 sequence as a probe. See, e.g., Sambrook et al. 1989, Molecular Cloning A Laboratory Manual, Cold Spring Harbor
  • Nucleic acids encoding a polypeptide comprising a GAIM variant or GAIM-lg fusion may also be prepared as provided in the Examples below.
  • any of the nucleic acid sequences of the invention may be inserted into an appropriate expression vector which contains the necessary elements for the transcription and translation of the inserted coding sequence, or in the case of an RNA viral vector, the necessary elements for replication and translation.
  • the encoding nucleic acid is inserted into the vector in proper reading frame.
  • the invention provides vectors comprising nucleic acids of the invention.
  • vectors include, but are not limited to, DNA vectors, phage vectors, viral vectors, retroviral vectors, etc.
  • Vectors may include, for example, baculovirus, cauliflower mosaic virus, tobacco mosaic virus, Ri plasmid, or Ti plasmid.
  • nucleic acids of the invention may be made by those of skill in the art using well-known knowledge of the compatibility of the vector with the chosen host cell in which to carry out expression. This may be done in any of mammalian cells, plant cells, insect cells, bacterial cells, fungal cells, transgenic animal cells, etc. Exemplary mammalian cells suitable for producing
  • polypeptides described herein include but are not limited to HEK293 cells, HEK293-derived cells, CHO cells, CHO-derived cells, HeLa cells, and COS cells.
  • Exemplary bacterial cells include but are not limited to E. coli cells.
  • Exemplary plant cells include but are not limited to duckweed cells. See, e.g., U.S. Patent 8,022,270. Appropriate vectors for each of these cell types are well-known in the art and are generally commercially available. Nonlimiting exemplary transfection methods are described in Sambrook et al. , Molecular Cloning, A Laboratory
  • Nucleic acids may be transiently or stably transfected in the desired host cells according to methods known in the art.
  • the nucleic acid encodes a
  • nucleic acid encodes a polypeptide comprising the amino acid sequence of SEQ ID NO: 19. In at least one embodiment, the nucleic acid encodes a polypeptide comprising the amino acid sequence of SEQ ID NO:20. In at least one embodiment, the nucleic acid encodes a polypeptide comprising the amino acid sequence of SEQ ID NO:21.
  • the nucleic acid encodes a polypeptide comprising the amino acid sequence of SEQ ID NO:22. In at least one embodiment, the nucleic acid encodes a polypeptide comprising the amino acid sequence of SEQ ID NO:23. In at least one embodiment, the nucleic acid encodes a polypeptide comprising the amino acid sequence of SEQ ID NO:24. In at least one embodiment, the nucleic acid encodes a polypeptide comprising the amino acid sequence of SEQ ID NO:25. In at least one embodiment, the nucleic acid encodes a polypeptide comprising the amino acid sequence of SEQ ID NO:26.
  • the nucleic acid encodes a
  • the nucleic acid encodes a polypeptide consisting essentially of SEQ ID NO: 19 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the nucleic acid encodes a polypeptide consisting essentially of SEQ ID NO:20 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the nucleic acid encodes a polypeptide consisting essentially of SEQ ID NO:21 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the nucleic acid encodes a polypeptide consisting essentially of SEQ ID NO:22 and the Fc portion of a human IgG (e.g., human lgG1 ). In at least one
  • the nucleic acid encodes a polypeptide consisting essentially of SEQ ID NO:23 and the Fc portion of a human IgG (e.g., human lgG1 ). In at least one embodiment, the nucleic acid encodes a polypeptide consisting essentially of SEQ ID NO:24 and the Fc portion of a human IgG (e.g., human lgG1 ). In at least one embodiment, the nucleic acid encodes a polypeptide consisting essentially of SEQ ID NO:25 and the Fc portion of a human IgG (e.g., human lgG1 ). In at least one embodiment, the nucleic acid encodes a polypeptide consisting essentially of SEQ ID NO:26 and the Fc portion of a human IgG (e.g., human lgG1 ).
  • the nucleic acid encodes a polypeptide consisting essentially of the amino acid sequence of SEQ ID NO:29 (PB108). In some embodiments, the nucleic acid encodes a polypeptide consisting essentially of the amino acid sequence of SEQ ID NO:30 (PB122). In some embodiments, the nucleic acid encodes a polypeptide consisting essentially of the amino acid sequence of SEQ ID NO:31 (PB116). In some embodiments, the nucleic acid encodes a polypeptide consisting essentially of the amino acid sequence of SEQ ID NO:32 (PB114). In some embodiments, the nucleic acid encodes a polypeptide consisting essentially of the amino acid sequence of SEQ ID NO:33 (PB109).
  • the nucleic acid encodes a polypeptide consisting essentially of the amino acid sequence of SEQ ID NO:34 (PB110). In some embodiments, the nucleic acid encodes a polypeptide consisting essentially of the amino acid sequence of SEQ ID NO:35 (PB105). In some embodiments, the nucleic acid encodes a polypeptide consisting essentially of the amino acid sequence of SEQ ID NO:36 (PB127). As described above, these embodiments encompass a nucleic acid encoding a variant of SEQ ID NO:34 (PB110). In some embodiments, the nucleic acid encodes a polypeptide consisting essentially of the amino acid sequence of SEQ ID NO:35 (PB105). In some embodiments, the nucleic acid encodes a polypeptide consisting essentially of the amino acid sequence of SEQ ID NO:36 (PB127). As described above, these embodiments encompass a nucleic acid encoding a variant of SEQ ID NO:34 (PB110). In some embodiments, the nucleic acid encodes
  • variant lacks amino acid 1 (DM1 ), amino acids 1 and 2 (DM1 and DA2), amino acid 485 (DK485), amino acids 1 and 485 (DM1 and DK485), or amino acids 1 , 2, and 485 (DM1 , DA2, and DK485).
  • the nucleic acid encoding a polypeptide of the invention comprises SEQ ID NO:37. In some embodiments, the nucleic acid comprises SEQ ID NO:38. In some embodiments, the nucleic acid comprises SEQ ID NO:39. In some embodiments, the nucleic acid comprises SEQ ID NO:40. In some embodiments, the nucleic acid comprises SEQ ID NO:41. In some embodiments, the nucleic acid comprises SEQ ID NO:42. In some embodiments, the nucleic acid comprises SEQ ID NO:43. In some
  • the nucleic acid comprises SEQ ID NO:44. In some embodiments, the nucleic acid comprises SEQ ID NO:44.
  • nucleic acid comprising any of SEQ ID Nos: 37, 38, 39, 40,
  • nucleic acid 41 , 42, 43, or 44 further comprises a nucleic acid encoding the Fc portion of IgG (e.g., human lgG1 or lgG2).
  • the nucleic acid encoding an open-stabilized GAIM variant and the nucleic acid encoding the Fc portion of IgG are connected by a nucleic acid encoding a small linker.
  • the nucleic acid encodes the small linker ARS.
  • nucleic acid further encodes a signal sequence.
  • nucleic acid further encodes a signal sequence having the 18- amino acid N-terminal sequence of GenBank Ref Seq NP_510891.1.
  • the nucleic acid encoding a polypeptide of the invention is SEQ ID NO:45. In at least one embodiment, the nucleic acid is SEQ ID NO:46. In at least one embodiment, the nucleic acid is
  • nucleic acid is SEQ ID NO:48.
  • the nucleic acid is SEQ ID NO:49. In at least one embodiment, the nucleic acid is SEQ ID NO:50. In at least one embodiment, the nucleic acid is SEQ ID NO:51. In at least one embodiment, the nucleic acid is SEQ ID NO:52.
  • Vectors used in transformation will usually contain a selectable marker used to identify transformants. In bacterial systems, this can include an antibiotic resistance gene such as ampicillin or kanamycin. Selectable markers for use in cultured mammalian cells include genes that confer resistance to drugs, such as neomycin, hygromycin, and methotrexate.
  • the selectable marker may be an amplifiable selectable marker.
  • One amplifiable selectable marker is the DHFR gene.
  • Another amplifiable marker is the DHFRr eDNA (Simonsen and Levinson, PNAS (1983) 80:2495). Selectable markers are reviewed by Thilly (Mammalian Cell Technology, Butterworth Publishers, Stoneham, MA) and the choice of selectable markers is well within the level of ordinary skill in the art.
  • the expression elements of the expression systems vary in their strength and specificities.
  • any of many suitable transcription and translation elements including constitutive and inducible promoters, may be used in the expression vector.
  • inducible promoters such as pL of bacteriophage l, plac, ptrp, ptac (ptrp-lac hybrid promoter), and the like may be used;
  • promoters such as the baculovirus polyhedron promoter may be used;
  • promoters derived from the genome of plant cells e.g., heat shock promoters; the promoter for the small subunit of RUBISCO; the promoter for the chlorophyll a/b binding protein
  • plant viruses e.g., the 35S RNA promoter of CaMV; the coat protein promoter of
  • TMV may be used; when cloning in mammalian cell systems, promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses (e.g., the adenovirus late promoter; the vaccinia virus 7.5 K promoter) may be used; when generating cell lines that contain multiple copies of expression product, SV40-, BPV- and EBV-based vectors may be used with an appropriate selectable marker. In cases where plant expression vectors are used, the expression of sequences encoding linear or non-cyclized forms of the expression product of the invention may be driven by any of a number of promoters.
  • promoters derived from the genome of mammalian cells e.g., metallothionein promoter
  • mammalian viruses e.g., the adenovirus late promoter; the vaccinia virus 7.5 K promoter
  • SV40-, BPV- and EBV-based vectors
  • viral promoters such as the 35S RNA and 19S RNA promoters of CaMV (Brisson et al. , Nature (1984) 31 0:511 -514), or the coat protein promoter of TMV (Takamatsu et al., EMBO J (1987) 3:17-311 ) may be used; alternatively, plant promoters such as the small subunit of RUBISCO (Coruzzi et al., EMBO J.
  • Autographa californica nuclear polyhidrosis virus (AcNPV) is used as a vector to express the foreign genes.
  • the virus grows in Spodoptera frugiperda cells.
  • a coding sequence may be cloned into non-essential regions (for example, the polyhedron gene) of the virus and placed under control of an AcNPV promoter (for example, the polyhedron promoter).
  • Successful insertion of a coding sequence results in inactivation of the polyhedron gene and production of non- occluded recombinant virus, i.e. virus lacking the proteinaceous coat coded for by the polyhedron gene.
  • These recombinant viruses are used to infect
  • Spodoptera frugiperda cells in which the inserted gene is expressed. See, e.g., Smith et al., J. Viral. (1983) 46:584; U.S. Patent No. 4,215,051. Further examples of this expression system may be found in Ausubel et al. , eds. 1989, Current Protocols in Molecular Biology, Vol. 2, Greene Publish. Assoc. & Wiley Interscience.
  • any of several viral based expression systems may be used.
  • a coding sequence may be ligated to an adenovirus
  • transcription/translation control complex e.g., the late promoter and tripartite leader sequence.
  • This fusion gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination. Insertion in a non-essential region of the viral genome (e.g., region E1 or E3) will result in a recombinant virus that is viable and capable of expressing peptide in infected hosts (see, e.g., Logan & Shenk, PNAS (1984) 81 :3655).
  • the vaccinia 7.5 K promoter may be used (see, e.g., Mackett et al., PNAS (1982) 79:7415; Mackett et al., J. Viral. (1984) 49:857; Panicali et al., PNAS (1982) 79:4927).
  • Other viral expression systems include adeno-associated virus and lentiviruses.
  • the invention provides a host cell harboring the vector containing a nucleic acid of the invention.
  • Methods of transfecting or transforming or otherwise getting a vector of the invention into a host cell are known in the art.
  • a cell harboring the vector when cultured under appropriate conditions, will produce the polypeptides of the invention.
  • suitable host cells include but are not limited to mammalian cells, transgenic animal cells, plant cells, insect cells, bacterial cells, and fungal cells.
  • suitable host cells include but are not limited to HEK293 cells, HEK293-derived cells, CHO cells, CHO-derived cells, HeLa cells, and COS cells.
  • Host cells comprising nucleic acid constructs (e.g., vectors) are grown in an appropriate growth medium.
  • appropriate growth medium means a medium having nutrients required for the growth of cells.
  • the recombinantly-produced polypeptides of the invention can be isolated from the culture media using techniques known in the art.
  • GAIM-lg fusion proteins were expressed using the Expi293TM Expression System (Thermo Fisher Scientific) according to manufacturer’s instructions. Purification of the proteins was performed on HiT rap® MabSelectTM SuReTM column (GE Flealthcare Lifesciences) in 20 mM sodium phosphate, pH 7.0 followed by a gradient elution in 20 mM sodium acetate from pH 4.0 to pH 3.6 over 20 CV using AKTATM Pure FPLC system. Fusion proteins were dialyzed into D-PBS pH 7 and filter sterilized (Ultrafree®-MC spin columns, Millipore). Protein purity was analyzed by NuPAGETM 4-12% Bis-Tris gel system with MES SDS Running Buffer (Thermo Fisher Scientific) followed by InstantBlueTM
  • GAIM dimers were generated from the GAIM-lg fusions using the FabRICATOR® (IdeS) enzyme (Genovis), which specifically clips the fusion at the immunoglobulin hinge to yield GAIM dimers linked by two disulfide bonds (Fig. 1 C), for 2 hours at 37°C. Cleavage was followed by separation from Fc by CaptoTM Adhere according to the manufacturer’s protocol. Purity of GAIM dimer was confirmed on a NuPAGETM 4-12% Bis-Tris gel system separated in MES SDS Running Buffer. GAIM dimer (0.5 pM) was incubated for 2 hours at 25°C in 100 mM potassium phosphate, pH 7.0 with increasing concentrations of
  • a SYPRO® Orange binding assay was carried out to monitor GAIM domain separation and stability of the N2 domain.
  • SYPRO® Orange binds poorly to the closed conformation of folded GAIM in an aqueous solution.
  • the dye binds to the exposed hydrophobic surfaces and shows increased fluorescence.
  • One micromolar GAIM-lg fusion in PBS was mixed with x20 excess of SYPRO® Orange (Invitrogen cat. no. S-6650) in a 96-well plate and sealed.
  • Thermal unfolding was monitored in a Roche LightCycler® 480 RT-PCR by continuous increase in temperature from 20°C to 95°C at a rate of 0.24°C/minute.
  • Excitation was set to 465 nm and emission at 580 nm with melt factor at 1 , quant factor at 10 and maximum integration time for two seconds.
  • the arbitrary unit of fluorescent signal was recorded and normalized to a scale of 0-100 (Layton and Hellinga, 2011 ).
  • the Trp fluorescence was red-shifted by 15 nm (Amax 360 nm) and the fluorescence intensity was significantly higher than both 0 and 2 M samples.
  • GAIM dimers were then excited at 280 nm (Trp and Tyr residues) and the fluorescence emission spectra was recorded (Fig. 5B).
  • the fluorescence emission intensity at 340 nm decreased between 0 and 2 M GuHCI and then increased by a similar margin at 5 M GuHCI.
  • Similar spectral changes were also observed in g3p (Martin and Schmid, 2003, J Mol Biol, 328:863-75), indicating that GAIM in the GAIM-lg fusion variants retained the native conformational stability of GAIM in native g3p.
  • EGDS (SEQ ID NO:4) from the filamentous phage IF1 and tested in combination with N2-stabilizing mutations (e.g., at one or more turns/loops indicated in Fig.
  • pyro-glu 3-42 forms fibers that have several bends in their structure
  • E22Q variant forms smooth long fibers
  • 11 -42 peptides form several short fibers.
  • Both the open-stabilized variant PB108 and the scaffold PB120 were found to engage these fibers by ELISA.
  • PB108 showed ⁇ 20-fold improved binding to the various aggregates compared to PB120, ECso 0.9-1.9 nM (Figs. 8A-8D).
  • superior binding was observed for the other tested open- stabilized GAIM-lg fusions (Table 2).
  • Tables 2 and 3 show binding of open-stabilized GAIM-lg fusions to Ab42 and to tauKL with low nanomolar affinity
  • Table 3 further demonstrates their binding to morphologically-diverse immunoglobulin light chain (LC) and transthyretin (TTR) aggregates with low nanomolar affinity.
  • LC morphologically-diverse immunoglobulin light chain
  • TTR transthyretin
  • Remodeling assays were carried out in low retention microfuge tubes (Fisher Scientific 02-681 -320). Buffers used in these assays contain 0.05% sodium azide to prevent microbial growth. To make sure there was no protease contamination in any sample, all remodeled complexes were run on an SDS- PAGE gel and checked for any degradation. For assays using ⁇ 1 mM fibers, protein quality was instead confirmed using western blot analysis.
  • Ab42 fibers (2.5 pM) were co-incubated with or without GAIM-lg fusion variants for three days at 37°C. Aliquots of the complexes were then incubated with varying concentrations of urea. The ThT fluorescence of the complexes in urea was plotted against the urea concentration. Remodeling efficiency at a fixed urea concentration was plotted as percent loss in ThT fluorescence compared to fibers without any GAIM-lg fusion treatment.
  • FIG. 10A shows remodeling efficiencies of different GAIM fusions incubated with Ab42 fibers under identical conditions and concentrations. Open-stabilized variants with low nanomolar ⁇ Ab42 binding showed a 2-fold to 3-fold increase in remodeling activity, with an average remodeling activity of 83% compared to the control scaffold (35%).
  • Fig. 10B reveals a positive correlation between altered fAp42-binding and remodeling activity, such that GAIM-lg fusions with superior Ab binding also exhibit superior remodeling activity.
  • Figs. 10A-10C as well as transmission electron microscopy data ( see Example 13; Fig. 10D), further demonstrate that open-stabilized GAIM-lg fusions remodel amyloid fibers to cause a loss of fibrillar architecture, as opposed to merely sticking to and masking fibrillar structures.
  • open-stabilized GAIM-lg fusions remodel amyloid fibers to cause a loss of fibrillar architecture, as opposed to merely sticking to and masking fibrillar structures.
  • Fig. 10C shows that when incubated in increasing concentrations of urea but without exposure to a GAIM-lg fusion, Ab42 fibers resisted denaturation and showed less than 10% structural change in 1 M urea as measured by ThT fluorescence (Fig. 10C). In higher urea concentrations, ThT fluorescence dropped dramatically, suggesting loss of fibrillar structure.
  • Remodeling assays were also performed by co-incubating Tau- K18P301 L fibers with GAIM-lg fusions to demonstrate that remodeling of aggregates is generic to amyloid protein.
  • Remodeling assays were carried out in low retention microfuge tubes (Fisher Scientific 02-681 -320). Buffers used in these assays contain 0.05% sodium azide to prevent microbial growth. To make sure there was no protease contamination in any sample, all remodeled complexes were run on an SDS- PAGE gel and checked for any degradation. For assays using ⁇ 1 mM fibers, protein quality was instead confirmed using western blot analysis.
  • Tau-k18P301 L fibers readily dissolve in low concentration urea solutions.
  • the remodeling efficiencies of GAIM-lg fusions against Tau-K18P301 L was investigated using sarkosyl solubility assays.
  • TauK18P301 L fibers (1 pM) were co-incubated with or without GAIM-lg-fusion variants at 37°C for 5 days. Fibers and the complexes were incubated with or without 1 % sarkosyl for 15 minutes and spun down at 100,000 g for 30 minutes. The supernatant from each sample was carefully removed and loaded on a 4- 12% NuPAGE® gels (Invitrogen). Proteins were transferred to a Nitrocellulose membrane and probed for TauK18P301 L. The percent remodeling was calculated by quantifying the gel bands using a Biorad ChemidocTM system.
  • PB1 13 The remodeling efficiency of PB120 were compared with the remodeling efficiencies of open-stabilized GAIM IgG fusions.
  • PB1 13 a super- stabilized, disulfide-free GAIM with reduced infectivity (Kather et al. , 2005, J Mol Biol, 354:666-78) has no binding activity to Ab1 -42 or Tau-K18P301 L fibers (data not shown) and was added as a negative control.
  • the open-stabilized GAIM-lg fusion proteins showed enhanced remodeling activities as compared to PB120 (Fig. 11 B), whereas PB113 had no remodeling activity (Fig. 11A).
  • Ab1 -42 fibers (15 pi of 20 mM sample) were applied on carbon coated copper grids (TedPella cat#01844-F). Samples were then washed gently with 0.5 ml water, inverted and floated over a drop of 2% uranyl acetate solution. After 30 seconds, the grids were removed and dried by wicking out the excess liquid from the edge of the grids using a filter paper. FEI TecnaiTM Spirit TEM was used to image the fibers.
  • Fig. 10D shows a representative TEM images of Ab42 fibers incubated with sub-stoichiometric open-stabilized GAIM-lg fusion.
  • FIG. 12A The open-stabilized fusions further showed increased assembly inhibition activity compared to the control scaffold, PB120 (Figs. 12A-12B). For example, at 250 nM, representative open-stabilized GAIM-lg fusions PB108 and
  • PB116 showed a 40-20% increase in blocking fiber formation compared to
  • PB120 (Fig. 12B).
  • the ability of sub-stoichiometric amounts of open-stabilized GAIM-lg fusions to potently block amyloid fibril formation suggests that the fusions block amyloid fiber formation by binding to core b strands in the growing fiber or seeds involved in nucleation dependent fiber assembly (Krishnan et al. (2014) J Mol Biol, 426:2500-19).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Virology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
PCT/US2019/037179 2018-06-15 2019-06-14 General amyloid interaction motif (gaim) Ceased WO2019241628A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
EP23188404.0A EP4389154A3 (en) 2018-06-15 2019-06-14 General amyloid interaction motif (gaim)
EP19739769.8A EP3806884B1 (en) 2018-06-15 2019-06-14 General amyloid interaction motif (gaim)
JP2020569166A JP7549536B2 (ja) 2018-06-15 2019-06-14 全般的アミロイド相互作用モチーフ(gaim)
CA3102841A CA3102841C (en) 2018-06-15 2019-06-14 General amyloid interaction motif (gaim)
AU2019287623A AU2019287623B2 (en) 2018-06-15 2019-06-14 General amyloid interaction motif (GAIM)
MX2020013525A MX2020013525A (es) 2018-06-15 2019-06-14 Motivo de interaccion amiloide general.
SG11202012091WA SG11202012091WA (en) 2018-06-15 2019-06-14 General amyloid interaction motif (gaim)
CN201980049538.2A CN112672755A (zh) 2018-06-15 2019-06-14 通用淀粉样蛋白相互作用基序(gaim)
PL19739769.8T PL3806884T3 (pl) 2018-06-15 2019-06-14 Ogólny motyw oddziaływania z amyloidem (gaim)
ES19739769T ES2960493T3 (es) 2018-06-15 2019-06-14 Motivo de interacción amiloide general (GAIM)
EA202190048A EA202190048A1 (ru) 2018-10-23 2019-06-14 Общий амилоид-взаимодействующий мотив (gaim)
US17/251,351 US11692017B2 (en) 2018-06-15 2019-06-14 General amyloid interaction motif (GAIM)
BR112020025111-9A BR112020025111A2 (pt) 2018-06-15 2019-06-14 Motivo de interação amiloide geral (gaim)
IL279333A IL279333B2 (en) 2018-06-15 2020-12-09 General amyloid interaction motif (gaim)
ZA2021/00071A ZA202100071B (en) 2018-06-15 2021-01-05 General amyloid interaction motif (gaim)
US18/320,697 US12247055B2 (en) 2018-06-15 2023-05-19 General amyloid interaction motif (GAIM)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201862685757P 2018-06-15 2018-06-15
US62/685,757 2018-06-15
US201862749499P 2018-10-23 2018-10-23
US62/749,499 2018-10-23

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US17/251,351 A-371-Of-International US11692017B2 (en) 2018-06-15 2019-06-14 General amyloid interaction motif (GAIM)
EP23188404.0A Previously-Filed-Application EP4389154A3 (en) 2018-06-15 2019-06-14 General amyloid interaction motif (gaim)
US18/320,697 Continuation US12247055B2 (en) 2018-06-15 2023-05-19 General amyloid interaction motif (GAIM)

Publications (1)

Publication Number Publication Date
WO2019241628A1 true WO2019241628A1 (en) 2019-12-19

Family

ID=67263052

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/037179 Ceased WO2019241628A1 (en) 2018-06-15 2019-06-14 General amyloid interaction motif (gaim)

Country Status (13)

Country Link
US (2) US11692017B2 (cg-RX-API-DMAC7.html)
EP (2) EP3806884B1 (cg-RX-API-DMAC7.html)
JP (1) JP7549536B2 (cg-RX-API-DMAC7.html)
CN (1) CN112672755A (cg-RX-API-DMAC7.html)
AU (1) AU2019287623B2 (cg-RX-API-DMAC7.html)
BR (1) BR112020025111A2 (cg-RX-API-DMAC7.html)
ES (1) ES2960493T3 (cg-RX-API-DMAC7.html)
IL (1) IL279333B2 (cg-RX-API-DMAC7.html)
MX (1) MX2020013525A (cg-RX-API-DMAC7.html)
PL (1) PL3806884T3 (cg-RX-API-DMAC7.html)
SG (1) SG11202012091WA (cg-RX-API-DMAC7.html)
WO (1) WO2019241628A1 (cg-RX-API-DMAC7.html)
ZA (1) ZA202100071B (cg-RX-API-DMAC7.html)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024119183A1 (en) 2022-12-02 2024-06-06 Alzheon, Inc. Methods for treating neurodegenerative disorders with tramiprosate

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019241628A1 (en) * 2018-06-15 2019-12-19 Proclara Biosciences, Inc. General amyloid interaction motif (gaim)
JP7505713B2 (ja) 2019-02-22 2024-06-25 ロヨラ メリーマウント ユニバーシティ アミロイドペプチドバリアント
CN117343200B (zh) * 2023-12-04 2024-01-30 北京质肽生物医药科技有限公司 一种包含淀粉样核心多肽的融合蛋白、制备方法及其应用

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3941763A (en) 1975-03-28 1976-03-02 American Home Products Corporation PGlu-D-Met-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 and intermediates
US4215051A (en) 1979-08-29 1980-07-29 Standard Oil Company (Indiana) Formation, purification and recovery of phthalic anhydride
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
US7083784B2 (en) 2000-12-12 2006-08-01 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
US7217798B2 (en) 2003-10-15 2007-05-15 Pdl Biopharma, Inc. Alteration of Fc-fusion protein serum half-lives by mutagenesis
US7217797B2 (en) 2002-10-15 2007-05-15 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US8022270B2 (en) 2000-07-31 2011-09-20 Biolex Therapeutics, Inc. Expression of biologically active polypeptides in duckweed
WO2013082114A1 (en) 2011-11-29 2013-06-06 Neurophage Pharmaceuticals, Inc. Use of p3 of bacteriophage as amyloid binding agents
WO2014055515A1 (en) 2012-10-02 2014-04-10 Neurophage Pharmaceuticals, Inc. Use of p3 of bacteriophage fusion proteins as amyloid binding agents
WO2014193935A1 (en) 2013-05-28 2014-12-04 Neurophage Pharmaceuticals, Inc. Polypeptides comprising a modified bacteriophage g3p amino acid sequence with reduced immunogenicity
WO2016090022A1 (en) 2014-12-03 2016-06-09 Neurophage Pharmaceuticals, Inc. Polypeptides comprising a modified bacteriophage g3p amino acid sequence lacking a gylcosylation signal

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019241628A1 (en) * 2018-06-15 2019-12-19 Proclara Biosciences, Inc. General amyloid interaction motif (gaim)

Patent Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3941763A (en) 1975-03-28 1976-03-02 American Home Products Corporation PGlu-D-Met-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 and intermediates
US4215051A (en) 1979-08-29 1980-07-29 Standard Oil Company (Indiana) Formation, purification and recovery of phthalic anhydride
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
US8022270B2 (en) 2000-07-31 2011-09-20 Biolex Therapeutics, Inc. Expression of biologically active polypeptides in duckweed
US7083784B2 (en) 2000-12-12 2006-08-01 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
US7217797B2 (en) 2002-10-15 2007-05-15 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US7217798B2 (en) 2003-10-15 2007-05-15 Pdl Biopharma, Inc. Alteration of Fc-fusion protein serum half-lives by mutagenesis
WO2013082114A1 (en) 2011-11-29 2013-06-06 Neurophage Pharmaceuticals, Inc. Use of p3 of bacteriophage as amyloid binding agents
WO2014055515A1 (en) 2012-10-02 2014-04-10 Neurophage Pharmaceuticals, Inc. Use of p3 of bacteriophage fusion proteins as amyloid binding agents
WO2014193935A1 (en) 2013-05-28 2014-12-04 Neurophage Pharmaceuticals, Inc. Polypeptides comprising a modified bacteriophage g3p amino acid sequence with reduced immunogenicity
US9988444B2 (en) 2013-05-28 2018-06-05 Proclara Biosciences, Inc. Polypeptides comprising a modified bacteriophage g3p amino acid sequence with reduced immunogenicity
WO2016090022A1 (en) 2014-12-03 2016-06-09 Neurophage Pharmaceuticals, Inc. Polypeptides comprising a modified bacteriophage g3p amino acid sequence lacking a gylcosylation signal
US20180207231A1 (en) 2014-12-03 2018-07-26 Proclara Biosciences, Inc. Polypeptides comprising a modified bacteriophage g3p amino acid sequence lacking a glycosylation signal

Non-Patent Citations (44)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", vol. 2, 1989, GREENE PUBLISH. ASSOC. & WILEY INTERSCIENCE
BRISSON ET AL., NATURE, vol. 31, no. 0, 1984, pages 511 - 514
BROGLIE ET AL., SCIENCE, vol. 224, 1984, pages 838 - 843
CHITIDOBSON, ANNU REV BIOCHEM, vol. 75, 2006, pages 333 - 66
CONDELLO ET AL., PNAS, vol. 115, 2018, pages E782 - 91
CORUZZI ET AL., EMBO J., vol. 3, 1984, pages 1671 - 1680
DAVIS ET AL., BIOCHEM. INTL., vol. 10, 1985, pages 394
DENGPERHAM, J MOL BIOL, vol. 319, 2002, pages 603 - 14
EICHNERRADFORD, MOL. CELL, vol. 43, 2011, pages 8 - 18
ERIKSON ET AL.: "The Proteins", vol. 2, 1976, pages: 257
FESSEL JEFFREY ED - WIEN MICHELLE: "Alzheimer's disease combination treatment", NEUROBIOLOGY OF AGING, TARRYTOWN, NY, US, vol. 63, 8 November 2017 (2017-11-08), pages 165, XP085345003, ISSN: 0197-4580, DOI: 10.1016/J.NEUROBIOLAGING.2017.10.022 *
FINN ET AL., THE PROTEINS, vol. 2, 1976, pages 105
GENTZ ET AL., PROC. NATL. ACAD. SCI., vol. 86, 1989, pages 821 - 824
GURLEY ET AL., MOL. CELL. BIOL., vol. 6, 1986, pages 559 - 565
HOFFMAN-THOMS ET AL., J BIOL CHEM, vol. 288, 2013, pages 12979 - 91
HOLLIGER ET AL., J MOL BIOL, vol. 288, 1999, pages 649 - 57
JOSEPHS ET AL., ACTA NEUROPATHOL, vol. 122, 2011, pages 137 - 153
KATHER ET AL., J MOL BIOL, vol. 354, 2005, pages 666 - 78
KRISHNAN ET AL., J MOL BIOL, vol. 426, 2014, pages 2500 - 19
LEE ET AL., ANNU. REV. NEUROSCI., vol. 24, 2001, pages 1121 - 159
LIU ET AL., SCI REP, vol. 6, 2016, pages 33079
LOGANSHENK, PNAS, vol. 81, 1984, pages 3655
MACKETT ET AL., J. VIRAL., vol. 49, 1984, pages 857
MARC MANIX ET AL: "Creutzfeldt-Jakob disease: updated diagnostic criteria, treatment algorithm, and the utility of brain biopsy", NEUROSURGICAL FOCUS, vol. 39, no. 5, 1 November 2015 (2015-11-01), United States, pages E2, XP055618585, ISSN: 1092-0684, DOI: 10.3171/2015.8.FOCUS15328 *
MARTINSCHMID, J MOL BIOL, vol. 328, 2003, pages 863 - 1003
MCKHANN ET AL., ALZHEIMER'S & DEMENTIA, vol. 7, no. 3, 2011, pages 263 - 9
MERRIFIELD, CHEMICAL POLYPEPTIDES, 1973, pages 335 - 61
MERRIFIELD, J. AM. CHEM. SOC., vol. 85, 1963, pages 2149
PANICALI ET AL., PNAS, vol. 79, 1982, pages 4927
RAJARAMAN KRISHNAN ET AL: "A Bacteriophage Capsid Protein Provides a General Amyloid Interaction Motif (GAIM) That Binds and Remodels Misfolded Protein Assemblies", JOURNAL OF MOLECULAR BIOLOGY, vol. 426, no. 13, 1 June 2014 (2014-06-01), United Kingdom, pages 2500 - 2519, XP055266872, ISSN: 0022-2836, DOI: 10.1016/j.jmb.2014.04.015 *
RAJARAMAN KRISHNAN ET AL: "Conformation as the Therapeutic Target for Neurodegenerative Diseases", CURRENT ALZHEIMER RESEARCH, vol. 14, no. 4, 16 February 2017 (2017-02-16), NL, pages 393 - 402, XP055618346, ISSN: 1567-2050, DOI: 10.2174/1567205014666170116152622 *
RASMUSSEN ET AL., PNAS, vol. 114, 2017, pages 13018 - 23
S POMMIER ET AL., J. BACTERIOL., vol. 187, no. 21, 2005, pages 7526 - 34
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
SIMONSENLEVINSON, PNAS, vol. 80, 1983, pages 2495
SMITH ET AL., J. VIRAL., vol. 46, 1983, pages 584
SUNDE ET AL., J. MOL BIOL., vol. 273, 1997, pages 729 - 39
TAKAMATSU ET AL., EMBO J, vol. 6, 1987, pages 307 - 311
TRAXLMAYR ET AL., BIOCHIM BIOPHYS ACTA, vol. 1824, 2012, pages 524 - 529
WANKER ET AL., METHODS ENZYMOL, vol. 309, 1999, pages 375 - 86
WEININGER ET AL., PNAS, vol. 106, 2009, pages 12335 - 40
WEISSBACHWEISSBACH: "Methods for Plant Molecular Biology", 1988, ACADEMIC PRESS, pages: 421 - 463
WILDBURGER ET AL., SCI REP, vol. 7, 2017, pages 9520
WILSON ET AL., CELL, vol. 37, 1984, pages 767

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024119183A1 (en) 2022-12-02 2024-06-06 Alzheon, Inc. Methods for treating neurodegenerative disorders with tramiprosate

Also Published As

Publication number Publication date
PL3806884T3 (pl) 2023-11-20
CN112672755A (zh) 2021-04-16
MX2020013525A (es) 2021-02-26
US11692017B2 (en) 2023-07-04
ES2960493T3 (es) 2024-03-05
CA3102841A1 (en) 2019-12-19
US20230279064A1 (en) 2023-09-07
IL279333B2 (en) 2023-06-01
EP3806884A1 (en) 2021-04-21
AU2019287623B2 (en) 2024-11-07
US20210246179A1 (en) 2021-08-12
ZA202100071B (en) 2023-04-26
IL279333A (en) 2021-01-31
SG11202012091WA (en) 2021-01-28
EP4389154A3 (en) 2024-11-13
US12247055B2 (en) 2025-03-11
EP4389154A2 (en) 2024-06-26
JP2021527407A (ja) 2021-10-14
AU2019287623A1 (en) 2021-01-07
EP3806884C0 (en) 2023-08-02
EP3806884B1 (en) 2023-08-02
BR112020025111A2 (pt) 2021-04-06
JP7549536B2 (ja) 2024-09-11

Similar Documents

Publication Publication Date Title
US12247055B2 (en) General amyloid interaction motif (GAIM)
US10526377B2 (en) Fusion proteins comprising P3 of bacteriophage
CA2857539C (en) Bacteriophage gene 3 protein compositions and use as amyloid binding agents
CA3102841C (en) General amyloid interaction motif (gaim)
HK40110180A (en) General amyloid interaction motif (gaim)
HK40049127A (en) General amyloid interaction motif (gaim)
HK40049127B (en) General amyloid interaction motif (gaim)
EA046070B1 (ru) Общий амилоид-взаимодействующий мотив (gaim)
RS56559B1 (sr) Upotreba p3 fuzionih proteina bakteriofaga kao vezujućih agenasa amiloida
HK1213775B (en) Use of p3 of bacteriophage fusion proteins as amyloid binding agents

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19739769

Country of ref document: EP

Kind code of ref document: A1

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
ENP Entry into the national phase

Ref document number: 3102841

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020569166

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020025111

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019287623

Country of ref document: AU

Date of ref document: 20190614

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019739769

Country of ref document: EP

Effective date: 20210115

ENP Entry into the national phase

Ref document number: 112020025111

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20201209