WO2019210055A2 - Heat shock protein-binding peptide compositions and methods of use thereof - Google Patents
Heat shock protein-binding peptide compositions and methods of use thereof Download PDFInfo
- Publication number
- WO2019210055A2 WO2019210055A2 PCT/US2019/029112 US2019029112W WO2019210055A2 WO 2019210055 A2 WO2019210055 A2 WO 2019210055A2 US 2019029112 W US2019029112 W US 2019029112W WO 2019210055 A2 WO2019210055 A2 WO 2019210055A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- polypeptide
- acid sequence
- certain embodiments
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001111—Immunoglobulin superfamily
- A61K39/001114—CD74, Ii, MHC class II invariant chain or MHC class II gamma chain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/646—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
- A61K47/6901—Conjugates being cells, cell fragments, viruses, ghosts, red blood cells or viral vectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70539—MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5152—Tumor cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55577—Saponins; Quil A; QS21; ISCOMS
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6043—Heat shock proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/62—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
- A61K2039/622—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier non-covalent binding
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/62—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
- A61K2039/627—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/64—Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the invention relates to heat shock protein (HSP)-binding peptide compositions, and uses of such compositions as immunotherapeutics (e.g., cancer vaccines).
- HSP heat shock protein
- Immunotherapies are becoming important tools in the treatment of cancer.
- One immunotherapy approach involves the use of therapeutic cancer vaccines comprising cancer- specific antigenic peptides that actively educate a patient’s immune system to target and destroy cancer cells.
- therapeutic cancer vaccines comprising cancer-specific antigenic peptides that actively educate a patient’s immune system to target and destroy cancer cells.
- generation of such therapeutic cancer vaccines is limited by the immunogenicity of cancer-specific antigenic peptides.
- the instant disclosure provides polypeptides and compositions comprising novel HSP-binding peptides. Such polypeptides and compositions are particularly useful as immunotherapeutics (e.g., cancer vaccines). Also provided are methods of inducing a cellular immune response using such polypeptides and compositions, methods of treating a disease using such polypeptides and compositions, kits comprising such polypeptides and compositions, and methods of making such compositions.
- the disclosure provides an isolated polypeptide comprising a heat shock protein (HSP)-binding peptide comprising the amino acid sequence of X1LX2LTX3 (SEQ ID NO: 1), wherein Xi is W or F; X 2 is R or K; and X3 is W, F, or G.
- HSP heat shock protein
- the disclosure provides an isolated polypeptide comprising an HSP-binding peptide comprising the amino acid sequence of NWX1X2X3X4X5 (SEQ ID NO: 232), wherein Xi is L or I; X2 is L, R, or K; X3 is L or I; X4 is T, L, F, K, R, or W; and X5 is W or K.
- NWX1X2X3X4X5 SEQ ID NO: 232
- the HSP-binding peptide comprises the amino acid sequence of: NX1LX2LTX3 (SEQ ID NO: 2), wherein Xi is W or F; X2 is R or K; and X3 is W, F, or G; WLX1LTX2 (SEQ ID NO: 3), wherein Xi is R or K; and X2 is W or G; or NWLX1LTX2 (SEQ ID NO: 4), wherein Xi is R or K; and X2 is W or G.
- the HSP-binding peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 5-12,98-113, 204, 205, and 207-215. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 5- 12,98-113, 204, 205, and 207-215. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 6. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 6. In certain embodiments, the HSP-binding peptide is no more than 6, 7, 8, 9, 10, 11,
- the polypeptide further comprises an antigenic peptide comprising one or more major histocompatibility complex (MHC)-binding epitopes.
- MHC major histocompatibility complex
- the MHC-binding epitope binds to an MHC I molecule with an IC50 of 500 nM or less.
- the MHC-binding epitope binds to an MHC II molecule with an IC50 of 1000 nM or less.
- the MHC-binding epitope is from a cancer cell.
- the MHC-binding epitope comprises an amino acid mutation or a gene fusion mutation of the cancer cell.
- the amino acid mutation is a substitution, deletion, or insertion mutation.
- the amino acid mutation or gene fusion mutation is at or about the middle of the antigenic peptide. In certain embodiments, the amino acid mutation or gene fusion mutation is at position 1, 2, 3, 4, 5, 6,
- the MHC-binding epitope is from a pathogenic microbe.
- the pathogenic microbe is a virus.
- the virus is a human papillomavirus (HPV).
- the antigenic peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 38-53.
- the instant disclosure provides an isolated polypeptide comprising an HSP-binding peptide and an antigenic peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 38-53.
- the amino acid sequence of the antigenic peptide consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 38-53.
- the HSP-binding peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-12, 98-113, 204, 205, 207-215, and 232.
- the amino acid sequence of the HSP-binding peptide consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-12, 98-113, 204, 205, 207-215, and 232.
- the MHC-binding epitope comprises a modified amino acid residue.
- the modified amino acid residue is a Tyr, Ser, Thr,
- the modified amino acid residue is a mimetic of a Tyr, Ser, Thr, Arg, Lys, or His amino acid that has been phosphorylated on a side chain hydroxyl or amine.
- the mimetic is a non-hydrolyzable analogue of a phosphorylated residue.
- the modified amino acid residue is an Asn that has been glycosylated on a side chain amide, a Ser or Thr that has been glycosylated on a side chain hydroxyl, a Lys or Arg that has been methylated on a side chain amino, a Lys that has been acetylated on a side chain amino, an N-terminal residue that has been acetylated on the a-amino, or a C- terminal residue that has been amidated on the a-carboxyl.
- the modified amino acid residue is at or about the middle of the antigenic peptide. In certain embodiments, the modified amino acid residue is at position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,
- the HSP-binding peptide is linked to the antigenic peptide via a chemical linker. In certain embodiments, the HSP-binding peptide is linked to the antigenic peptide via a peptide linker. In certain embodiments, the peptide linker comprises the amino acid sequence of FFRK (SEQ ID NO: 13) or FR.
- the HSP-binding peptide is at the C-terminus of the polypeptide.
- the polypeptide comprises the amino acid sequence of: (a) FFRKX1LX2LTX3 (SEQ ID NO: 14), wherein Xi is W or F; X 2 is R or K; and X 3 is W, F, or G; (b) FFRKNX1LX2LTX3 (SEQ ID NO: 15), wherein Xi is W or F; X 2 is R or K; and X3 is W, F, or G;
- the polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 18-25, 71-75, 166, 167, 173, and 174, at the C-terminus of the polypeptide.
- the HSP-binding peptide is at the N-terminus of the polypeptide.
- the polypeptide comprises the amino acid sequence of:
- NX1LX2LTX3FFRK (SEQ ID NO: 27), wherein Xi is W or F; X 2 is R or K; and X3 is W, F, or G;
- the polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 30-37, and 216-229, at the N-terminus of the polypeptide.
- the polypeptide is 12 to 50 amino acids in length ( e.g .,
- the polypeptide is 20 to 40 amino acids in length.
- the polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 54-69. In certain embodiments, the amino acid sequence of the polypeptide consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 54-69.
- the polypeptide is chemically synthesized.
- the instant disclosure provides a composition comprising a complex of the polypeptide disclosed herein and a purified stress protein.
- the stress protein is selected from the group consisting of Hsc70, Hsp70, Hsp90, Hspl 10, Grp 170, Gp96, Calreticulin, and a mutant or fusion protein thereof.
- the stress protein is Hsc70.
- the stress protein is human Hsc70.
- the stress protein is a recombinant protein.
- the instant disclosure provides a composition comprising a plurality of the polypeptides as disclosed herein, optionally further comprising a purified stress protein as disclosed herein.
- the composition comprises 2-20 different polypeptides as disclosed herein.
- each of the different polypeptides comprises the same HSP-binding peptide and a different antigenic peptide.
- the antigenic peptide of each one of the polypeptides comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 38-53.
- the composition comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
- each one of the polypeptides comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 54-69.
- the amino acid sequence of each one of the polypeptides consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 54-69.
- the composition comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16 different polypeptides.
- the total amount of the polypeptide(s) in the composition is about 0.1 to 20 nmol. In certain embodiments, the total amount of the polypeptide(s) in the composition is about 3, 4, 5, or 6 nmol.
- the amount of the stress protein in the composition is about 10 pg to 600 pg. In certain embodiments, the amount of the stress protein in the composition is about 250 pg to 290 pg.
- the molar ratio of the polypeptide(s) to the stress protein is about 0.5: 1 to 5: 1. In certain embodiments, the molar ratio of the polypeptide(s) to the stress protein is about 1 : 1 to 2: 1. In certain embodiments, the molar ratio of the
- polypeptide(s) to the stress protein is about 1 : 1, 1.25: 1, or 1.5: 1.
- the total amount of the polypeptide(s) and stress protein in the composition is about 10 pg to 600 pg. In certain embodiments, the total amount of the polypeptide(s) and stress protein in the composition is about 300 pg.
- the composition further comprises an adjuvant.
- the adjuvant comprises a saponin or an immunostimulatory nucleic acid.
- the adjuvant comprises QS-21.
- the amount of the QS-21 in the composition is about 10 pg, 25 pg, or 50 pg.
- the adjuvant comprises a Toll-like receptor (TLR) agonist.
- TLR Toll-like receptor
- the TRL agonist is an agonist of TLR4.
- the TRL agonist is an agonist of TLR7 and/or TLR8.
- the TRL agonist is an agonist of TLR9.
- the TRL agonist is an agonist of TLR5.
- the composition is a pharmaceutical composition comprising a pharmaceutically acceptable carrier or excipient. In certain embodiments, the composition is in a unit dosage form.
- the instant disclosure provides a method of inducing a cellular immune response to an antigenic peptide in a subject, the method comprising administering to the subject an effective amount of a composition or a unit dosage form as disclosed herein.
- the subject has cancer.
- the subject has an infection of a pathogenic microbe.
- the instant disclosure provides a method of treating a disease in a subject, the method comprising administering to the subject an effective amount of a composition or a unit dosage form as disclosed herein.
- the disease is cancer.
- the disease is an infection of a pathogenic microbe.
- the MHC-binding epitope is present in the subject’s cancer cells. In certain embodiments, the MHC-binding epitope is present in the pathogenic microbe.
- the composition or unit dosage form is administered to the subject weekly for four weeks. In certain embodiments, at least two further doses of the composition or unit dosage form are administered biweekly to the subject after the four weekly doses. In certain embodiments, at least one booster dose of the composition or unit dosage form is administered three months after the final weekly or biweekly dose. In certain embodiments, the composition or unit dosage form is further administered every three months for at least 1 year.
- the method further comprises administering to the subject lenalidomide, dexamethasone, interleukin-2, recombinant interferon alfa-2b, or PEG- interferon alfa-2b.
- the method further comprises administering to the subject an indoleamine dioxygenase-l (IDO-l) inhibitor.
- the IDO-l inhibitor is 4-amino-N-(3-chloro-4-fluorophenyl)-N'-hydroxy-l,2,5-oxadiazole-3- carboximidamide.
- the method further comprises administering to the subject an immune checkpoint antibody.
- the immune checkpoint antibody is selected from the group consisting of an agonistic anti-GITR antibody, an agonistic anti-OX40 antibody, an antagonistic anti-PD-l antibody, an antagonistic anti- CTLA-4 antibody, an antagonistic anti-TIM-3 antibody, an antagonistic anti-LAG-3 antibody, an antagonistic anti-TIGIT antibody, an agonistic anti-CD96 antibody, an antagonistic anti-VISTA antibody, an antagonistic anti-CD73 antibody, an agonistic anti- CD 137 antibody, an antagonist anti-CEACAMl antibody, an agonist anti-ICOS antibody, and or an antigen-binding fragment thereof.
- the instant disclosure provides a kit comprising a first container containing the polypeptide as disclosed herein, and a second container containing a purified stress protein capable of binding to the polypeptide.
- the first container contains 2-20 different polypeptides as disclosed herein.
- each of the different polypeptides comprises the same HSP-binding peptide and a different antigenic peptide.
- the total amount of the polypeptide(s) in the first container is about 0.1 to 20 nmol. In certain embodiments, the total amount of the polypeptide(s) in the first container is about 3, 4, 5, or 6 nmol.
- the first container contains a single polypeptide as disclosed here in. In certain embodiments, the first container contains at least 20 different polypeptides as disclosed herein. In certain embodiments, each of the different polypeptides comprises the same HSP-binding peptide and a different antigenic peptide. In certain embodiments, the total amount of the polypeptide(s) in the first container is about 0.1 to 20 nmol. In certain embodiments, the total amount of the polypeptide(s) in the first container is about 3, 4, 5, or 6 nmol.
- the stress protein is selected from the group consisting of Hsc70, Hsp70, Hsp90, Hspl 10, Grpl70, Gp96, Calreticulin, and a mutant thereof.
- the stress protein is Hsc70.
- the stress protein is human Hsc70.
- the stress protein is a recombinant protein.
- the amount of the stress protein in the second container is about 10 pg to 600 pg. In certain embodiments, the amount of the stress protein in the second container is about 250 pg to 290 pg.
- the molar ratio of the polypeptide to the stress protein is about 0.5: 1 to 5: 1. In certain embodiments, the molar ratio of the polypeptide to the stress protein is about 1 : 1 to 2: 1. In certain embodiments, the molar ratio of the polypeptide to the stress protein is about 1 : 1, 1.25: 1, or 1.5: 1. In certain embodiments, the total amount of the polypeptide(s) in the first container and the stress protein in the second container is about 10 mg to 600 pg. In certain embodiments, the total amount of the polypeptide(s) in the first container and the stress protein in the second container is 300 pg.
- the kit further comprises a third container containing an adjuvant.
- the adjuvant comprises a saponin or an
- the adjuvant comprises QS-21. In certain embodiments, the amount of the QS-21 in the third container is about 10 pg, 25 pg, or 50 pg. In certain embodiments, the adjuvant comprises a TLR agonist. In certain embodiments, the TRL agonist is an agonist of TLR4. In certain embodiments, the TRL agonist is an agonist of TLR7 and/or TLR8. In certain embodiments, the TRL agonist is an agonist of TLR9. In certain embodiments, the TRL agonist is an agonist of TLR5.
- the instant disclosure provides a method of making a vaccine, the method comprising mixing one or more polypeptides as disclosed herein with a purified stress protein under suitable conditions such that the purified stress protein binds to at least one of the polypeptides.
- the stress protein is selected from the group consisting of Hsc70, Hsp70, Hsp90, Hspl 10, Grpl70, Gp96, Calreticulin, and a mutant thereof.
- the stress protein is Hsc70.
- the stress protein is human Hsc70.
- the stress protein is a recombinant protein.
- the molar ratio of the polypeptide to the stress protein is about 0.5: 1 to 5: 1. In certain embodiments, the molar ratio of the polypeptide to the stress protein is about 1 :1 to 2: 1. In certain embodiments, the molar ratio of the polypeptide to the stress protein is about 1 : 1, 1.25: 1, or 1.5:1. In certain embodiments, the suitable conditions comprise a temperature of about 37 °C.
- Figure 1 is an exemplary size exclusion chromatography (SEC) chromatogram showing the UV absorbance of uncomplexed Hsc70 (top) and peptide complexed Hsc70 (bottom).
- C”,“D”,“T”, and“HMW” indicate the segments of the chromatogram corresponding to peptide-Hsc70 complexes, Hsc70 dimers, Hsc70 trimers, and high molecular weight oligomeric Hsc70 species, respectively.
- M Sh refers to a monomer shoulder.
- Figure 2 is a chromatogram showing the UV absorbance of PEP006 mixed with Hsc70 at a range of molar ratios from 0.25: 1 to 3: 1, wherein the compositions in the mixture were separated by size exclusion chromatography.
- Figure 3A is a chromatogram showing the UV absorbance of a polypeptide comprising PEP006 mixed with Hsc70 at a range of molar ratios from 0.125: 1 to 4: 1, wherein the compositions in the mixture were separated by size exclusion chromatography.
- Figure 3B is a graph showing percent complexation with Hsc70 for a PEP006-containing polypeptide, over a range of polypeptide:Hsc70 molar ratios from 0.125: 1 to 4: 1, as calculated from size exclusion chromatography traces similar to those in Figure 3A. Three independent experiments are shown.
- Figure 4A is a graph showing percent complexation with Hsc70 for five different peptides, where each of the five different peptides was synthesized in three forms: one with a C -terminal PEP001 sequence, one with a C-terminal PEP006 sequence, and one without a C- terminal HSP-binding peptide (“Naked Peptide”).
- Figure 4B is a graph showing percent complexation with Hsc70 for six different peptides, where each of the six different peptides was synthesized in two forms: one with a C-terminal PEP001 sequence and one with a C- terminal PEP006 sequence.
- Figures 7B-7E show the tumor volume of each mouse in these four treatment groups.
- Figure 7F shows a set of survival curves of the mice.
- Figure 8B shows a set of survival curves of the mice.
- Figure 9A is a series of graphs showing tumor growth kinetics in individual mice treated with two different formulations of HSC70-based vaccine loaded with 16 different HPV peptides comprising PEP006 as compared to PBS.
- Figure 9B is a graph showing group mean tumor growth kinetics of mice in the same mice.
- Figure 9C is a graph showing overall survival in the same experiment.
- Figure 10A is a series of chromatograms showing the reverse phase
- chromatography signals of the chemical synthesis products of an Ova peptide naked (SEQ ID NO:97) or linked with PEP001 (SEQ ID NO:230) or PEP006 (SEQ ID NO:23l).
- the arrows indicate the retention time of the pure peptides.
- Figure 10B is a graph showing quantification of the signals in Figure 10A.
- Figure 11 is a graph showing crude purity of naked peptides (A-Y) versus the same peptides (A-Y) with a C-terminal PEP006 sequence.
- the instant disclosure provides polypeptides and compositions comprising novel HSP-binding peptides. Such polypeptides and compositions are particularly useful as immunotherapeutics (e.g., cancer vaccines). Also provided are methods of inducing a cellular immune response using such polypeptides and compositions, methods of treating a disease using such polypeptides and compositions, kits comprising such polypeptides and compositions, and methods of making such compositions.
- the terms“about” and“approximately,” when used to modify a numeric value or numeric range, indicate that deviations of 5% to 10% above (e.g., up to 5% to 10% above) and 5% to 10% below (e.g., up to 5% to 10% below) the recited value or range remain within the intended meaning of the recited value or range.
- polypeptide refers to a non-naturally occurring polymer comprising a peptide of six or more amino acid residues.
- a polypeptide can further comprise one or more non-amino-acid-residue structures.
- a polypeptide comprises a chemical linker.
- a polypeptide comprises a chemical linker linking two portions of the polypeptide.
- a polypeptide does not comprise the entire amino acid sequence of a protein (e.g., a naturally occurring protein) comprising the amino acid sequence of SEQ ID NO: 1.
- a polypeptide does not comprise an amino acid sequence comprising more than 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 contiguous amino acids of a protein (e.g., a naturally occurring protein) that comprises the amino acid sequence of SEQ ID NO: 1.
- isolated polypeptide refers to a polypeptide that is separated from one or more molecules present after the expression (e.g., recombinant expression) or synthesis (e.g., chemical synthesis) of the polypeptide.
- MHC major histocompatibility complex
- HLA human leukocyte antigen
- HLA-A a class I MHC molecule
- HLA-B a class II MHC molecule
- HLA-DP a class II MHC molecule
- HLA-DQ a class II MHC molecule
- MHC-binding epitope refers to a peptide that binds to or is predicted to bind to an MHC molecule.
- an HSP-binding peptide does not comprise an amino acid sequence containing more than 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, or 50 contiguous amino acids of a protein (e.g., a naturally occurring protein) that comprises the amino acid sequence of SEQ ID NO: 1.
- peptide linker refers to a peptide bond or a peptide sequence that links a C-terminal amino acid residue of a first peptide to an N-terminal amino acid residue of a second peptide.
- chemical linker refers to any chemical bond or moiety that is capable of linking two molecules, wherein the bond or moiety is not a peptide linker.
- the terms“treat,”“treating,” and“treatment” refer to therapeutic or preventative measures described herein.
- the methods of“treatment” employ
- an antibody to a subject having a disease or disorder, or predisposed to having such a disease or disorder, in order to prevent, cure, delay, reduce the severity of, or ameliorate one or more symptoms of the disease or disorder or recurring disease or disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment.
- the term“effective amount” in the context of the administration of a therapy to a subject refers to the amount of a therapy that achieves a desired prophylactic or therapeutic effect.
- the term“subject” includes any human or non-human animal.
- the instant disclosure provides a polypeptide comprising an HSP- binding peptide comprising any one of the amino acid sequences provided in Table 1.
- the instant disclosure provides a polypeptide comprising an HSP- binding peptide comprising the amino acid sequence of X1LX2LTX3 (SEQ ID NO: 1), wherein Xi is W or F; X2 is R or K; and X3 is W, F, or G.
- the instant disclosure provides a polypeptide comprising an HSP-binding peptide comprising the amino acid sequence of NWX1X2X3X4X5 (SEQ ID NO: 232), wherein Xi is L or I; X2 is L, R, or K; X3 is L or I; X4 is T, L, F, K, R, or W; and X5 is W or K.
- the HSP- binding peptide binds to an HSP (e.g ., Hsc70, Hsp70, Hsp90, Hspl lO, Grpl70, Gp96, or Calreticulin) with a K d lower than 10 3 M, 10 4 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, or 10 9 M.
- Hsc70 e.g., human Hsc70
- Hsc70 e.g., human Hsc70
- the HSP-binding peptide comprises the amino acid sequence of NX1LX2LTX3 (SEQ ID NO: 2), wherein Xi is W or F; X2 is R or K; and X3 is W, F, or G.
- the HSP-binding peptide comprises the amino acid sequence of WLX1LTX2 (SEQ ID NO: 3), wherein Xi is R or K; and X2 is W or G.
- the HSP-binding peptide comprises the amino acid sequence of NWLX1LTX2 (SEQ ID NO: 4), wherein Xi is R or K; and X2 is W or G
- the HSP-binding peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 5-12, 98-113, 204-205, and 207-215. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 5. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 6. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 7. In certain embodiments, the HSP- binding peptide comprises the amino acid sequence of SEQ ID NO: 8. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO:
- the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 10. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 11. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 12. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 98. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 99. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 100. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 101.
- the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 102. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 103. In certain embodiments, the HSP- binding peptide comprises the amino acid sequence of SEQ ID NO: 104. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 105. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 106. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 107.
- the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 108. In certain embodiments, the HSP- binding peptide comprises the amino acid sequence of SEQ ID NO: 109. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 110. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 111. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 112. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 113. In certain embodiments, the HSP- binding peptide comprises the amino acid sequence of SEQ ID NO: 204.
- the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 205. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 207. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 208. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 209. In certain embodiments, the HSP- binding peptide comprises the amino acid sequence of SEQ ID NO: 210. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 211.
- the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 212. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 213. In certain embodiments, the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 214. In certain embodiments, the HSP- binding peptide comprises the amino acid sequence of SEQ ID NO: 215.
- the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 1. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 2. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 3. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 4. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 232.
- the amino acid sequence of the HSP-binding peptide consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 5-12, 98-113, 204, 205, and 207-215. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 5. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 6. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 7. In certain
- the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 8. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 9. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 8. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 9. In certain
- the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 10. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 11. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 12. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 98. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 99.
- the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 100. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 101. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 102. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 103. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 104.
- the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 105. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 106. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 107. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 108. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 109.
- the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 110. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 111. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 112. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 113. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 204.
- the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 205. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 207. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 208. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 209. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 210.
- the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 211. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 212. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 213. In certain embodiments, the amino acid sequence of the HSP-binding peptide consists of the amino acid sequence of SEQ ID NO: 214. In certain embodiments, the amino acid sequence of the HSP- binding peptide consists of the amino acid sequence of SEQ ID NO: 215.
- the HSP-binding peptide is no more than 100 (e.g ., no more than 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95) amino acid residues in length.
- the HSP- binding peptide is from 6 to 50 (e.g., 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50) amino acid residues in length.
- the amino acid sequence of the polypeptide consists of the amino acid sequence of the HSP-binding peptide.
- the HSP-binding peptide further comprises a linker.
- the linker can be any chemical linker or peptide linker known in the art.
- the linker comprises a moiety for chemical crosslinking or ultraviolet (UV) crosslinking. Any chemical crosslinking or UV crosslinking moieties known in the art (see, e.g., Wong, 1991, Chemistry of Protein Conjugation and Cross- Linking, CRC Press, incorporated herein by reference in its entirety) can be employed.
- the linker comprises a click chemistry handle.
- click chemistry handle refers to a reactant or a reactive group that can partake in a click chemistry reaction. Exemplary click chemistry handles are demonstrated in U.S. Patent Publication 20130266512, which is incorporated by reference herein in its entirety.
- the linker comprises a peptide linker.
- the peptide linker comprises an amino acid sequence that can be recognized and/or cleaved by a protease.
- the protease is expressed in a mammalian cell (e.g., a human cell).
- the protease is expressed in an antigen-presenting cell (e.g., B cell, macrophage, dendritic cell).
- the protease is a serine protease.
- the protease is trypsin, chymotrypsin, papain, V8 protease, or elastase.
- the peptide linker comprises or consists of the amino acid sequence of FFRK (SEQ ID NO: 13).
- the peptide linker comprises or consists of the amino acid sequence of FR.
- polypeptide comprises any one of the amino acid sequences provided in Table 2.
- the linker is N-terminal to the HSP-binding peptide.
- the polypeptide comprises the amino acid sequence of SEQ ID NO: 14, 15, 16, 17, or 233.
- the polypeptide comprises the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 71, 72, 74, 75, 166, 167, 173, or 174.
- the amino acid sequence of the polypeptide consists of the amino acid sequence of SEQ ID NO: 14, 15, 16, 17, or 233.
- the amino acid sequence of the polypeptide consists of the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 71, 72, 74, 75, 166, 167, 173, or 174.
- the linker is C-terminal to the HSP-binding peptide.
- the polypeptide comprises the amino acid sequence of SEQ ID NO: 26, 27, 28, 29, or 234.
- the polypeptide comprises the amino acid sequence of SEQ ID NO: 30, 31, 32, 33, 34, 35, 36, 37, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, or 229.
- the amino acid sequence of the polypeptide consists of the amino acid sequence of SEQ ID NO: 26, 27, 28, 29, or 234.
- the amino acid sequence of the polypeptide consists of the amino acid sequence of SEQ ID NO: 30, 31, 32, 33, 34, 35, 36, 37, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, or 229.
- the instant disclosure provides a polypeptide comprising an HSP- binding peptide as disclosed herein and an antigenic peptide comprising one or more MHC- binding epitopes.
- MHC-binding epitopes can be identified by methods known in the art, e.g., by an assay that measures the binding of a peptide to an MHC molecule (e.g., an HLA molecule).
- an assay that measures the binding of a peptide to an MHC molecule e.g., an HLA molecule.
- Non-limiting examples of such assays include inhibition of antigen presentation (Sette, et al., J. Immunol. 141 :3893, 1991), in vitro assembly assays (Townsend, et al, Cell 62:285, 1990), and FACS based assays using mutated cells, such as RMA.S (Melief, et al, Eur. J. Immunol. 21 :2963, 1991).
- an MHC-binding epitope can be predicted to bind an MHC molecule (e.g., an HLA molecule) by a software program (e.g. SYFPE
- MHC molecules are classified as either Class I or Class II molecules.
- Class II MHC molecules are expressed primarily on cells involved in initiating and sustaining immune responses, such as dendritic cells, B lymphocytes, macrophages, etc.
- Class II MHC molecules are recognized by helper T lymphocytes and induce proliferation of helper T lymphocytes and amplification of the immune response to the particular immunogenic peptide that is displayed.
- Class I MHC molecules are expressed on almost all nucleated cells and are recognized by cytotoxic T lymphocytes (CTLs), which then destroy the antigen bearing cells. Cytotoxic T lymphocytes are particularly important in tumor rejection and in fighting viral infections.
- CTLs cytotoxic T lymphocytes
- the CTL recognizes the antigen in the form of a peptide fragment bound to the MHC class I molecules rather than the intact foreign antigen itself.
- the capacity of peptides to bind MHC molecules can be measured in a variety of different ways, such as by inhibition of antigen presentation (Sette, et al., J. Immunol. 141:3893, 1991, incorporated herein by reference in its entirety), in vitro assembly assays (Townsend, et al, Cell 62:285, 1990), and FACS based assays using mutated cells, such as RMA.S (Melief, et al., Eur. J. Immunol. 21 :2963, 1991, incorporated herein by reference in its entirety).
- MHC-binding epitopes predicted to bind MHC class I molecules are typically between 8 to 11 residues
- MHC-binding epitopes predicted to bind MHC class II molecules are typically in the range of 10 to 20 residues.
- the MHC-binding epitope is an HLA-binding epitope.
- the MHC-binding epitope binds to an MHC I molecule with an IC50 smaller than or equal to 500 nM (e.g ., smaller than or equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, or 450 nM).
- the MHC-binding epitope binds to an MHC II molecule with an IC50 smaller than or equal to 1000 nM (e.g., smaller than or equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, or 900 nM).
- 1000 nM e.g., smaller than or equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, or 900 nM.
- the sequence of the MHC-binding epitope is identified from one or more of a subject’s cancer cells (e.g., cells of cervical cancer, adenocarcinoma, glioblastoma, or multiple myeloma).
- cancer cells e.g., cells of cervical cancer, adenocarcinoma, glioblastoma, or multiple myeloma.
- the amino acid sequence of the MHC-binding epitope is 100% identical to the sequence identified from the cancer cell(s).
- the amino acid sequence of the MHC-binding epitope is at least 70%, 80%, 90%, or 95% identical to the sequence identified from the cancer cell, optionally wherein the difference comprises mostly or only conservative substitutions of amino acids.
- the amino acid sequence identified from the cancer cell can be either wild-type or mutant relative to the most frequent sequence of the population of the species. Where the amino acid sequence identified from the cancer cell is mutant, it can comprise an amino acid mutation (e.g., a substitution, deletion, or insertion mutation) or a gene fusion mutation (e.g., as a result of genomic translocation or transposition).
- an amino acid mutation e.g., a substitution, deletion, or insertion mutation
- a gene fusion mutation e.g., as a result of genomic translocation or transposition.
- the sequence of the MHC-binding epitope is identified from a pathogenic microbe.
- the pathogenic microbe can be a virus, a bacterium, a fungus, a protozoan, or a parasite.
- viruses include hepatitis type A, hepatitis type B, hepatitis type C, influenza (e.g., influenza A or influenza B), varicella, adenovirus, herpes simplex type I (HSV-I), herpes simplex type II (HSV-II), rinderpest, rhinovirus, echovirus, rotavirus, respiratory syncytial virus, papilloma virus (e.g., human papillomavirus (HPV)), papova virus, cytomegalovirus, echinovirus, arbovirus, hantavirus, coxsackie virus, mumps virus, measles virus, rubella virus, polio virus, Epstein Barr virus (EBV), human
- HIV -I immunodeficiency virus type I
- HAV -II human immunodeficiency virus type II
- dengue virus smallpox virus
- Zika virus Exemplary bacteria include Escherichia coli, Klebsiella pneumoniae, Staphylococcus aureus, Enterococcus faecalis, Proteus vulgaris, Staphylococcus viridans, and Pseudomonas aeruginosa.
- Exemplary fungi include Candida (e.g., Candida glabratd), Pneumocystis carinii, Fusarium keratitis, coccidioidal, Aspergillus niger, Cryptococcus neoformans, and Curvularia geniculata.
- Exemplary protozoa include leishmania, coccidiosis, trypanosoma schistosoma, and malaria.
- Exemplary parasites include chlamydia and rickettsia.
- the MHC-binding epitope comprises a modified amino acid residue.
- the MHC-binding epitope comprises a phosphorylated residue (e.g., a Tyr, Ser, Thr, Arg, Lys, or His that has been phosphorylated on a side chain hydroxyl or amine).
- the MHC-binding epitope comprises a phosphomimetic residue (e.g., a mimetic of a Tyr, Ser, Thr, Arg, Lys, or His amino acid that has been phosphorylated on a side chain hydroxyl or amine).
- phosphomimetic groups include O-boranophospho, borono, O-dithiophospho,
- phosphoramide, H-phosphonate, alkylphosphonate, phosphorothiolate, phosphodithiolate and phosphorofluoridate any of which may be derivatized on Tyr, Thr, Ser, Arg, Lys, or His residues.
- an Asp or Glu residue is used as a phosphomimetic in place of a phospho-Tyr, phospho-Thr, phospho-Ser, phospho-Arg, phospho-Lys and/or phospho-His residue in a peptide.
- the phosphomimetic residue is a non-hydrolyzable analogue of a phosphorylated residue.
- the antigenic peptide can comprise one or more MHC-binding epitopes.
- the antigenic peptide comprises one MHC-binding epitope.
- the antigenic peptide comprises two or more (e.g., 3, 4, 5, 6, 7, 8, 9, 10, or more) MHC-binding epitopes.
- the two or more MHC-binding epitopes can be linked via a chemical linker or a peptide linker, wherein the peptide linker optionally comprises an amino acid sequence that can be recognized and/or cleaved by a protease.
- the antigenic peptide is 8 to 50 amino acids (e.g., 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35,
- the antigenic peptide is 12 to 50, 20 to 40, 20 to 35, 25 to 40, 20 to 30, 25 to 35, or 30 to 40 amino acids in length.
- the HSP-binding peptide can be linked to the antigenic peptide via a chemical linker or a peptide linker.
- the HSP-binding peptide can be linked to the antigenic peptide via a chemical linker.
- Any chemical linkers can be employed to link the HSP-binding peptide and the antigenic peptide.
- Exemplary chemical linkers include moieties generated from chemical crosslinking (see, e.g., Wong, 1991, Chemistry of Protein
- the HSP-binding peptide can be linked to the antigenic peptide via a peptide linker (e.g., a peptide linker as disclosed in Section 5.2).
- a peptide linker e.g., a peptide linker as disclosed in Section 5.2.
- the HSP-binding sequence can be linked to the antigenic peptide at any amino acid position.
- the C-terminus of the HSP-binding sequence is linked to the N-terminus of the antigenic peptide via a chemical linker.
- the N-terminus of the HSP-binding sequence is linked to the C-terminus of the antigenic peptide via a chemical linker.
- the C-terminus of the HSP-binding sequence is linked to the N-terminus of the antigenic peptide via a peptide linker.
- the N-terminus of the HSP-binding sequence is linked to the C-terminus of the antigenic peptide via a peptide linker.
- the HSP-binding peptide is at the C-terminus of the polypeptide.
- Polypeptides having an HSP-binding peptide at the C- terminus are generally advantageous in having an improved purity when produced by solid- phase synthesis.
- the HSP-binding peptide is at the N-terminus of the polypeptide.
- the heat shock protein-binding peptide is not at the N- terminus or the C-terminus of the polypeptide.
- the heat shock protein-binding peptide is at the center of the polypeptide.
- the polypeptide comprises, from N-terminus to C- terminus, an antigenic peptide comprising one or more MHC-binding epitopes, a peptide linker, and an HSP-binding peptide disclosed herein.
- the polypeptide comprises the amino acid sequence of SEQ ID NO: 14, 15, 16, 17, or 233.
- the polypeptide comprises the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 71, 72, 74, 75, 166, 167, 173, or 174.
- the amino acid sequence of the polypeptide consists of, from N-terminus to C-terminus, the amino acid sequence of an antigenic peptide disclosed herein, and the amino acid sequence of SEQ ID NO: 14, 15, 16, 17, or 233. In certain embodiments, the amino acid sequence of the polypeptide consists of, from N-terminus to C-terminus, the amino acid sequence of an antigenic peptide disclosed herein, and the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 71, 72, 74, 75, 166, 167, 173, or 174.
- the polypeptide comprises, from N-terminus to C- terminus, an HSP-binding peptide disclosed herein, a peptide linker, and an antigenic peptide comprising one or more MHC-binding epitopes.
- the polypeptide comprises the amino acid sequence of SEQ ID NO: 26, 27, 28, 29, or 234.
- the polypeptide comprises the amino acid sequence of SEQ ID NO: 30, 31, 32, 33, 34, 35, 36, 37, or 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, or 229.
- the amino acid sequence of the polypeptide consists of, from N- terminus to C-terminus, the amino acid sequence of SEQ ID NO: 26, 27, 28, 29, or 234, and the amino acid sequence of an antigenic peptide disclosed herein.
- the amino acid sequence of the polypeptide consists of, from N-terminus to C-terminus, the amino acid sequence of SEQ ID NO: 30, 31, 32, 33, 34, 35, 36, 37, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, or 229, and the amino acid sequence of an antigenic peptide disclosed herein.
- the polypeptide disclosed herein is no more than 500 amino acids (e.g ., no more than 400, 300, 200, 100, 90, 80, 70, 60, 50, or 40 amino acids) in length. In certain embodiments, the amino acid sequence of the polypeptide is not naturally occurring.
- the polypeptide binds to an HSP (e.g., Hsc70, Hsp70, Hsp90, Hspl 10, Grpl70, Gp96, or Calreticulin) with a K d lower than 10 3 M, 10 4 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, or 10 9 M.
- Hsc70 e.g., human Hsc70
- the polypeptide binds to Hsc70 (e.g., human Hsc70) with a K d of 10 3 M, 10 4 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, 10 9 M, or lower.
- Polypeptides disclosed herein can be synthesized by standard chemical methods including the use of a peptide synthesizer. Conventional peptide synthesis or other synthetic protocols well known in the art can be used.
- the polypeptide disclosed herein consists of amino acid residues linked by peptide bonds.
- Such polypeptides can be synthesized, for example, by solid-phase peptide synthesis using procedures similar to those described by Merrifield, 1963, J. Am. Chem. Soc., 85:2149, incorporated herein by reference in its entirety.
- N-a-protected amino acids having protected side chains are added stepwise to a growing polypeptide chain linked by its C-terminal and to an insoluble polymeric support /. e.. polystyrene beads.
- the polypeptides are synthesized by linking an amino group of an N-a- deprotected amino acid to an a-carboxyl group of an N-a-protected amino acid that has been activated by reacting it with a reagent such as dicyclohexylcarbodiimide or 2-(6-Chloro-l-H- benzotriazole- 1 -y 1)- 1 , 1 ,3 ,3 -tetramethy laminium hexafluorophosphate.
- a reagent such as dicyclohexylcarbodiimide or 2-(6-Chloro-l-H- benzotriazole- 1 -y 1)- 1 , 1 ,3 ,3 -tetramethy laminium hexafluorophosphate.
- the attachment of a free amino group to the activated carboxyl leads to peptide bond formation.
- the most commonly used N-a-protecting groups include Boc which is acid l
- nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the peptide sequence.
- Non-classical amino acids include, but are not limited to, the D-isomers of the common amino acids, a-amino isobutyric acid, 4-aminobutyric acid, hydroxyproline, sarcosine, citrulline, cysteic acid, t- butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, b-alanine, designer amino acids such as b-methyl amino acids, C-a-methyl amino acids, and N-a-methyl amino acids.
- Polypeptides phosphorylated on the side chains of Tyr, Ser, Thr, Arg, Lys, and His can be synthesized in Fmoc solid phase synthesis using the appropriate side chain protected Fmoc-phospho amino acid.
- polypeptides with a combination of phosphorylated and non-phosphorylated Tyr, Ser, Thr, Arg, Lys, and His residues can be synthesized.
- Staerkaer et al can be applied (1991, Tetrahedron Letters 32: 5389-5392).
- Other procedures are detailed in De Bont et al. (1987, Trav.
- a phosphorylated polypeptide can also be produced by first culturing a cell transformed with a nucleic acid that encodes the amino acid sequence of the polypeptide. After producing such a polypeptide by cell culture, the hydroxyl groups of the appropriate amino acid are substituted by phosphate groups using organic synthesis or enzymatic methods with phosphorylation enzymes. For example, in the case of serine-specific phosphorylation, serine kinases can be used.
- Phosphopeptide mimetics can also be synthesized, wherein a phosphorylated amino acid residue in a polypeptide is replaced with a phosphomimetic group.
- phosphomimetic groups include O-boranophospho, borono, O-dithiophospho, phosphoramide, H-phosphonate, alkylphosphonate, phosphorothiolate, phosphodithiolate and phosphorofluoridate, any of which may be derivatized on Tyr, Thr, Ser, Arg, Lys, or His residues.
- an Asp or Glu residue is used as a phosphomimetic.
- Asp or Glu residues can also function as phosphomimetic groups, and be used in place of a phospho-Tyr, phospho-Thr, phospho-Ser, phospho-Arg, phospho-Lys and/or phospho-His residue in a peptide.
- Polypeptides disclosed herein can also be prepared by recombinant DNA methods known in the art.
- a nucleic acid sequence encoding a polypeptide can be obtained by back translation of the amino acid sequence and synthesized by standard chemical methods, such as the use of an oligonucleotide synthesizer.
- coding information for polypeptides can be obtained from DNA templates using specifically designed
- nucleic acid encoding a polypeptide can be inserted into an expression vector for propagation and expression in host cells.
- the coding sequence for peptides of the length contemplated herein can be synthesized by chemical techniques, for example, the phosphotri ester method of Matteucci et al., J. Am. Chem. Soc. 103:3185 (1981) (incorporated herein by reference in its entirety), modification can be made simply by substituting the appropriate base(s) for those encoding the native peptide sequence.
- the coding sequence can then be provided with appropriate linkers and ligated into expression vectors commonly available in the art, and the vectors used to transform suitable hosts to produce the desired peptide or fusion protein. A number of such vectors and suitable host systems are now available.
- the coding sequence will be provided with operably linked start and stop codons, promoter and terminator regions and usually a replication system to provide an expression vector for expression in the desired cellular host.
- An expression construct refers to a nucleotide sequence encoding a polypeptide operably linked with one or more regulatory regions which enables expression of the peptide in an appropriate host cell. “Operably -linked” refers to an association in which the regulatory regions and the peptide sequence to be expressed are joined and positioned in such a way as to permit transcription, and ultimately, translation.
- the regulatory regions necessary for transcription of the peptide can be provided by the expression vector.
- a translation initiation codon may also be provided if the peptide gene sequence lacking its cognate initiation codon is to be expressed.
- cellular transcriptional factors such as RNA polymerase, will bind to the regulatory regions on the expression construct to effect transcription of the peptide sequence in the host organism.
- the precise nature of the regulatory regions needed for gene expression may vary from host cell to host cell. Generally, a promoter is required which is capable of binding RNA polymerase and promoting the transcription of an operably - associated nucleic acid sequence.
- Such regulatory regions may include those 5' non-coding sequences involved with initiation of transcription and translation, such as the TATA box, capping sequence, CAAT sequence, and the like.
- the non-coding region 3' to the coding sequence may contain transcriptional termination regulatory sequences, such as terminators and polyadenylation sites.
- linkers or adapters providing the appropriate compatible restriction sites may be ligated to the ends of the cDNAs by techniques well known in the art (Wu et al, 1987, Methods in Enzymol 152:343-349, incorporated herein by reference in its entirety). Cleavage with a restriction enzyme can be followed by modification to create blunt ends by digesting back or filling in single-stranded DNA termini before ligation. Alternatively, a desired restriction enzyme site can be introduced into a fragment of DNA by amplification of the DNA by use of PCR with primers containing the desired restriction enzyme site.
- An expression construct comprising a polypeptide coding sequence operably linked with regulatory regions can be directly introduced into appropriate host cells for expression and production of the peptide without further cloning.
- the expression constructs can also contain DNA sequences that facilitate integration of the DNA sequence into the genome of the host cell, e.g. , via homologous recombination. In this instance, it is not necessary to use an expression vector comprising a replication origin suitable for appropriate host cells in order to propagate and express the peptide in the host cells.
- a variety of expression vectors may be used including plasmids, cosmids, phage, phagemids or modified viruses.
- such expression vectors comprise a functional origin of replication for propagation of the vector in an appropriate host cell, one or more restriction endonuclease sites for insertion of the peptide gene sequence, and one or more selection markers.
- Expression vectors may be constructed to carry nucleotide sequences for one or more of the polypeptides disclosed herein.
- the expression vector must be used with a compatible host cell which may be derived from a prokaryotic or eukaryotic organism including but not limited to bacteria, yeasts, insects, mammals and humans.
- Such host cells can be transformed to express one or more polypeptides disclosed herein, such as by transformation of the host cell with a single expression vector containing a plurality of nucleotide sequences encoding any of the polypeptides disclosed herein, or by transformation of the host cell with multiple expression vectors encoding different polypeptides disclosed herein.
- a number of expression vectors may be advantageously selected to produce polypeptides.
- vectors that direct the expression of high levels of fusion protein products that are readily purified may be desirable.
- Such vectors include the E. coli expression vector pUR278 (Ruther et al, 1983, EMBO J. 2, 1791, incorporated herein by reference in its entirety), in which the peptide coding sequence may be ligated individually into the vector in frame with the lac Z coding region so that a fusion protein is produced; pIN vectors (Inouye and Inouye, 1985, Nucleic Acids Res.
- pGEX vectors may also be used to express these peptides as fusion proteins with glutathione S-transferase (GST).
- GST glutathione S-transferase
- fusion proteins are soluble and can easily be purified from lysed cells by adsorption to glutathione-agarose beads followed by elution in the presence of free glutathione.
- the pGEX vectors are designed to include thrombin or factor Xa protease cleavage sites so that the polypeptide can be released from the GST moiety.
- Cell lines that stably express peptide complexes may be engineered by using a vector that contains a selectable marker.
- engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media.
- the selectable marker in the expression construct confers resistance to the selection and optimally allows cells to stably integrate the expression construct into their chromosomes and to grow in culture and to be expanded into cell lines. Such cells can be cultured for a long period of time while the peptide is expressed continuously.
- the recombinant cells may be cultured under standard conditions of temperature, incubation time, optical density and media composition. However, conditions for growth of recombinant cells may be different from those for expression of the polypeptides. Modified culture conditions and media may also be used to enhance production of the peptides. For example, recombinant cells containing peptides with their cognate promoters may be exposed to heat or other environmental stress, or chemical stress. Any techniques known in the art may be applied to establish the optimal conditions for producing peptide complexes.
- a codon encoding methionine is added at the 5' end of the nucleotide sequence encoding a polypeptide to provide a signal for initiation of translation of the peptide.
- This methionine may remain attached to the polypeptide, or the methionine may be removed by the addition of an enzyme or enzymes that can catalyze the cleavage of methionine from the peptide.
- an enzyme or enzymes that can catalyze the cleavage of methionine from the peptide.
- N-terminal methionine is removed by a methionine aminopeptidase (MAP) (Tsunasawa et al, 1985, J. Biol. Chem. 260, 5382-5391, incorporated herein by reference in its entirety).
- Methionine aminopeptidases have been isolated and cloned from several organisms, including E. coli, yeast, and rat.
- the peptide may be recovered from the bacterial, mammalian, or other host cell types, or from the culture medium, by known methods (see, for example, Current Protocols in Immunology, vol. 2, chapter 8, Coligan et al. (ed.), John Wiley & Sons, Inc.; Pathogenic and Clinical Microbiology: A Laboratory Manual by Rowland et al., Little Brown & Co., June 1994, incorporated herein by reference in its entirety).
- peptide comprising the amino acid sequence of the HSP- binding peptide can be synthesized chemically, and joined to an antigenic peptide, optionally produced by recombinant DNA technology, via a peptide bond.
- derivatives or analogs of the polypeptides disclosed herein that are modified during or after translation, e.g., by glycosylation, acetylation, phosphorylation, amidation (e.g., of the C-terminal carboxyl group), or derivatization by known protecting/blocking groups, or proteolytic cleavage.
- any of numerous chemical modifications may be carried out by known techniques, including but not limited to, reagents useful for protection or modification of free NFL- groups, free COOH- groups, OH- groups, side groups of Trp-, Tyr-, Phe-, His-, Arg-, or Lys-; specific chemical cleavage by cyanogen bromide, hydroxylamine, BNPS-Skatole, acid, or alkali hydrolysis; enzymatic cleavage by trypsin, chymotrypsin, papain, V8 protease, NaBFL:
- the instant disclosure provides a composition (e.g., a pharmaceutical composition) comprising one or more polypeptide as disclosed herein.
- a composition e.g., a pharmaceutical composition
- the instant disclosure provides a composition (e.g., a pharmaceutical composition) comprising one or more (e.g., two or more, three or more, four or more, five or more, ten or more, or 20 or more) different polypeptides as disclosed herein.
- the instant disclosure provides a composition (e.g., a pharmaceutical composition) comprising no more than 30 different polypeptides as disclosed herein.
- the instant disclosure provides a composition (e.g., a pharmaceutical composition) comprising 1 to 30 (e.g., 2 to 20, 3 to 20, 4 to 20, 5 to 20, 5 to 15, or 5 to 10) different polypeptides as disclosed herein.
- the different polypeptides each comprise the same HSP-binding peptide and a different antigenic peptide.
- the composition further comprises a purified stress protein.
- a purified stress protein is useful as a vaccine formulation.
- a method for making a vaccine comprising mixing one or more compositions disclosed herein with a purified stress protein such that the purified stress protein binds to at least one of the HSP-binding antigenic conjugates or peptides.
- the instant disclosure provides a composition (e.g . , a pharmaceutical composition) comprising one or more polypeptides as disclosed herein and a purified stress protein.
- a composition comprising one or more polypeptides as disclosed herein and a purified stress protein.
- at least a portion of the purified stress protein binds to the polypeptide in the composition.
- Such compositions are useful as vaccine formulations for the treatment of a cancer or an infection of a pathogenic microbe.
- the polypeptides prior to complexation with purified stress proteins, may be reconstituted from powder in 100% DMSO. Equimolar amounts of the peptides may then be pooled in a solution of 75% DMSO diluted in sterile water.
- the polypeptides prior to complexation with purified stress proteins, may be reconstituted in neutral water.
- the polypeptides prior to complexation with purified stress proteins, may be reconstituted in acidic water containing HC1.
- the polypeptides prior to complexation with purified stress proteins, may be reconstituted in basic water containing NaOH.
- the solubility of each polypeptide in water may be tested. If a polypeptide is soluble in neutral water, neutral water may be used as a solvent for the polypeptide. If the polypeptide is not soluble in neutral water, solubility in acidic water containing HC1, or another acid, e.g., acetic acid, phosphoric acid, or sulfuric acid may be tested. If the polypeptide is soluble in acidic water containing HC1 (or another acid), acidic water containing HC1 (or another acid) may be used as the solvent for the polypeptide. If the polypeptide is not soluble in acidic water containing HC1 (or another acid), solubility in basic water containing NaOH may be tested.
- polypeptide is soluble in basic water containing NaOH
- basic water containing NaOH may be used as the solvent for the polypeptide.
- the polypeptide may be dissolved in DMSO. If the polypeptide is not soluble in DMSO the polypeptide may be excluded from the vaccine.
- the dissolved polypeptides may then be mixed to make a pool of polypeptides.
- the dissolved polypeptides may be mixed at equal volume.
- the dissolved polypeptides may be mixed in equimolar amounts.
- Stress proteins which are also referred to interchangeably herein as heat shock proteins (HSPs), useful in the practice of the instant invention can be selected from among any cellular protein that is capable of binding other proteins or peptides and capable of releasing the bound proteins or peptides in the presence of adenosine triphosphate (ATP) or under acidic conditions.
- ATP adenosine triphosphate
- the intracellular concentration of such protein may increase when a cell is exposed to a stressful stimulus.
- the HSP60, HSP70, HSP90, HSP100, sHSPs, and PDI families also include proteins that are related to stress-induced HSPs in sequence similarity, for example, having greater than 35% amino acid identity, but whose expression levels are not altered by stress. Therefore, stress protein or heat shock protein embraces other proteins, mutants, analogs, and variants thereof having at least 35% (e.g., at least 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 99%) amino acid identity with members of these families whose expression levels in a cell are enhanced in response to a stressful stimulus.
- stress protein or heat shock protein embraces other proteins, mutants, analogs, and variants thereof having at least 35% (e.g., at least 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 99%) amino acid identity with members of these families whose expression levels in a cell are enhanced in response to a stressful stimulus.
- the stress protein is a member of the hsp60, hsp70, or hsp90 family of stress proteins (e.g., Hsc70, human Hsc70), or a mutant, analog, or variant thereof.
- the stress protein is selected from the group consisting of hsc70, hsp70, hsp90, hspl 10, grpl70, gp96, calreticulin, a mutant thereof, and combinations of two or more thereof.
- the stress protein is Hsc70 (e.g., human Hsc70).
- the stress protein is Hsp70 (e.g., human Hsp70).
- the stress protein (e.g., human hsc70) is a recombinant protein.
- HSP70 Heat Shock 70kDa Protein 1 A
- HGNC 5232
- Entrez Gene 3303
- Ensembl ENSG00000204389
- OMIM 140550;
- mouse Hsp70 Genbank Accession No. M35021, Hunt et al., 1990, Gene, 87: 199-204
- mouse gp96 Genbank Accession No. M16370, Srivastava et al, 1987, Proc. Natl. Acad. Sci., 85:3807-3811
- mouse BiP Genbank Accession No. U16277, Haas et al., 1988, Proc. Natl. Acad. Sci. U.S.A., 85: 2250-2254 (each of these references is incorporated herein by reference in its entirety).
- HSPs/stress proteins belonging to all of these families can be used in the practice of the invention.
- a stress protein encompasses any chaperone protein that facilitates peptide- MHC presentation.
- Suitable chaperone proteins include, but are not limited to, ER chaperones and tapasin ( e.g ., human tapasin).
- the major stress proteins can accumulate to very high levels in stressed cells, but they occur at low to moderate levels in cells that have not been stressed.
- the highly inducible mammalian hsp70 is hardly detectable at normal temperatures but becomes one of the most actively synthesized proteins in the cell upon heat shock (Welch, et al., 1985, J. Cell. Biol. 101 : 1198-1211, incorporated herein by reference in its entirety).
- hsp90 and hsp60 proteins are abundant at normal temperatures in most, but not all, mammalian cells and are further induced by heat (Lai, et al, 1984, Mol. Cell. Biol. 4:2802- 10; van Bergen en Henegouwen, et al, 1987, Genes Dev. 1 :525-31, each of which is incorporated herein by reference in its entirety).
- nucleotide sequences encoding heat shock protein within a family or variants of a heat shock protein can be identified and obtained by hybridization with a probe comprising nucleotide sequence encoding an HSP under conditions of low to medium stringency.
- procedures using such conditions of low stringency are as follows ( see also Shilo and Weinberg, 1981, Proc. Natl. Acad. Sci. USA 78:6789- 6792).
- Filters containing DNA are pretreated for 6 h at 40°C in a solution containing 35% formamide, 5X SSC, 50 mM Tris-HCl (pH 7.5), 5 mM EDTA, 0.1% PVP, 0.1% Ficoll, 1% BSA, and 500 pg/ml denatured salmon sperm DNA.
- Hybridizations are carried out in the same solution with the following modifications: 0.02% PVP, 0.02% Ficoll, 0.2% BSA, 100 pg/ml salmon sperm DNA, 10% (wt/vol) dextran sulfate.
- Filters are incubated in hybridization mixture for 18-20 h at 40°C, and then washed for 1.5 h at 55° C in a solution containing 2 x SSC, 25 mM Tris-HCl (pH 7.4), 5 mM EDTA, and 0.1% SDS. The wash solution is replaced with fresh solution and incubated an additional 1.5 h at 60°C. Filters are blotted dry and exposed for signal detection. If necessary, filters are washed for a third time at 65-68°C before signal detection. Other conditions of low stringency which may be used are well known in the art (e.g., as used for cross-species hybridizations).
- the stress protein is a full-length HSP.
- the stress protein is a polypeptide comprising a domain of an HSP (e.g., a member of the Hsp60, Hsp70, or Hsp90 family, such as Hsc70, particularly human Hsc70), wherein the domain is capable of being noncovalently associated with a peptide (e.g., an HSP-binding peptide as described herein) to form a complex and optionally eliciting an immune response, and wherein the stress protein is not a full-length HSP.
- HSP a member of the Hsp60, Hsp70, or Hsp90 family, such as Hsc70, particularly human Hsc70
- the stress protein is a polypeptide that is capable of being noncovalently associated with a peptide (e.g., an HSP-binding peptide as described herein) to form a complex and optionally eliciting an immune response, wherein the stress protein shares a high degree of sequence similarity with a wild-type HSP (e.g., a member of the Hsp60, Hsp70, or Hsp90 family, such as Hsc70, particularly human Hsc70).
- a wild-type HSP e.g., a member of the Hsp60, Hsp70, or Hsp90 family, such as Hsc70, particularly human Hsc70.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence).
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
- the determination of percent identity between two sequences can also be accomplished using a mathematical algorithm.
- a non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. USA 87:2264-2268, modified as in Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. USA 90:5873-5877 (each of which is incorporated herein by reference in its entirety).
- Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul, et al, 1990, J. Mol. Biol. 215:403-410 (incorporated herein by reference in its entirety).
- BLAST nucleotide searches can be performed with the
- Gapped BLAST can be utilized as described in Altschul et al,
- PSI-Blast can be used to perform an iterated search which detects distant relationships between molecules (Altschul et al, 1997, supra).
- BLAST Altschul et al, 1997, supra.
- Gapped BLAST and PSI-Blast programs
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- Another example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, 1988, CABIOS 4: 11-17. Such an algorithm is incorporated into the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package.
- isolated peptide-binding domains of a stress protein e.g., Hsp70 and Hsc70
- Hsp70 and Hsc70 are employed. These peptide-binding domains can be identified by computer modeling of the three dimensional structure of the peptide-binding site of a stress protein (e.g., Hsp70 and Hsc70). See for example, the peptide-binding fragments of HSPs disclosed in United States patent publication US 2001/0034042 (incorporated herein by reference in its entirety).
- the stress protein is a mutated stress protein which has an affinity for a target polypeptide that is greater than a native stress protein.
- mutated stress proteins can be useful when the target polypeptide is phosphorylated or is a phosphopeptide mimetic (such as non-hydrolyzable analogs) or has some other post- translational modification.
- the stress proteins can be prepared by purification from tissues, or by
- HSPs can be purified from tissues in the presence of ATP or under acidic conditions (pH 1 to pH 6.9), for subsequent in vitro complexing to one or more polypeptides. See Peng, et al, 1997, J. Immunol. Methods, 204: 13-21; Li and Srivastava, 1993, EMBO J. 12:3143-3151 (each of these references is incorporated herein by reference in its entirety).
- “Purified” stress proteins are substantially free of materials that are associated with the proteins in a cell, in a cell extract, in a cell culture medium, or in an individual.
- the stress protein purified from a tissue is a mixture of different HSPs, for example, hsp70 and hsc70.
- the recombinant host cells may contain one or more copies of a nucleic acid sequence comprising a sequence that encodes an HSP or a peptide-binding fragment, operably linked with regulatory region(s) that drives the expression of the HSP nucleic acid sequence in the host cell.
- Recombinant DNA techniques can be readily utilized to generate recombinant HSP genes or fragments of HSP genes, and standard techniques can be used to express such HSP gene fragments.
- Any nucleic acid sequence encoding an HSP peptide-binding domain can be used to prepare the HSPs or peptide-binding fragments of the invention.
- the nucleic acid sequence can be wild- type or a codon-optimized variant that encodes the same amino acid sequence.
- An HSP gene fragment containing the peptide-binding domain can be inserted into an appropriate cloning vector and introduced into host cells so that many copies of the gene sequence are generated.
- vector-host systems such as, but not limited to, bacteriophages such as lambda derivatives, or plasmids such as pBR322, pUC plasmid derivatives, the Bluescript vectors (Stratagene) or the pET series of vectors (Novagen). Any technique for mutagenesis known in the art can be used to modify individual nucleotides in a DNA sequence, for purpose of making amino acid substitution(s) in the expressed peptide sequence, or for creating/deleting restriction sites to facilitate further manipulations.
- bacteriophages such as lambda derivatives, or plasmids such as pBR322, pUC plasmid derivatives, the Bluescript vectors (Stratagene) or the pET series of vectors (Novagen).
- Any technique for mutagenesis known in the art can be used to modify individual nucleotides in a DNA sequence, for purpose of making amino acid substitution(s) in the expressed peptide sequence, or for creating/deleting restriction sites to facilitate further manipulation
- the stress proteins may be expressed as fusion proteins to facilitate recovery and purification from the cells in which they are expressed.
- the stress proteins may contain a signal sequence leader peptide to direct its translocation across the endoplasmic reticulum membrane for secretion into culture medium.
- the stress protein may contain an affinity label fused to any portion of the protein not involved in binding to a target polypeptide, for example, the carboxyl terminus.
- the affinity label can be used to facilitate purification of the protein, by binding to an affinity partner molecule.
- affinity labels known in the art may be used, non-limiting examples of which include the
- Such recombinant stress proteins can be assayed for peptide binding activity (see, e.g., Klappa et al, 1998, EMBO I, 17:927-935, incorporated herein by reference in its entirety) for their ability to elicit an immune response.
- the recombinant stress protein produced in the host cell is of the same species as the intended recipient of the immunogenic composition (e.g., human).
- the stress protein may be bound to the polypeptide(s) non-covalently or covalently.
- the stress protein is non-covalently bound to the polypeptide.
- the molar ratio of total polypeptide(s) to total stress protein(s) can be any ratio from about 0.01: 1 to about 100: 1, including but not limited to about 0.01 : 1, 0.02: 1, 0.05: 1. 0.1: 1. 0.2: 1, 0.5: 1, 1: 1, 1.5: 1, 2: 1, 2.5: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 11 : 1, 12: 1, 13: 1, 14: 1, 15: 1, 16: 1, 17: 1, 18: 1, 19: 1, 20: 1, 30: 1, 40: 1, 49: 1, up to 100: 1.
- the composition comprises a plurality of complexes each comprising a polypeptide disclosed herein and a stress protein, wherein the molar ratio of the polypeptide to the stress protein in each complex is at least about 1 : 1 (e.g. , about 1.5: 1, 2: 1, 2.5: 1, 3: 1,
- the molar ratio of total polypeptide(s) to total stress protein(s) is about 0.5: 1 to 5: 1. In certain embodiments, the molar ratio of total
- polypeptide(s) to total stress protein(s) is about 1 : 1 to 2: 1.
- the molar ratio of total polypeptide(s) to total stress protein(s) is about 1 : 1, 1.25: 1, or 1.5: 1.
- Such ratios, particularly the ratios close to 1 : 1, are advantageous in that the composition does not comprise a great excess of free peptide(s) that is not bound to a stress protein. Since many antigenic peptides comprising MHC-binding epitopes tend to comprise hydrophobic regions, an excess amount of free peptide(s) may tend to aggregate during preparation and storage of the composition.
- Substantial complexation with a stress protein at a molar ratio of total polypeptide(s) to total stress protein(s) close to 1 : 1 is enabled by a high binding affinity of the polypeptide to the stress protein.
- the polypeptide binds to an HSP (e.g., Hsc70, Hsp70, Hsp90, Hspl 10, Grpl70, Gp96, or Calreticulin) with a K d lower than 10 3 M, 10 4 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, or 10 9 M.
- HSP e.g., Hsc70, Hsp70, Hsp90, Hspl 10, Grpl70, Gp96, or Calreticulin
- the polypeptide binds to Hsc70 (e.g. , human Hsc70) with a K d of 10 3 M, 10 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, 10 9 M, or lower.
- Hsc70 e.g. , human Hsc70
- K d 10 3 M, 10 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, 10 9 M, or lower.
- At least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% of the stress protein binds to the polypeptide in the composition. In certain embodiments, substantially all of the stress protein binds to the polypeptide in the composition.
- compositions comprise no more than 100 different polypeptides, e.g. , 2-50, 2-30, 2-20, 5-20, 5-15, 5-10, or 10-15 different
- compositions of the invention can be formulated to contain one or more pharmaceutically acceptable carriers or excipients including bulking agents, stabilizing agents, buffering agents, sodium chloride, calcium salts, surfactants, antioxidants, chelating agents, other excipients, and combinations thereof.
- Bulking agents are preferred in the preparation of lyophilized formulations of the vaccine composition. Such bulking agents form the crystalline portion of the lyophilized product and may be selected from the group consisting of mannitol, glycine, alanine, and hydroxy ethyl starch (HES).
- Stabilizing agents may be selected from the group consisting of sucrose, trehalose, raffmose, and arginine. These agents are preferably present in amounts between 1-4%.
- Sodium chloride can be included in the present formulations preferably in an amount of 100- 300 mM, or if used without the aforementioned bulking agents, can be included in the formulations in an amount of between 300-500 mM NaCl.
- Calcium salts include calcium chloride, calcium gluconate, calcium glubionate, or calcium gluceptate.
- Buffering agents can be any physiologically acceptable chemical entity or combination of chemical entities which have a capacity to act as buffers, including but not limited to histidine, potassium phosphate, TRIS [tris-(hydroxymethyl)-aminomethane], BIS- Tris Propane (l,3-bis-[tris-(hydroxymethyl)methylamino]-propane), PIPES [piperazine-N,N'- bis-(2-ethanesulfonic acid)], MOPS [3-(N-morpholino)ethanesulfonic acid], HEPES (N-2- hydroxyethyl-piperazine-N'-2-ethanesulfonic acid), MES [2-(N-morpholino)ethanesulfonic acid], and ACES (N-2-acetamido-2-aminoethanesulfonic acid).
- TRIS tris-(hydroxymethyl)-aminomethane
- BIS- Tris Propane l,3-bis-[tris
- the buffering agent is included in a concentration of 10-50 mM.
- base buffers include (i) PBS; (ii) lOmM KP0 4 , 150 mM NaCl; (iii) 10 mM HEPES, 150 mM NaCl; (iv) 10 mM imidazole, 150 mM NaCl; and (v) 20 mM sodium citrate.
- Excipients that can be used include (i) glycerol (10%, 20%); (ii) Tween 50 (0.05%, 0.005%); (iii) 9% sucrose; (iv) 20% sorbitol; (v) 10 mM lysine; or (vi) 0.01 mM dextran sulfate.
- Surfactants are preferably in a concentration of 0.1% or less, and may be chosen from the group including but not limited to polysorbate 20, polysorbate 80, pluronic polyols, and BRIJ 35 (polyoxyethylene 23 laurel ether).
- Antioxidants if used, must be compatible for use with a pharmaceutical preparation, and are preferably water soluble.
- Suitable antioxidants include homocysteine, glutathione, lipoic acid, 6-hydroxy-2, 5,7,8- tetramethylchroman-2-carboxylic acid (Trolox), methionine, sodium thiosulfate, platinum, glycine-glycine-histidine (tripeptide), and butylatedhydroxytoluene (BHT).
- Chelating agents should preferably bind metals such as copper and iron with greater affinity than calcium, if a calcium salt is being used in the composition.
- An exemplary chelator is deferoxamine.
- U.S. Patent No. 5,763,401 describes a therapeutic formulation, comprising 15-60 mM sucrose, up to 50 mM NaCl, up to 5 mM calcium chloride, 65-400 mM glycine, and up to 50 mM histidine.
- the therapeutic formulation is a solution of 9% sucrose in potassium phosphate buffer.
- U.S. Patent No. 5,733,873 discloses formulations which include between 0.01-1 mg/ml of a surfactant.
- This patent discloses formulations having the following ranges of excipients: polysorbate 20 or 80 in an amount of at least 0.01 mg/ml, preferably 0.02-1.0 mg/ml; at least 0.1 M NaCl; at least 0.5 mM calcium salt; and at least 1 mM histidine.
- the following specific formulations are also disclosed: (1) 14.7-50-65 mM histidine, 0.31-0.6 M NaCl, 4 mM calcium chloride, 0.001-0.02-0.025% polysorbate 80, with or without 0.1% PEG 4000 or 19.9 mM sucrose; and (2) 20 mg/ml mannitol, 2.67 mg/ml histidine, 18 mg/ml NaCl, 3.7 mM calcium chloride, and 0.23 mg/ml polysorbate 80.
- U.S. Patent No. 5,605,884 (incorporated herein by reference in its entirety) teaches the use of formulations with relatively high concentrations of sodium chloride. These formulations include 0.35 M-1.2 M NaCl, 1.5-40 mM calcium chloride, 1 mM-50 mM histidine, and up to 10% sugar such as mannitol, sucrose, or maltose. A formulation comprising 0.45 M NaCl, 2.3 mM calcium chloride, and 1.4 mM histidine is exemplified.
- U.S. Patent No. 5,328,694 (incorporated herein by reference in its entirety) describes a formulation which includes 100-650 mM disaccharide and 100 mM-l.O M amino acid, for example (1) 0.9 M sucrose, 0.25 M glycine, 0.25 M lysine, and 3 mM calcium chloride; and (2) 0.7 M sucrose, 0.5 M glycine, and 5 mM calcium chloride.
- Pharmaceutical compositions can be optionally prepared as lyophilized product, which may then be formulated for oral administration or reconstituted to a liquid form for parenteral
- the composition stimulates a T-cell response against a cell expressing or displaying a polypeptide comprising one or more of the MHC-binding epitopes in a subject to whom the composition is administered.
- the cell expressing the polypeptide may be a cell comprising a polynucleotide encoding the polypeptide, wherein the polynucleotide is in the genome of the cell, in an episomal vector, or in the genome of a virus that has infected the cell.
- the cell displaying the polypeptide may not comprise a
- polynucleotide encoding the polypeptide may be produced by contacting the cell with the polypeptide or a derivative thereof.
- the composition induces in vitro activation of T cells in peripheral blood mononuclear cells (PBMCs) isolated from a subject.
- PBMCs peripheral blood mononuclear cells
- the in vitro activation of T cells includes, without limitation, in vitro proliferation of T cells, production of cytokines (e.g., IFNy) from T cells, and increased surface expression of activation markers (e.g, CD25, CD45RO) on T cells.
- the instant disclosure provides a method of making a vaccine, the method comprising mixing one or more polypeptides as disclosed herein with a purified stress protein in vitro under suitable conditions such that the purified stress protein binds to at least one of the polypeptides.
- the method is also referred to as a complexing reaction herein.
- two or more purified stress proteins are employed, wherein each purified stress protein binds to at least one of the polypeptides.
- the stress protein may be bound to the polypeptide non-covalently or covalently.
- the stress protein is non-covalently bound to the polypeptide.
- the complexes formed in vitro are optionally purified. Purified complexes of stress proteins and polypeptides are substantially free of materials that are associated with such complexes in a cell, or in a cell extract. Where purified stress proteins and purified polypeptides are used in an in vitro complexing reaction, the term“purified complex(es)” does not exclude a composition that also comprises free stress proteins and conjugates or peptides not in complexes.
- any stress proteins described supra may be employed in the method of the invention.
- the stress protein is selected from the group consisting of Hsc70, Hsp70, Hsp90, Hspl 10, Grpl70, Gp96, Calreticulin, a mutant thereof, and combinations of two or more thereof.
- the stress protein is an Hsc70, e.g., a human Hsc70.
- the stress protein is an Hsp70, e.g., a human Hsp70.
- the stress protein (e.g., human Hsc70 or human Hsp70) is a recombinant protein.
- HSPs Prior to complexing, HSPs can be pretreated with ATP or exposed to acidic conditions to remove any peptides that may be non-covalently associated with the HSP of interest.
- Acidic conditions are any pH levels below pH 7, including the ranges pH l-pH 2, pH 2-pH 3, pH 3-pH 4, pH 4-pH 5, pH 5-pH 6, and pH 6-pH 6.9.
- ATP adenosine triphosphate
- excess ATP is removed from the preparation by the addition of apyranase as described by Levy, et al, 1991, Cell 67:265-274 (incorporated herein by reference in its entirety).
- the buffer is readjusted to neutral pH by the addition of pH modifying reagents.
- the molar ratio of total polypeptide(s) to total stress protein(s) can be any ratio from 0.01:1 to 100:1, including but not limited to 0.01:1, 0.02:1, 0.05:1.0.1:1.0.2:1, 0.5:1, 1:1, 1.5:1, 2:1, 2.5:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, 20:1, 30:1, 40:1, 49:1, up to 100:1.
- the composition to be prepared comprises a plurality of complexes each comprising a polypeptide disclosed herein and a stress protein
- the complexing reaction comprises mixing the polypeptides with the stress proteins, wherein the molar ratio of the polypeptide to the stress protein in each complex is at least 1:1 (e.g., about 2: 1,3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, 20:1, 30:1,40:1, 49:1, up to 100:1).
- the molar ratio of total polypeptide(s) to total stress protein(s) is about 0.5: 1 to 5: 1. In certain embodiments, the molar ratio of total
- polypeptide(s) to total stress protein(s) is about 1:1 to 2:1.
- the molar ratio of total polypeptide(s) to total stress protein(s) is about 1:1, 1.25:1, or 1.5:1.
- Such ratios, particularly the ratios close to 1 : 1, are advantageous in that the composition does not comprise a great excess of free peptide(s) that is not bound to a stress protein. Since many antigenic peptides comprising MHC-binding epitopes tend to comprise hydrophobic regions, an excess amount of free peptide(s) may tend to aggregate during preparation and storage of the composition.
- Substantial complexation with a stress protein at a molar ratio of total polypeptide(s) to total stress protein(s) close to 1:1 is enabled by a high binding affinity of the polypeptide to the stress protein.
- the polypeptide used in the complexing reaction binds to an HSP (e.g., Hsc70, Hsp70, Hsp90, Hspl 10, Grp 170, Gp96, or Calreticulin) with a K d lower than 10 3 M, 10 4 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, or 10 9 M.
- the polypeptide binds to Hsc70 (e.g., human Hsc70) with a K d of 10 3 M, 10 4 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, 10 9 M, or lower.
- Hsc70 e.g., human Hsc70
- K d 10 3 M, 10 4 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, 10 9 M, or lower.
- the method disclosed herein can be used to prepare a composition (e.g., a pharmaceutical composition or a vaccine) in bulk (e.g., greater than or equal to 30 mg, 50 mg, 100 mg, 200 mg, 300 mg, 500 mg, or 1 g of total peptide and protein).
- the prepared composition can then be transferred to single-use or multi-use containers, or apportioned to unit dosage forms.
- method disclosed herein can be used to prepare a composition (e.g., a pharmaceutical composition or a vaccine) in a small amount (e.g., less than or equal to 300 pg, 1 mg, 3 mg, 10 mg, 30 mg, or 100 mg of total peptide and protein).
- the composition is prepared for single use, optionally in a unit dosage form.
- the total amount of the polypeptide(s) and stress protein in the pharmaceutical composition is about 10 pg to 600 pg (e.g., about 50 pg, 100 pg, 200 pg, 300 pg, 400 pg, or 500 pg). In certain embodiments, the total amount of the
- polypeptide(s) and stress protein in the pharmaceutical composition is about 300 pg.
- Amounts of the stress protein(s) and polypeptide(s) in a unit dosage form are disclosed infra.
- the population of polypeptides can comprise a mixture of the different polypeptide species of the invention. Then, the mixture is incubated with the purified and/or pretreated stress protein for from 15 minutes to 3 hours (e.g., 1 hour) at from 4° to 50° C (e.g., 37° C) in a suitable binding buffer, such as phosphate buffered saline pH 7.4 optionally supplemented with 0.01% Polysorbate 20; a buffer comprising 9% sucrose in potassium phosphate buffer; a buffer comprising 2.7 mM Sodium Phosphate Dibasic, 1.5 mM Potassium Phosphate Monobasic, 150 mM NaCl, pH 7.2; a buffer containing 20 mM sodium phosphate, pH 7.2-7.5, 350-500 mM NaCl, 3 mM MgCh and 1 m
- any buffer may be used that is compatible with the stress protein.
- the preparations are then optionally purified by centrifugation through a Centricon 10 assembly (Millipore; Billerica, MA) to remove any unbound peptide.
- HPLC High Performance Liquid Chromatography
- MS Mass Spectrometry
- MLTC mixed lymphocyte target cell assay
- ELISPOT enzyme-linked immunospot
- compositions before administration to a subject.
- the composition is prepared within 1, 2, 3, 4, 5, 6, or 7 days before administration to a subject.
- the composition is prepared within 1, 2, 3, 4, 5, 6, 7, or 8 weeks before administration to a subject.
- the composition is prepared within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months before administration to a subject.
- the composition can optionally be stored at about 4 °C, - 20 °C, or -80 °C after preparation and before use.
- the complexes prepared by the method disclosed herein are mixed with an adjuvant at bedside just prior to administration to a patient.
- the adjuvant comprises a saponin or an immunostimulatory nucleic acid.
- the adjuvant comprises QS-21.
- the dose of QS-21 is 10 pg, 25 pg, or 50 pg.
- the dose of QS-21 is 50 pg.
- the adjuvant comprises a TLR agonist.
- the TRL agonist is an agonist of TLR4.
- the TRL agonist is an agonist of TLR7 and/or TLR8.
- the TRL agonist is an agonist of TLR9.
- the TRL agonist is an agonist of TLR5.
- the polypeptides can be covalently attached to stress proteins, e.g., by chemical crossbnking or UV crossbnking. Any chemical crossbnking or UV crosslinking methods known in the art (see, e.g., Wong, 1991, Chemistry of Protein Conjugation and Cross- Linking, CRC Press, incorporated herein by reference in its entirety) can be employed. For example, glutaraldehyde crossbnking (see, e.g., Barrios et al, 1992, Eur. J. Immunol. 22: 1365-1372, incorporated herein by reference in its entirety) may be used.
- HSP-peptide complex is cross-linked in the presence of 0.002% glutaraldehyde for 2 hours.
- Glutaraldehyde is removed by dialysis against phosphate buffered saline (PBS) overnight (Lussow et al, 1991, Eur. J. Immunol. 21 : 2297-2302, incorporated herein by reference in its entirety).
- PBS phosphate buffered saline
- compositions disclosed herein are useful as vaccines. Accordingly, in another aspect, the instant disclosure provides a vaccine formulation.
- the vaccine formulation may be prepared by any method that results in a stable, sterile, preferably injectable formulation.
- the vaccine comprises one or more compositions disclosed herein and one or more adjuvants.
- a variety of adjuvants may be employed, including, for example, systemic adjuvants and mucosal adjuvants.
- a systemic adjuvant is an adjuvant that can be delivered parenterally.
- Systemic adjuvants include adjuvants that create a depot effect, adjuvants that stimulate the immune system, and adjuvants that do both.
- An adjuvant that creates a depot effect is an adjuvant that causes the antigen to be slowly released in the body, thus prolonging the exposure of immune cells to the antigen.
- This class of adjuvants includes alum (e.g., aluminum hydroxide, aluminum phosphate); or emulsion-based formulations including mineral oil, non-mineral oil, water-in-oil or oil-in- water-in oil emulsion, oil-in-water emulsions such as Seppic ISA series of Montanide adjuvants (e.g., Montanide ISA 720, AirLiquide, Paris, France); MF-59 (a squalene-in-water emulsion stabilized with Span 85 and Tween 80; Chiron Corporation, Emeryville, Calif.; and PROVAX (an oil-in- water emulsion containing a stabilizing detergent and a micelle-forming agent; IDEC, Pharmaceuticals Corporation, San Diego, Calif.).
- alum e.g., aluminum hydroxide, aluminum phosphate
- emulsion-based formulations including mineral oil, non-mineral oil, water-in-oil or oil-in- water-
- adjuvants stimulate the immune system, for instance, cause an immune cell to produce and secrete cytokines or IgG.
- This class of adjuvants includes immunostimulatory nucleic acids, such as CpG oligonucleotides; saponins purified from the bark of the Q.
- RNA mimetics such as polyinosinic:polycytidylic acid (poly I:C) or poly I:C stabilized with poly-lysine (poly-ICLC [Hiltonol®; Oncovir, Inc.];
- LPS lipopoly saccharides
- MPL monophosphoryl lipid A
- MDP muramyl dipeptide
- t-MDP threonyl-muramyl dipeptide
- OM-174 a glucosamine disaccharide related to lipid A
- OM Pharma SA Meyrin, Switzerland
- Leishmania elongation factor a purified Leishmania protein; Corixa Corporation, Seattle, Wash.
- systemic adjuvants are adjuvants that create a depot effect and stimulate the immune system. These compounds have both of the above-identified functions of systemic adjuvants.
- This class of adjuvants includes but is not limited to ISCOMs (Immunostimulating complexes which contain mixed saponins, lipids and form virus-sized particles with pores that can hold antigen; CSL, Melbourne, Australia); AS01 which is a liposome based formulation containing MPL and QS-21 (GlaxoSmithKline, Belgium); AS02
- GlaxoSmithKline, Rixensart, Belgium GlaxoSmithKline, Rixensart, Belgium
- AS04 GaxoSmithKline, which contains alum and MPL; GSK, Belgium
- AS 15 which is a liposome based formulation containing CpG oligonucleotides, MPL and QS-21 (GlaxoSmithKline, Belgium); non-ionic block copolymers that form micelles such as CRL 1005 (these contain a linear chain of hydrophobic polyoxypropylene flanked by chains of polyoxyethylene; Vaxcel, Inc., Norcross, Ga.); and Syntex Adjuvant Formulation (SAF, an oil-in-water emulsion containing Tween 80 and a nonionic block copolymer; Syntex Chemicals, Inc., Boulder, Colo.).
- SAF Syntex Adjuvant Formulation
- the mucosal adjuvants useful according to the invention are adjuvants that are capable of inducing a mucosal immune response in a subject when administered to a mucosal surface in conjunction with complexes of the invention.
- Mucosal adjuvants include CpG nucleic acids ( e.g .
- CT Cholera toxin
- CT derivatives including but not limited to CT B subunit (CTB); CTD53 (Val to Asp); CTK97 (Val to Lys); CTK104 (Tyr to Lys); CTD53/K63 (Val to Asp, Ser to Lys); CTH54 (Arg to His); CTN107 (His to Asn); CTE114 (Ser to Glu); CTE112K (Glu to Lys); CTS61F (Ser to Phe); CTS 106 (Pro to Lys); and CTK63 (Ser to Lys), Zonula occludens toxin (zot), Escherichia coli heat-labile enterotoxin, Labile Toxin (LT), LT derivatives including but not limited to LT B subunit (LTB); LT7K (Arg to Lys); LT61F (Ser to Phe);
- PT-9K/129G including PT-9K/129G; Toxin derivatives (see below); Lipid A derivatives (e.g., monophosphoryl lipid A, MPL); Muramyl Dipeptide (MDP) derivatives; bacterial outer membrane proteins (e.g., outer surface protein A (OspA) lipoprotein of Borrelia burgdorferi, outer membrane protein of Neisseria meningitidis ); oil-in-water emulsions (e.g., MF59; aluminum salts (Isaka et al., 1998, 1999); and Saponins (e.g., QS-21, e.g., QS-21 Stimulon ® , Antigenics LLC, Lexington, Mass.), ISCOMs, MF-59 (a squalene-in- water emulsion stabilized with Span 85 and Tween 80; Chiron Corporation, Emeryville, Calif.); the Seppic ISA series of Montanide adjuvants (e.g.
- PCPP polymer Poly[di(carboxylatophenoxy)]phosphazene (PCPP polymer; Virus Research Institute, USA) and Leishmania elongation factor (Corixa Corporation, Seattle, Wash.).
- the adjuvant added to the compositions disclosed herein comprises a saponin and/or an immunostimulatory nucleic acid. In certain embodiments, the adjuvant added to the composition comprises or further comprises QS-21. [00174] In certain embodiments, the adjuvant added to the compositions disclosed herein comprises a Toll-like receptor (TLR) agonist. In certain embodiments, the TRL agonist is an agonist of TLR4. In certain embodiments, the TRL agonist is an agonist of TLR7 and/or TLR8. In certain embodiments, the TRL agonist is an agonist of TLR9. In certain embodiments, the TRL agonist is an agonist of TLR5.
- TLR Toll-like receptor
- compositions of the invention described herein may be combined with an adjuvant in several ways.
- different polypeptides may be mixed together first to form a mixture and then complexed with stress protein(s) and/or adjuvant(s) to form a composition.
- different polypeptides may be complexed individually with a stress protein and/or adjuvant(s), and the resulting batches of complexes may then be mixed to form a composition.
- the adjuvant can be administered prior to, during, or following administration of the compositions comprising complexes of stress protein and polypeptides. Administration of the adjuvant and the compositions can be at the same or different administration sites.
- the instant disclosure provides a unit dosage form of a pharmaceutical composition or vaccine disclosed herein.
- the amounts and concentrations of the polypeptides, stress proteins, and/or adjuvants at which the efficacy of a vaccine formulation of the invention may vary depending on the chemical nature and the potency of the polypeptides, stress proteins, and/or adjuvants.
- the starting amounts and concentrations in the vaccine formulation are the ones conventionally used for eliciting the desired immune response, using the conventional routes of administration, e.g., intramuscular injection.
- the amounts and concentrations of the peptides, conjugates, stress proteins, and/or adjuvants can then be adjusted, e.g., by dilution using a diluent, so that an effective protective immune response is achieved as assessed using standard methods known in the art (e.g., determined by the antibody or T-cell response to the vaccine formulation relative to a control formulation).
- the total amount of the polypeptides and stress protein in the pharmaceutical composition is about 10 pg to 600 pg (e.g., about 50 pg, 100 pg, 200 pg, 300 pg, 400 pg, or 500 pg). In certain embodiments, the total amount of the polypeptides and stress protein in the pharmaceutical composition is about 300 pg. In certain embodiments, the amount of the stress protein in the composition is about 250 pg to 290 pg.
- the amount of the stress protein in the pharmaceutical composition is about 10 pg to 600 pg (e.g., about 50 pg, 100 pg, 200 pg, 300 pg, 400 pg, or 500 mg). In certain embodiments, the amount of the stress protein in the pharmaceutical composition is about 300 pg.
- the amount of the polypeptide is calculated based on a designated molar ratio and the molecular weight of the polypeptides.
- the total molar amount of the polypeptides in the unit dosage form of the pharmaceutical composition is about 0.1 to 10 nmol (e.g., about 0.1 nmol, 0.5 nmol, 1 nmol, 2 nmol, 3 nmol, 4 nmol, 5 nmol, 6 nmol, 7 nmol, 8 nmol, 9 nmol, or 10 nmol). In certain embodiments, the total molar amount of the polypeptides in the unit dosage form of the pharmaceutical composition is about 4 nmol. In certain embodiments, the total molar amount of the polypeptides in the unit dosage form of the pharmaceutical composition is about 5 nmol.
- the molar ratio of total polypeptides to total stress proteins can be any ratio from about 0.01:1 to about 100:1, including but not limited to about 0.01:1, 0.02:1, 0.05:1.0.1:1. 0.2:1, 0.5:1, 1:1, 1.5:1, 2:1, 2.5:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, 20:1, 30:1, 40:1, 49:1, up to 100:1.
- the composition comprises a plurality of complexes each comprising a polypeptide and a stress protein, wherein the molar ratio of the polypeptide to the stress protein in each complex is at least about 1:1 (e.g., about 1.5:1, 2:1, 2.5:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, 20:1, 30:1,40:1,49:1, up to 100:1). In certain embodiments, the molar ratio of total polypeptide(s) to total stress protein(s) is about 0.5:1 to 5:1.
- the molar ratio of total polypeptide(s) to total stress protein(s) is about 1:1 to 2:1. In certain embodiments, the molar ratio of total polypeptide(s) to total stress protein(s) is about 1:1, 1.25:1, or 1.5:1. Such ratios, particularly the ratios close to 1 : 1 , are advantageous in that the composition does not comprise a great excess of free peptide(s) that is not bound to a stress protein. Since many antigenic peptides comprising MHC-binding epitopes tend to comprise hydrophobic regions, an excess amount of free peptide(s) may tend to aggregate during preparation and storage of the composition.
- Substantial complexation with a stress protein at a molar ratio of total polypeptide(s) to total stress protein(s) close to 1:1 is enabled by a high binding affinity of the polypeptide to the stress protein.
- the polypeptide binds to an HSP (e.g, Hsc70, Hsp70, Hsp90, HspllO, Grpl70, Gp96, or Calreticulin) with a K d lower than 10 3 M, 10 4 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, or 10 9 M.
- the polypeptide binds to Hsc70 (e.g., human Hsc70) with a Kd of 10 3 M, 10 4 M, 10 5 M, 10 6 M, 10 7 M, 10 8 M, 10 9 M, or lower.
- Hsc70 e.g., human Hsc70
- Methods of calculating the amounts of components in the unit dosage form are provided.
- the polypeptides have an average molecular weight of about 3 kD, and the molecular weight of Hsc70 is about 71 kD. Assuming in one embodiment that the total amount of the polypeptides and stress protein in the pharmaceutical composition is 300 pg, and the molar ratio of the polypeptides to hsc70 is 1.5: 1.
- the molar amount of Hsc70 can be calculated as 300 pg divided by 71 kD + 1.5 x 3 kD, resulting in about 4.0 nmol, and the mass amount of Hsc70 can be calculated by multiplying the molar amount with 71 kD, resulting in about 280 kD.
- the total molar amount of the polypeptides can be calculated as 1.5 c 4.0 nmol, resulting in 6.0 nmol. If 10 different polypeptides are employed, the molar amount of each polypeptide is 0.60 nmol.
- the molar ratio of polypeptides to Hsc70 is 1.5: 1.
- the total molar amount of the polypeptides can be calculated as 300 pg divided by 71 kD then times 1.5, resulting in 6.3 nmol. If 10 different polypeptides are employed, the molar amount of each polypeptide is 0.63 nmol. In cases where one or more of the variables are different from those in the examples, the quantities of the stress proteins and of the polypeptides are scaled accordingly.
- the unit dosage form can optionally comprise one or more adjuvants as disclosed supra.
- the adjuvant comprises a saponin and/or an immunostimulatory nucleic acid.
- the adjuvant comprises or further comprises QS-21.
- the amount of QS-21 in the unit dosage form of pharmaceutical composition is 10 pg, 25 pg, or 50 pg.
- the amount of QS-21 in the unit dosage form of pharmaceutical composition is 50 pg.
- the adjuvant comprises a Toll-like receptor (TLR) agonist.
- TLR Toll-like receptor
- the TRL agonist is an agonist of TLR4. In certain embodiments, the TRL agonist is an agonist of TLR7 and/or TLR8. In certain embodiments, the TRL agonist is an agonist of TLR9. In certain embodiments, the TRL agonist is an agonist of TLR5.
- compositions e.g.. pharmaceutical compositions
- vaccine formulations e.g., and unit dosage forms disclosed herein are useful for inducing a cellular immune response.
- Stress proteins can deliver immunogenic peptides through the cross-presentation pathway in antigen presenting cells (APCs) (e.g., macrophages and dendritic cells (DCs) via membrane receptors (mainly CD91) or by binding to Toll-like receptors, thereby leading to activation of CD8 + and CD4 + T cells.
- APCs antigen presenting cells
- DCs dendritic cells
- the instant disclosure provides a method of inducing a cellular immune response to an antigenic peptide in a subject, the method comprising administering to the subject an effective amount of a composition, vaccine formulations, or unit dosage form as disclosed herein.
- the instant disclosure provides a method of treating a disease (e.g., cancer or infection) in a subject, the method comprising administering to the subject an effective amount of a composition, vaccine formulations, or unit dosage form as disclosed herein.
- the compositions e.g., pharmaceutical compositions), vaccine formulations, and unit dosage forms disclosed herein can also be used in preparing a medicament or vaccine for the treatment of a subject.
- such subjects can be an animal, e.g., a mammal, a non- human primate, and a human.
- the term“animal” includes companion animals, such as cats and dogs; zoo animals; wild animals, including deer, foxes and raccoons; farm animals, livestock and fowl, including horses, cattle, sheep, pigs, turkeys, ducks, and chickens, and laboratory animals, such as rodents, rabbits, and guinea pigs.
- the subject has cancer.
- the subject has infection of a pathogenic microbe.
- compositions, vaccine formulations, or unit dosage forms of the invention can be used alone or in combination with other therapies for the treatment of cancer.
- One or more of the MHC-binding epitopes in the HSP-binding antigenic conjugate(s) or peptide(s) can be present in the subject’s cancer cells.
- one or more of the MHC-binding epitopes are common to or frequently found in the type and/or stage of the cancer.
- the term“frequently found in cancers” refers to one or more mutant MHC-binding epitopes that are found in greater than 5% of cancers.
- one or more of the MHC-binding epitopes are specific to the cancer of the subject.
- Cancers that can be treated using the compositions, vaccine formulations, or unit dosage forms of the invention include, without limitation, a solid tumor, a hematological cancer (e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma), and a metastatic lesion.
- a solid tumor e.g., a hematological cancer (e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma)
- a metastatic lesion e.g., the cancer is a solid tumor.
- solid tumors include malignancies, e.g., sarcomas and carcinomas, e.g., adenocarcinomas of the various organ systems, such as those affecting the lung, breast, ovarian, lymphoid, gastrointestinal (e.g., colon), anal, genitals and genitourinary tract (e.g., renal, urothelial, bladder cells, prostate), pharynx, CNS (e.g., brain, neural or glial cells), head and neck, skin (e.g., melanoma), and pancreas, as well as adenocarcinomas which include malignancies such as colon cancers, rectal cancer, renal-cell carcinoma, liver cancer, lung cancer (e.g., non-small cell lung cancer or small cell lung cancer), cancer of the small intestine and cancer of the esophagus.
- the cancer may be at an early, intermediate, late stage or metastatic cancer.
- the cancer is associated with elevated PD
- the cancer is chosen from a lung cancer (e.g., lung adenocarcinoma or a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology, or a NSCLC adenocarcinoma)), a melanoma (e.g.
- a lung cancer e.g., lung adenocarcinoma or a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology, or a NSCLC adenocarcinoma)
- NSCLC non-small cell lung cancer
- a melanoma e.g.
- an advanced melanoma a renal cancer (e.g., a renal cell carcinoma), a liver cancer (e.g., hepatocellular carcinoma or intrahepatic cholangiocellular carcinoma), a myeloma (e.g., a multiple myeloma), a prostate cancer, a breast cancer (e.g., a breast cancer that does not express one, two or all of estrogen receptor, progesterone receptor, or Her2/neu, e.g., a triple negative breast cancer), an ovarian cancer, a colorectal cancer, a pancreatic cancer, a head and neck cancer (e.g., head and neck squamous cell carcinoma (HNSCC), anal cancer, gastro esophageal cancer (e.g., esophageal squamous cell carcinoma), mesothelioma,
- a renal cancer e.g., a renal cell carcinoma
- a liver cancer e.g., hepatocellular
- the cancer is NSCLC.
- the cancer is a renal cell carcinoma.
- the cancer is an ovarian cancer, optionally wherein the ovarian cancer is associated with human papillomavirus (HPV) infection.
- the ovarian cancer is a platinum-refractory ovarian cancer.
- the cancer is a hematological cancer, for example, a leukemia, a lymphoma, or a myeloma.
- the cancer is a leukemia, for example, acute lymphoblastic leukemia (ALL), acute myelogenous leukemia (AML), acute myeloblastic leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myeloid leukemia (CML), chronic myelomonocytic leukemia (CMML), chronic lymphocytic leukemia (CLL), or hairy cell leukemia.
- ALL acute lymphoblastic leukemia
- AML acute myelogenous leukemia
- AML acute myeloblastic leukemia
- CLL chronic lymphocytic leukemia
- CML chronic myelogenous leukemia
- CML chronic myeloid leukemia
- CML chronic myelomonocytic leukemia
- the cancer is a lymphoma, for example, B cell lymphoma, diffuse large B-cell lymphoma (DLBCL), activated B-cell like (ABC) diffuse large B cell lymphoma, germinal center B cell (GCB) diffuse large B cell lymphoma, mantle cell lymphoma, Hodgkin lymphoma, non- Hodgkin lymphoma, relapsed non-Hodgkin lymphoma, refractory non-Hodgkin lymphoma, recurrent follicular non-Hodgkin lymphoma, Burkitt lymphoma, small lymphocytic lymphoma, follicular lymphoma, lymphoplasmacytic lymphoma, or extranodal marginal zone lymphoma.
- the cancer is a myeloma, for example, multiple myeloma.
- the cancer is chosen from a carcinoma (e.g., advanced or metastatic carcinoma), melanoma or a lung carcinoma, e.g., a non-small cell lung carcinoma.
- a carcinoma e.g., advanced or metastatic carcinoma
- melanoma e.g., a non-small cell lung carcinoma.
- the cancer is a lung cancer, e.g., a lung adenocarcinoma, non small cell lung cancer or small cell lung cancer.
- the cancer is a melanoma, e.g., an advanced melanoma. In one embodiment, the cancer is an advanced or unresectable melanoma that does not respond to other therapies. In other embodiments, the cancer is a melanoma with a BRAF mutation (e.g., a BRAF V600 mutation). In yet other embodiments, the compositions, vaccine formulations, or unit dosage forms disclosed herein is administered after treatment with an anti-CTLA-4 antibody (e.g., ipilimumab) with or without a BRAF inhibitor (e.g.,
- the cancer is a hepatocarcinoma, e.g., an advanced hepatocarcinoma, with or without a viral infection, e.g., a chronic viral hepatitis.
- a hepatocarcinoma e.g., an advanced hepatocarcinoma
- a viral infection e.g., a chronic viral hepatitis.
- the cancer is a prostate cancer, e.g., an advanced prostate cancer.
- the cancer is a myeloma, e.g., multiple myeloma.
- the cancer is a renal cancer, e.g., a renal cell carcinoma (RCC) (e.g., a metastatic RCC, clear cell renal cell carcinoma (CCRCC) or kidney papillary cell carcinoma).
- RCC renal cell carcinoma
- CCRCC clear cell renal cell carcinoma
- the cancer is chosen from a lung cancer, a melanoma, a renal cancer, a breast cancer, a colorectal cancer, a leukemia, or a metastatic lesion of the cancer.
- compositions, vaccine formulations, or unit dosage forms of the invention may be administered when a cancer is detected, or prior to or during an episode of recurrence.
- Administration can begin at the first sign of cancer or recurrence, followed by boosting doses until at least symptoms are substantially abated and for a period thereafter.
- the compositions can be administered to a subject with cancer who has undergone tumor resection surgery that results in an insufficient amount of resected tumor tissue (e.g., less than 7 g, less than 6 g, less than 5 g, less than 4 g, less than 3 g, less than 2 g, or less than 1 g of resected tumor tissue) for production of a therapeutically effective amount of an autologous cancer vaccine comprising a representative set of antigens collected from the resected tumor tissue.
- an autologous cancer vaccine comprising a representative set of antigens collected from the resected tumor tissue.
- compositions, vaccine formulations, and unit dosage forms of the invention can also be used for immunization against recurrence of cancers.
- Prophylactic administration of a composition to an individual can confer protection against a future recurrence of a cancer.
- compositions, vaccine formulations, or unit dosage forms of the invention can be used alone or in combination with other therapies for the treatment of a microbial infection (e.g., a pathogenic microbial infection).
- a microbial infection e.g., a pathogenic microbial infection.
- One or more of the MHC-binding epitopes in the HSP-binding antigenic conjugate(s) or peptide(s) can be identified from the microbe.
- one or more of the MHC-binding epitopes are present at the surface of the microbe or a cell infected with the microbe.
- Infections that can be treated using the compositions, vaccine formulations, or unit dosage forms of the invention include, without limitation, a viral infection, a bacterial infection, a fungal infection, a protozoal infection, or a parasitic infection.
- Viral infections that can be treated by the compositions, vaccine formulations, or unit dosage forms disclosed herein include, but are not limited to, those caused by hepatitis type A, hepatitis type B, hepatitis type C, influenza (e.g., influenza A or influenza B), varicella, adenovirus, herpes simplex type I (HSV-I), herpes simplex type II (HSV-II), rinderpest, rhinovirus, echovirus, rotavirus, respiratory syncytial virus, papilloma virus (e.g., human papillomavirus (HPV)), papova virus, cytomegalovirus, echinovirus, arbovirus, hantavirus, coxsackie virus, mumps virus, measles virus, rubella virus, polio virus, Epstein Barr virus (EBV), human immunodeficiency virus type I (HIV-I), human immunodeficiency virus type II (HIV-
- Bacterial infections that can be treated by the compositions, vaccine formulations, or unit dosage forms disclosed herein include, but are not limited to, infections caused by Escherichia coli, Klebsiella pneumoniae, Staphylococcus aureus, Enterococcus faecalis, Proteus vulgaris, Staphylococcus viridans, and Pseudomonas aeruginosa.
- Bacterial diseases caused by any of these bacteria that can be treated in accordance with the methods described herein include, but are not limited to, Mycobacteria rickettsia, Mycoplasma, Neisseria, S.
- pneumonia Borrelia burgdorferi (Lyme disease), Bacillus antracis (anthrax), tetanus, Streptococcus, Staphylococcus, mycobacterium, pertissus, cholera, plague, diptheria, chlamydia, S. aureus and legionella.
- Fungal infections that can be treated by the compositions, vaccine formulations, or unit dosage forms disclosed herein include, but are not limited to, infections caused by Candida (e.g., Candida glabrata ), Pneumocystis carinii, Fusarium keratitis, coccidioidal, Aspergillus niger, Cryptococcus neoformans, and Curvularia geniculata.
- Candida e.g., Candida glabrata
- Pneumocystis carinii Fusarium keratitis
- coccidioidal Aspergillus niger
- Cryptococcus neoformans e.g., Curvularia geniculata.
- Fungal diseases caused by any of these bacteria include, but are not limited to, zygomycosis, Candida mastitis, progressive disseminated trichosporonosis with latent trichosporonemia, disseminated candidiasis, pulmonary paracoccidioidomycosis, pulmonary aspergillosis, Pneumocystis carinii pneumonia, cryptococcal meningitis, coccidioidal meningoencephalitis and cerebrospinal vasculitis, paranasal sinus mycoses, Aspergillus fumigatus endocarditis, tibial
- dyschondroplasia Candida glabrata vaginitis, oropharyngeal candidiasis, X-linked chronic granulomatous disease, tinea pedis, cutaneous candidiasis, mycotic placentitis, disseminated trichosporonosis, allergic bronchopulmonary aspergillosis, mycotic keratitis, fungal peritonitis, staphylococcal endophthalmitis, sporotrichosis, and dermatophytosis.
- Protozoal infections that can be treated by the compositions, vaccine formulations, or unit dosage forms disclosed herein include, but are not limited to, infections caused by leishmania, coccidiosis, trypanosoma schistosoma, and malaria.
- Parasitic infections that can be treated by the compositions, vaccine formulations, or unit dosage forms disclosed herein include, but are not limited to, infections caused by chlamydia and rickettsia.
- compositions, vaccine formulations, and unit dosage forms of the invention can be used for immunization against subjects who have been diagnosed, by any medical methods known in the art, to have infections. They can be used for immunization against subjects who have been exposed to a pathogenic microbe, will be exposed to a pathogenic microbe, or are otherwise at a high risk of contracting an infectious disease, for prophylaxis.
- Combination therapy refers to the use of compositions, vaccine formulations, or unit dosage forms of the invention, as a first modality, with a second modality to treat cancer or infections.
- the instant disclosure provides a method of inducing a cellular immune response to an antigenic peptide in a subject as disclosed herein, or a method of treating a disease in a subject as disclosed herein, the method comprising administering to the subject an effective amount of (a) a composition, vaccine formulations, or unit dosage form as disclosed herein and (b) a second modality.
- the second modality is a non-HSP modality, e.g., a modality that does not comprise HSP as a component.
- This approach is commonly termed combination therapy, adjunctive therapy or conjunctive therapy (the terms are used interchangeably).
- combination therapy additive potency or additive therapeutic effect can be observed. Synergistic outcomes are sought where the therapeutic efficacy is greater than additive.
- the use of combination therapy can also provide better therapeutic profiles than the administration of either the first or the second modality alone.
- the additive or synergistic effect may allow for a reduction in the dosage and/or dosing frequency of either or both modalities to mitigate adverse effects.
- the second modality administered alone is not clinically adequate to treat the subject (e.g., the subject is non-responsive or refractory to the single modality), such that the subject needs an additional modality.
- the subject has responded to the second modality, yet suffers from side effects, relapses, develops resistance, etc., such that the subject needs an additional modality.
- Methods of the invention comprising administration of the compositions, vaccine formulations, or unit dosage forms of the invention to such subjects to improve the therapeutic effectiveness of the second modality.
- the effectiveness of a treatment modality can be assayed in vivo or in vitro using methods known in the art.
- a lesser amount of the second modality is required to produce a therapeutic benefit in a subject.
- a reduction of about 10%, 20%, 30%, 40% and 50% of the amount of second modality can be achieved.
- the amount of the second modality including amounts in a range that does not produce any observable therapeutic benefits, can be determined by dose-response experiments conducted in animal models by methods well known in the art.
- the second modality comprises a TCR, e.g., a soluble TCR or a cell expressing a TCR.
- the second modality comprises a cell expressing a chimeric antigen receptor (CAR).
- the cell expressing the TCR or CAR is a T cell.
- the TCR or CAR binds to (e.g., specifically binds to) at least one MHC-binding epitope in the composition, vaccine formulation, or unit dosage form of the invention.
- the second modality comprises a TCR mimic antibody.
- the TCR mimic antibody is an antibody that specifically binds to a peptide-MHC complex.
- TCR mimic antibodies are disclosed in U.S. Patent No. 9,074,000, U.S. Publication Nos. US 2009/0304679 Al and US
- the TCR mimic antibody binds to (e.g., specifically binds to) at least one MHC-binding epitope in the composition, vaccine formulation, or unit dosage form of the invention.
- the second modality comprises a checkpoint targeting agent.
- the checkpoint targeting agent is selected from the group consisting of an antagonist anti-CTLA-4 antibody, an antagonist anti-PD-Ll antibody, an antagonist anti-PD-L2 antibody, an antagonist anti-PD-l antibody, an antagonist anti -TIM-3 antibody, an antagonist anti-LAG-3 antibody, an antagonist anti-CEACAMl antibody, an agonist anti-CDl37 antibody, an antagonist anti-TIGIT antibody, an antagonist anti-VISTA antibody, an agonist anti-GITR antibody, and an agonist anti-OX40 antibody.
- an anti-PD-l antibody is used as the second modality in methods disclosed herein.
- the anti-PD-l antibody is nivolumab, also known as BMS-936558 or MDX1106, developed by Bristol-Myers Squibb.
- the anti-PD-l antibody is pembrolizumab, also known as lambrolizumab or MK-3475, developed by Merck & Co.
- the anti-PD-l antibody is pidilizumab, also known as CT-011, developed by CureTech.
- the anti-PD-l antibody is MEDI0680, also known as AMP-514, developed by Medimmune.
- the anti-PD-l antibody is PDR001 developed by Novartis
- the anti-PD-l antibody is REGN2810 developed by Regeneron Pharmaceuticals. In certain embodiments, the anti-PD-l antibody is PF- 06801591 developed by Pfizer. In certain embodiments, the anti-PD-l antibody is BGB- A317 developed by BeiGene. In certain embodiments, the anti-PD-l antibody is TSR-042 developed by AnaptysBio and Tesaro. In certain embodiments, the anti-PD-l antibody is SHR-1210 developed by Hengrui.
- anti-PD-l antibodies that may be used in treatment methods disclosed herein are disclosed in the following patents and patent applications, all of which are herein incorporated by reference in their entireties for all purposes: U.S. Patent No. 6,808,710; U.S. Patent No. 7,332,582; U.S. Patent No. 7,488,802; U.S. Patent No. 8,008,449; U.S. Patent No. 8,114,845; U.S. Patent No. 8,168,757; U.S.
- an anti-PD-Ll antibody is used as the second modality in methods disclosed herein.
- the anti-PD-Ll antibody is atezolizumab developed by Genentech.
- the anti-PD-Ll antibody is durvalumab developed by AstraZeneca, Celgene and Medimmune.
- the anti-PD- Ll antibody is avelumab, also known as MSB0010718C, developed by Merck Serono and Pfizer.
- the anti-PD-Ll antibody is MDX-1105 developed by Bristol- Myers Squibb.
- the anti-PD-Ll antibody is AMP -224 developed by Amplimmune and GSK.
- Non-limiting examples of anti-PD-Ll antibodies that may be used in treatment methods disclosed herein are disclosed in the following patents and patent applications, all of which are herein incorporated by reference in their entireties for all purposes: US Patent No. 7,943,743; US Patent No. 8,168,179; US Patent No. 8,217,149; U.S. Patent No. 8,552,154; U.S. Patent No. 8,779,108; U.S. Patent No. 8,981,063; U.S. Patent No. 9,175,082; U.S.
- a compound that targets an immunomodulatory enzyme(s) such as IDO (indoleamine-(2,3)-dioxygenase) and/or TDO (tryptophan 2,3- dioxygenase) is used as the second modality in methods disclosed herein. Therefore, in one embodiment, the compound targets an immunomodulatory enzyme(s), such as an inhibitor of indoleamine-(2,3)-dioxygenase (IDO).
- IDO indoleamine-(2,3)-dioxygenase
- TDO tryptophan 2,3- dioxygenase
- such compound is selected from the group consisting of epacadostat (Incyte Corp; see, e.g., WO 2010/005958 which is herein incorporated by reference in its entirety), F001287 (Flexus Biosciences/Bristol-Myers Squibb), indoximod (NewLink Genetics), and NLG919 (NewLink Genetics).
- the compound is epacadostat.
- the compound is F001287.
- the compound is indoximod.
- the compound is NLG919.
- an anti-TIM-3 (e.g., human TIM-3) antibody disclosed herein is administered to a subject in combination with an IDO inhibitor for treating cancer.
- the IDO inhibitor as described herein for use in treating cancer is present in a solid dosage form of a pharmaceutical composition such as a tablet, a pill or a capsule, wherein the pharmaceutical composition includes an IDO inhibitor and a pharmaceutically acceptable excipient.
- a pharmaceutical composition such as a tablet, a pill or a capsule
- the pharmaceutical composition includes an IDO inhibitor and a pharmaceutically acceptable excipient.
- the antibody as described herein and the IDO inhibitor as described herein can be administered separately, sequentially or concurrently as separate dosage forms.
- the antibody is administered parenterally, and the IDO inhibitor is administered orally.
- the inhibitor is selected from the group consisting of epacadostat (Incyte Corporation), F001287 (Flexus Biosciences/Bristol- Myers Squibb), indoximod (NewLink Genetics), and NLG9l9 (NewLink Genetics).
- Epacadostat has been described in PCT Publication No. WO 2010/005958, which is herein incorporated by reference in its entirety for all purposes.
- the inhibitor is epacadostat.
- the inhibitor is F001287.
- the inhibitor is indoximod.
- the inhibitor is NLG919.
- the second modality comprises a different vaccine (e.g., a peptide vaccine, a DNA vaccine, or an RNA vaccine) for treating cancer or infection.
- the vaccine is a heat shock protein based tumor vaccine or a heat shock protein based pathogen vaccine (e.g., a vaccine as described in WO 2016/183486, which is incorporated herein by reference in its entirety).
- the second modality comprises a stress protein-based vaccine.
- the second modality comprises a composition, vaccine formulation, or unit dosage form as disclosed herein that is different from the first modality.
- the second modality comprises a composition, vaccine formulation, or unit dosage form analogous to those disclosed herein except for having a different sequence of the HSP-binding peptide.
- the stress protein-based vaccine is derived from a tumor preparation, such that the immunity elicited by the vaccine is specifically directed against the unique antigenic peptide repertoire expressed by the cancer of each subject.
- the second modality comprises one or more adjuvants, such as the ones disclosed supra that may be included in the vaccine formulation disclosed herein.
- the second modality comprises a saponin, an
- the second modality comprises a Toll-like receptor (TLR) agonist.
- TLR Toll-like receptor
- the TRL agonist is an agonist of TLR4.
- the TRL agonist is an agonist of TLR7 and/or TLR8.
- the TRL agonist is an agonist of TLR9.
- the TRL agonist is an agonist of TLR5.
- the second modality comprises one or more of the agents selected from the group consisting of lenalidomide, dexamethasone, interleukin-2, recombinant interferon alfa-2b, and peginterferon alfa-2b.
- the second modality comprises a chemotherapeutic or a radiotherapeutic.
- the chemotherapeutic agent is a hypomethylating agent (e.g., azacitidine).
- the second modality comprises one or more anti-infective interventions (e.g., antivirals, antibacterials, antifungals, or anti-helminthics) for the treatment of the infectious disease.
- anti-infective interventions e.g., antivirals, antibacterials, antifungals, or anti-helminthics
- composition, vaccine formulation, or unit dosage form of the invention can be administered separately, sequentially, or concurrently from the second modality (e.g., chemotherapeutic, radiotherapeutic, checkpoint targeting agent, IDO inhibitor, vaccine, adjuvant, soluble TCR, cell expressing a TCR, cell expressing a CAR, and/or TCR mimic antibody), by the same or different delivery routes.
- the second modality e.g., chemotherapeutic, radiotherapeutic, checkpoint targeting agent, IDO inhibitor, vaccine, adjuvant, soluble TCR, cell expressing a TCR, cell expressing a CAR, and/or TCR mimic antibody
- compositions or vaccine formulations disclosed herein and the dosage of any additional treatment modality if combination therapy is to be administered, depends to a large extent on the weight and general state of health of the subject being treated, as well as the frequency of treatment and the route of administration.
- Amounts effective for this use will also depend on the stage and severity of the disease and the judgment of the prescribing physician, but generally range for the initial immunization (that is, for therapeutic administration) from about 1.0 pg to about 1000 pg (1 mg) (including, for example, 10, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 240, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, or 1000 pg) of any one of the compositions disclosed herein for a 70 kg patient, followed by boosting dosages of from about 1.0 pg to about 1000 pg of the composition (including, for example, 10, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, or 1000 pg) pursuant to a boosting
- Preferred adjuvants include QS-21, e.g., QS-21 Stimulon ® , and CpG
- the adjuvant comprises a Toll-like receptor (TLR) agonist.
- TLR Toll-like receptor
- the TRL agonist is an agonist of TLR4.
- the TRL agonist is an agonist of TLR7 and/or TLR8.
- the TRL agonist is an agonist of TLR9.
- the TRL agonist is an agonist of TLR5.
- the administered amount of compositions depends on the route of administration and the type of HSPs in the compositions.
- the amount of HSP in the compositions can range, for example, from 5 to 1000 pg (1 mg) per
- compositions comprising Hsc70-, Hsp70- and/or Gp96-polypeptide complexes is, for example, 5, 10, 20,
- the administered amount of the composition is in the range of about 10 to 600 pg per administration and about 5 to 100 pg if the composition is administered intradermally. In certain embodiments, the administered amount of the composition is about 5 pg to 600 pg, about 5 pg to 300 pg, about 5 pg to 150 pg, or about 5 pg to 60 pg. In certain embodiments, the administered amount of the composition is less than 100 pg.
- the administered amount of the composition is about 5 pg, 25 pg, 50 pg, or 240 pg.
- the compositions comprising complexes of stress proteins and polypeptides are purified. [00234]
- a dosage substantially equivalent to that observed to be effective in smaller non-human animals e.g., mice or guinea pigs
- is effective for human administration optionally subject to a correction factor not exceeding a fifty fold increase, based on the relative lymph node sizes in such mammals and in humans.
- interspecies dose-response equivalence for stress proteins (or HSPs) noncovalently bound to or mixed with antigenic molecules for a human dose is estimated as the product of the therapeutic dosage observed in mice and a single scaling ratio, not exceeding a fifty fold increase.
- the dosages of the composition can be much smaller than the dosage estimated by extrapolation.
- the doses recited above can be given once or repeatedly, such as daily, every other day, weekly, biweekly, or monthly, for a period up to a year or over a year. Doses are preferably given once every 28 days for a period of about 52 weeks or more.
- compositions are administered to a subject at reasonably the same time as an additional treatment modality or modalities.
- This method provides that the two administrations are performed within a time frame of less than one minute to about five minutes, or up to about sixty minutes from each other, for example, at the same doctor's visit.
- compositions and an additional treatment modality or modalities are administered at exactly the same time.
- compositions and an additional treatment modality or modalities are administered in a sequence and within a time interval such that the complexes of the invention and the additional treatment modality or modalities can act together to provide an increased benefit than if they were administered alone.
- compositions and an additional treatment modality or modalities are administered sufficiently close in time so as to provide the desired therapeutic or prophylactic outcome.
- Each can be administered simultaneously or separately, in any appropriate form and by any suitable route.
- the complexes of the invention and the additional treatment modality or modalities are administered by different routes of administration.
- each is administered by the same route of administration.
- the compositions can be administered at the same or different sites, e.g. arm and leg.
- the compositions and an additional treatment modality or modalities may or may not be administered in admixture or at the same site of administration by the same route of administration.
- the compositions and an additional treatment modality or modalities are administered less than 1 hour apart, at about 1 hour apart, 1 hour to 2 hours apart, 2 hours to 3 hours apart, 3 hours to 4 hours apart, 4 hours to 5 hours apart, 5 hours to 6 hours apart, 6 hours to 7 hours apart, 7 hours to 8 hours apart, 8 hours to 9 hours apart, 9 hours to 10 hours apart, 10 hours to 11 hours apart, 11 hours to 12 hours apart, no more than 24 hours apart or no more than 48 hours apart.
- the compositions and a vaccine composition are administered 2 to 4 days apart, 4 to 6 days apart, 1 week a part, 1 to 2 weeks apart, 2 to 4 weeks apart, one month apart, 1 to 2 months apart, or 2 or more months apart.
- the compositions and an additional treatment modality or modalities are administered in a time frame where both are still active. One skilled in the art would be able to determine such a time frame by determining the half-life of each administered component.
- compositions are administered to the subject weekly for at least four weeks. In certain embodiments, after the four weekly doses, at least 2 (e.g., 1
- compositions administered as a booster three months after the final weekly or biweekly dose.
- the three monthly booster can be administered for the life of the subject (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more years).
- the total number of doses of the compositions administered to the subject is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
- compositions and an additional treatment modality or modalities are administered within the same patient visit.
- the compositions are administered prior to the administration of an additional treatment modality or modalities.
- the compositions are administered subsequent to the administration of an additional treatment modality or modalities.
- compositions and an additional treatment modality or modalities are cyclically administered to a subject. Cycling therapy involves the
- compositions for a period of time followed by the administration of a modality for a period of time and repeating this sequential administration.
- Cycling therapy can reduce the development of resistance to one or more of the therapies, avoid or reduce the side effects of one of the therapies, and/or improve the efficacy of the treatment.
- the disclosure contemplates the alternating administration of the compositions followed by the administration of a modality 4 to 6 days later, preferable 2 to 4 days, later, more preferably 1 to 2 days later, wherein such a cycle may be repeated as many times as desired.
- the compositions and the modality are alternately administered in a cycle of less than 3 weeks, once every two weeks, once every 10 days or once every week.
- compositions are administered to a subject within a time frame of one hour to twenty four hours after the administration of a modality.
- the time frame can be extended further to a few days or more if a slow- or continuous- release type of modality delivery system is used.
- compositions disclosed herein may be administered using any desired route of administration. Many methods may be used to introduce the compositions described above, including but not limited to, oral, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, mucosal, intranasal, intra-tumoral, and intra-lymph node routes. Non-mucosal routes of administration include, but are not limited to, intradermal and topical
- Mucosal routes of administration include, but are not limited to, oral, rectal and nasal administration.
- Advantages of intradermal administration include use of lower doses and rapid absorption, respectively.
- Advantages of subcutaneous or intramuscular administration include suitability for some insoluble suspensions and oily suspensions, respectively. Preparations for mucosal administrations are suitable in various formulations as described below.
- Solubility and the site of the administration are factors which should be considered when choosing the route of administration of the compositions.
- the mode of administration can be varied between multiple routes of administration, including those listed above.
- compositions are water-soluble, then it may be formulated in an appropriate buffer, for example, phosphate buffered saline or other physiologically compatible solutions, preferably sterile. Alternatively, if a composition has poor solubility in aqueous solvents, then it may be formulated with a non-ionic surfactant such as Tween, or polyethylene glycol. Thus, the compositions may be formulated for administration by inhalation or insufflation (either through the mouth or the nose) or oral, buccal, parenteral, or rectal administration.
- an appropriate buffer for example, phosphate buffered saline or other physiologically compatible solutions, preferably sterile.
- a composition may be formulated with a non-ionic surfactant such as Tween, or polyethylene glycol.
- the compositions may be formulated for administration by inhalation or insufflation (either through the mouth or the nose) or oral, buccal, parenteral, or rectal administration.
- the composition may be in liquid form, for example, solutions, syrups or suspensions, or may be presented as a drug product for reconstitution with water or other suitable vehicle before use.
- a liquid preparation may be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, cellulose derivatives or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid).
- suspending agents e.g., sorbitol syrup, cellulose derivatives or hydrogenated edible fats
- emulsifying agents e.g., lecithin or acacia
- non-aqueous vehicles e.g., almond oil, oily esters, or fractionated vegetable oils
- preservatives e.g.
- compositions may take the form of, for example, tablets or capsules prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pre-gelatinized maize starch, polyvinyl pyrrolidone or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate); lubricants (e.g., magnesium stearate, talc or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulphate).
- binding agents e.g., pre-gelatinized maize starch, polyvinyl pyrrolidone or hydroxypropyl methylcellulose
- fillers e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate
- lubricants e.g., magnesium stearate, talc or silica
- disintegrants e.g., potato
- compositions for oral administration may be suitably formulated to be released in a controlled and/or timed manner.
- compositions may take the form of tablets or lozenges formulated in conventional manner.
- the preparation may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion.
- Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative.
- the preparation may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the active ingredient may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- the preparation may also be formulated in a rectal preparation such as a suppository or retention enema, e.g., containing conventional suppository bases such as cocoa butter or other glycerides.
- a rectal preparation such as a suppository or retention enema, e.g., containing conventional suppository bases such as cocoa butter or other glycerides.
- the preparation may also be formulated as a depot preparation.
- Such long acting formulations may be administered by implantation (for example, subcutaneously or intramuscularly) or by intramuscular injection.
- the preparation may be formulated with suitable polymeric or
- hydrophobic materials for example, as emulsion in an acceptable oil
- ion exchange resins for example, as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- Liposomes and emulsions are well known examples of delivery vehicles or carriers for hydrophilic drugs.
- compositions are conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane,
- the dosage unit may be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges of, e.g., gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
- Patients treated with the compositions disclosed herein may be tested for an anti tumor immune response.
- peripheral blood from patients may be obtained and assayed for markers of anti-tumor immunity.
- leukocytes may be obtained from the peripheral blood and assayed for frequency of different immune cell phenotypes, HLA subtype, and function of anti -tumor immune cells.
- the majority of effector immune cells in the anti -tumor response is CD8 + T cells and thus is HLA class I restricted.
- Using immunotherapeutic strategies in other tumor types expansion of CD8+ cells that recognize HLA class I restricted antigens is found in a majority of patients.
- other cell types are involved in the anti-tumor immune response, including, for example, CD4+ T cells, and macrophages and dendritic cells, which may act as antigen-presenting cells.
- Populations of T cells (CD4+, CD8+, and Treg cells), macrophages, and antigen presenting cells may be determined using flow cytometry.
- HLA typing may be performed using routine methods in the art, such as methods described in Boegel et al.
- the HLA subtype of CD8+ T cells may be determined by a complement- dependent microcytotoxicity test.
- an enzyme linked immunospot assay may be performed to quantify the IFNy-producing peripheral blood mononuclear cells (PBMC). This technique provides an assay for antigen recognition and immune cell function.
- subjects who respond clinically to the vaccine may have an increase in tumor-specific T cells and/or IFNy-producing PBMCs.
- immune cell frequency is evaluated using flow cytometry.
- antigen recognition and immune cell function is evaluated using enzyme linked immunospot assays.
- a panel of assays may be performed to characterize the immune response generated to the composition alone or given in combination with standard of care (e.g., maximal surgical resection, radiotherapy, and concomitant and adjuvant chemotherapy with temozolomide for glioblastoma multiforme).
- the panel of assays includes one or more of the following tests: whole blood cell count, absolute lymphocyte count, monocyte count, percentage of CD4 + CD3 + T cells, percentage of
- CD8 + CD3 + T cells percentage of CD4 + CD25 + FoxP3 + regulatory T cells and other phenotyping of PBL surface markers, intracellular cytokine staining to detect
- proinflammatory cytokines at the protein level proinflammatory cytokines at the protein level, qPCR to detect cytokines at the mRNA level and CFSE dilution to assay T cell proliferation.
- a number of other tests may be performed to determine the overall health of the subject.
- blood samples may be collected from subjects and analyzed for hematology, coagulation times and serum biochemistry.
- Hematology for CBC may include red blood cell count, platelets, hematocrit, hemoglobin, white blood cell (WBC) count, plus WBC differential to be provided with absolute counts for neutrophils, eosinophils, basophils, lymphocytes, and monocytes.
- WBC white blood cell
- Serum biochemistry may include albumin, alkaline phosphatase, aspartate amino transferase, alanine amino transferase, total bilirubin, BUN, glucose, creatinine, potassium and sodium.
- Protime (PT) and partial thromboplastin time (PTT) may also be tested.
- One or more of the following tests may also be conducted: anti thyroid (anti-microsomal or thyroglobulin) antibody tests, assessment for anti-nuclear antibody, and rheumatoid factor.
- Urinalysis may be performed to evaluated protein, RBC, and WBC levels in urine. Also, a blood draw to determine histocompatibility leukocyte antigen (HLA) status may be performed.
- HLA histocompatibility leukocyte antigen
- radiologic tumor evaluations are performed one or more times throughout a treatment to evaluate tumor size and status.
- tumor evaluation scans may be performed within 30 days prior to surgery, within 48 hours after surgery (e.g., to evaluate percentage resection), 1 week (maximum 14 days) prior to the first vaccination (e.g., as a baseline evaluation), and approximately every 8 weeks thereafter for a particular duration.
- MRI or CT imaging may be used.
- the same imaging modality used for the baseline assessment is used for each tumor evaluation visit.
- Kits are also provided for carrying out the prophylactic and therapeutic methods disclosed herein.
- the kits may optionally further comprise instructions on how to use the various components of the kits.
- the kit comprises a first container containing the composition disclosed herein, and a second container containing one or more adjuvants.
- the adjuvant can be any adjuvant disclosed herein, e.g., a saponin, an immunostimulatory nucleic acid, or QS-21 (e.g., QS-21 Stimulon ® ).
- the kit further comprises a third container containing an additional treatment modality.
- the kit can further comprise an instruction on the indication, dosage regimen, and route of administration of the composition, adjuvant, and additional treatment modality, e.g., as disclosed in Section 5.5 herein.
- the kit can comprise the stress protein(s) and polypeptide(s) of a composition disclosed herein in separate containers.
- the kit comprises a first container containing one or more polypeptides disclosed herein, and a second container containing a purified stress protein capable of binding to the polypeptide.
- the first container can contain any number of different polypeptides.
- the first container contains no more than 100 different polypeptides, e.g., 2-50, 2-30, 2-20, 5-20, 5-15, 5-10, or 10-15 different polypeptides.
- each of the different polypeptides comprises the same HSP-binding peptide and a different antigenic peptide.
- the total amount of the polypeptide(s) in the first container is a suitable amount for a unit dosage. In certain embodiments, the total amount of the polypeptide(s) in the first container is about 0.1 to 20 nmol (e.g., 3, 4, 5, or 6 nmol).
- the second container can contain any stress protein disclosed herein.
- the stress protein is selected from the group consisting of Hsc70, Hsp70, Hsp90, Hspl 10, Grpl70, Gp96, or Calreticulin, and a mutant or fusion protein thereof.
- the stress protein is Hsc70 (e.g., human Hsc70).
- the stress protein is a recombinant protein.
- the total amount of the stress protein(s) in the second container is about 10 pg to 600 pg (e.g., 250 pg to 290 pg).
- the total amount of the stress protein(s) in the second container is about 50 pg, 100 pg, 200 pg, 300 pg, 400 pg, or 500 pg.
- the amount of the stress protein in the pharmaceutical composition is about 300 pg.
- the total molar amount of the stress protein(s) in the second container is calculated based on the total molar amount of the polypeptide(s) in the first container, such that the molar ratio of the polypeptide(s) to the stress protein(s) is about 0.5:1 to 5: 1 (e.g., about 1: 1 to 2:1, e.g., about 1 : 1, 1.25: 1, or 1.5: 1).
- the total amount of the stress protein(s) in the second container is an amount for multiple administrations (e.g, less than or equal to 1 mg, 3 mg, 10 mg, 30 mg, or 100 mg).
- the kit further comprises an instruction for preparing a composition from the polypeptide(s) in the first container and the stress protein(s) in the second container (e.g, an instruction for the complexing reaction as disclosed in Section 5.4.2 herein).
- the kit further comprises a third container containing one or more adjuvants.
- the adjuvant can be any adjuvant disclosed herein, e.g., a saponin, an immunostimulatory nucleic acid, or QS-21 (e.g., QS-21 Stimulon ® ).
- the kit further comprises a fourth container containing an additional treatment modality.
- the kit can further comprise an instruction on the indication, dosage regimen, and route of administration of the composition prepared from the polypeptide(s) and stress protein(s), the adjuvant, and the additional treatment modality, e.g., as disclosed in Section 5.5 herein.
- the composition, polypeptide(s), stress protein(s), adjuvant(s), and additional treatment modality in the containers are present in pre-determined amounts effective to treat cancers or infections.
- the compositions can be presented in a pack or dispenser device which may contain one or more unit dosage forms of the compositions.
- the pack may, for example, comprise metal or plastic foil, such as a blister pack.
- the pack or dispenser device may be accompanied by instructions for administration.
- the instant disclosure provides a polypeptide comprising an
- HSP-binding peptide and an amino acid sequence from a human papillomavirus (HPV) (e.g., HPV 16 or HPV18).
- HPV human papillomavirus
- Such amino acid sequence is also referred to as an HPV peptide herein.
- the HPV peptide can comprise any amino acid sequence as disclosed in Table 3.
- the amino acid sequence from HPV comprises the amino acid sequence of SEQ ID NO: 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, or 53.
- the HSP-binding peptide can be any HSP-binding peptide disclosed in Section 5.2, or any HSP-binding peptide known in the art (see, e.g., US20160331821A1 and
- the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO:
- the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 5, 6, 7, 8, 9, 10, 11, 12, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 204, 205, 207, 208, 209, 210, 211, 212, 213, 214, or 215.
- the HSP-binding peptide comprises the amino acid sequence of SEQ ID NO: 6.
- the HPV peptide can be linked to the HSP-binding peptide via any linker disclosed herein (e.g., in Section 5.3).
- the HPV peptide is linked to the HSP-binding peptide via a peptide linker.
- the peptide linker comprises the amino acid sequence of FR or FFRK (SEQ ID NO: 13).
- the HPV peptide comprises the amino acid sequence of
- composition e.g.,
- composition comprising a plurality of different polypeptides, wherein each polypeptide comprises an HSP-binding peptide and an HPV peptide.
- the amino acid sequence of at least one HPV peptide is selected from the group consisting of SEQ ID NOs: 38-53. In certain embodiments, the amino acid sequence of each HPV peptide is selected from the group consisting of SEQ ID NOs: 38-53. In certain embodiments, the composition comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16 different HPV peptides.
- the amino acid sequence of at least one polypeptide is selected from the group consisting of SEQ ID NOs: 54-69. In certain embodiments, the amino acid sequence of each polypeptide is selected from the group consisting of SEQ ID NOs: 54-69. In certain embodiments, the composition comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16 different polypeptides.
- the composition further comprises a purified stress protein.
- a stress protein disclosed herein (e.g., in Section 5.4) can be used.
- the stress protein is selected from the group consisting of Hsc70, Hsp70, Hsp90, Hspl lO, Grpl70, Gp96, Calreticulin, and a mutant or fusion protein thereof.
- the stress protein is Hsc70 (e.g., human Hsc70).
- the ratio of polypeptide to stress protein can be any ratio disclosed herein, e.g., about 0.5: 1 to 5: 1. In certain embodiments, the ratio of polypeptide to stress protein is about 1 : 1 to 2: 1. In certain embodiments, the ratio of polypeptide to stress protein is about 1 :1, 1.25: 1, or 1.5:1. Also, the amounts of the polypeptide(s) and of the stress protein(s) can be any amounts disclosed in Section 5.4 herein. In certain embodiments, the composition is in a unit dosage form.
- the instant disclosure provides a kit comprising the composition disclosed herein either in a single container or in separate containers, optionally further comprising containers containing one or more adjuvants and additional treatment modalities, as disclosed in Section 5.6 herein.
- the instant disclosure provides a method of inducing a cellular immune response to an HPV peptide in a subject, the method comprising administering to the subject an effective amount of a composition as disclosed in this section.
- the instant disclosure provides a method of treating an HPV-associated disease in a subject, the method comprising administering to the subject an effective amount of a composition as disclosed this section.
- the HPV-associated disease is a cancer (e.g., cervical cancer).
- the HPV is HPV16 or HPV18. Any dosage regimen as disclosed in Section 5.5.4 herein and any route of administration as disclosed in Section 5.5.5 herein can be used.
- the method can further comprise an additional treatment modality as disclosed in Section 5.5.3 herein, and can further comprise a patient evaluation step as disclosed in Section 5.5.6 herein.
- the peptides were synthesized using standard Fmoc solid-phase chemical synthesis with pre-loaded polystyrene wang (PS-Wang) resin in a Symphony-X automatic synthesizer (Gyros Protein Technologies Inc). Fmoc protected L-amino acids were applied with standard HCTU/NMM activation chemistry. With respect to resin substitution, 5-fold excess of amino acid, 5-fold excess of activating reagent (HCTU) and lO-fold excess of N- methyl morpholine was used for coupling the amino acid to make the peptide bond. The reaction was performed for 6 min with double coupling cycle for any incomplete coupling throughout the synthesis. These steps were repeated until the desired sequence was obtained.
- Dithiothreitol water Triisopropylsilane (88:5:5:2 v/w/v/v) was mixed with the resin and stirred for 4 hours at 25°C.
- the crude peptides were isolated from the resin by filtration and evaporated with N 2 gas followed by precipitation with chilled diethyl ether and stored at - 20°C for 12 hours.
- the precipitated peptides were centrifuged and washed 2X with ether, dried, dissolved in the choice of solvent, and lyophilized to produce a crude dry powder.
- the crude peptides were purified by prep-HPLC with a Cl 8 column (Ultimate 3000, Thermo Scientific) using a water (0.1% TFA)-acetonitrile (0.1% TFA) gradient. Peptide purity was tested using an analytical Cl 8-column. Further characterization was confirmed by 6550 Q- TOF (Agilent Technologies) mass spectrometry.
- Hsc70 was solubilized in 100% DMSO at 10 mg/ml followed by a second dilution step to 320 mM in 75% DMSO.
- Hsc70 was mixed at a concentration of 7 mM (0.5 mg/ml) with the appropriate concentration of peptide in IX PBS with a final volume of 25 m ⁇ . The mixed samples were then incubated at 37°C for 1 hour and cooled down on ice for 10 min.
- Hsc70 (1 mg/ml, 0.1% polysorbate) was mixed with peptide at peptide:Hsc70 molar ratios of, 0.25: 1, 0.5: 1, 1: 1, 2: 1, and 4: 1, for 60 minutes at 30°C. Following incubation, samples were cooled for 5 minutes at room temperature and transferred to HPLC vials for analysis. To evaluate the quantity of the complex in the solution, 20 m ⁇ (10 pg) of the sample was loaded on a size exclusion chromatography column TSKgel SuperSW3000 (Tosoh Bioscience) at a flow rate of 0.2 ml/min with IX PBS as a running buffer. The data was collected by measuring the absorbance at 214 nm.
- Hsc70 human heat shock cognate 71 kDa protein
- M monomer
- D dimer
- T trimer
- HMW high molecular weight
- AREAcompiex AREATotai — (AreaT+D AreaMshx AreaMx)
- AREATotai AREAT+D, C, Msh, M + (AREAHDW-X - AREAHDW-O)
- AREAMshx A REAMSIIO X (AREA(T+D)X)/(AREA(T+D)O)
- AREAMX AREAMO X (AREA(T+D)X)/(AREA(T+D)O)
- AREATotai is the sum of total integrated peak areas from trimer/ oligomer region through the monomer peak and excludes the initial HMW peak area but includes the excess increase of the HMW peak area that was observed when peptide was added.
- the HMW peak was excluded from the complexation calculation on the basis that it was aggregated protein that was not functional for complexation. This correction took into account AreaTotai factors in the minor increase in HMW area, adding it back to base total area used to calculate area of complex. Including this adjustment resulted in a more stable AreaTotai across the range of peptide concentrations used to form complexes.
- PEP006 was selected for further characterization.
- PEP006 peptide was reconstituted in water for injection (WFI) to a concentration of 645 mM.
- Recombinant human Hsc70 (rhHsc70) was diluted at a concentration of 1.66 mg/mL. Both solutions were pre-warmed in a 37 °C incubator for 10 minutes, and were combined and incubated at 37 °C for 60 minutes.
- the final concentration of rhHsc70 was 1 mg/mL (about 14.1 pM), and the molar ratio of PEP006 to rhHsc70 was 0.25: 1, 0.5: 1, 1: 1, 1.5: 1, 2: 1, 2.5: 1, and 3: 1.
- a negative control containing only rhHsc70 at 1 mg/mL was also prepared.
- a quantity of 10 pg of each sample was injected neat in triplicate for resolution by size exclusion HPLC (Alliance HPLC, Waters Model #2695 Separations Module; Dual Wavelength UV Detector, Waters Model 2487) using a chromatography column TSKgel SuperSW3000 (Tosoh Bioscience, Catalog # 18675).
- the column temperature was controlled at 25°C ⁇ 5°C, and the autosampler temperature was controlled at 5°C ⁇ 3°C.
- the mobile phase was composed of lOmM sodium phosphate with 300mM sodium chloride, pH 7.2, and was delivered at a flow rate of 0.2mL/min for 30 minutes.
- UV absorbance of PEP006 peptide and rhHsc70 protein was measured at the wavelengths of 214 nm and 280nm.
- the absorbance data was processed by Waters Empower (V2) software.
- Figure 2 shows a chromatogram of the PEP006-Hsc70 complexation products, wherein the column retention time became shorter when rhHsc70 bound to PEP006.
- Figure 3 A shows a chromatogram of the polypeptide-Hsc70 complexation products, wherein the column retention time became shorter when rhHsc70 bound to the polypeptide.
- Figure 3B is a graph showing percent complexation of a polypeptide comprising PEP006 with HSC70 over a range of polypeptide:Hsc70 molar ratios from 0.125: 1 to 4: 1, as calculated from size exclusion chromatography traces similar to those in Figure 3A, using the methods described Example 6.1.1. Three independent experiments are shown.
- PEP006 and in some cases, the same polypeptide without a C-terminal HSC70 binding peptide.
- the peptides used are shown in Table 7 below. Polypeptides were synthesized, complexation was performed, and SEC data was analyzed according to the methods described in Example 6.1.1, above.
- Figure 4A is a graph showing percent complexation for five different peptides, where each of the five different peptides comprised, C-terminal PEP001, C-terminal PEP006, or no C-terminal HSC70 binding peptide.
- Figure 4B is a graph showing percent
- immunogenicity of a pool of four polypeptides each comprising an immunogenic HPV E6 or E7 peptide linked to PEP001 or PEP006, or not linked to an HSP-binding peptide, was analyzed in an immunogenicity animal model.
- HPV E6 or E7 peptides either alone or linked to PEP001 or PEP006, having the amino acid sequences provided in Table 8, were chemically synthesized and dissolved in 100% DMSO at concentrations ranging from 25 to 100 mg/ml. These HPV E6 and E7 peptides were known to be immunogenic in C57BL/6 mice (see Bartkowiak et al. (2015) Proc Natl Acad Sci U S A. 112(38); and Manuri et al. (2007) Vaccine 25(l7):3302-l0, each of which is incorporated by reference herein in its entirety).
- the known epitope sequence of PEP059 and PEP060 was RAHYNIVTF (SEQ ID NO: 78), and the known epitope sequence of PEP061 and PEP062 was VYDFAFRDL (SEQ ID NO: 79).
- Recombinant human Hsc70 (rhHsc70) protein was purified from rhHsc70- expressing E. coli by chromatography using, sequentially, a weak anionic Q Sepharose column, an ATP agarose affinity column, and a DEAE-FF weak anion exchange column.
- the purified rhHsc70 protein was diluted in filtered PBS supplemented with 0.01%
- an equimolar pool of four polypeptides was prepared in 75% DMSO at a total concentration of 320 mM.
- the purified rhHsc70 protein was pre- incubated at 37°C for 30 minutes, and the polypeptide pool was added to the rhHsc70 protein solution at 2: 1 or 1 : 1 molar ratio to reach an rhHsc70 protein concentration of 0.5 mg/ml.
- the mixture was incubated for 1 hour at 37°C and filtered sequentially through a 0.8 pm and a 0.2 pm filter. The mixture was then placed on ice for 30 min and stored at -80 °C.
- mice For vaccination, six-week-old female C57BL/6J mice purchased from the Jackson Laboratory were maintained in a specific pathogen-free environment. The mice were immunized by subcutaneous injection of the vaccine. Each injection contained a total of 30 pg (about 0.42 nmol) Hsc70 complexed to the peptide pool (0.42 nmol for 1 : 1 ratio or 0.84 nmol for 2: 1 ratio), supplemented with 10 pg of QS-21 Stimulon ® , diluted in BioXcell InVivoPure pH 7.0 Dilution Buffer to a final volume of 200 pl.
- an equimolar pool of the four polypeptides at a total concentration of 10 nmol, supplemented with 10 pg of the adjuvant QS-21 Stimulon ® was diluted in filtered PBS with 0.1% Polysorbate 20 to a final volume of 200 pl.
- a boosting dose containing the same amount of vaccine was injected subcutaneously to each mouse.
- an IFNy ELISpot assay was performed. Briefly, immunized mice were euthanized, splenocytes were gently isolated, and 5* l0 5 to 1 x 10 6 live cells from each mouse were seeded on a plate previously coated with a murine IFNy capture antibody. The cells were re-stimulated overnight using the naked peptides (PEP059-062). The cells were removed by lysis, and the IFNy bound to the capture antibody was detected using a detection antibody couple to horseradish peroxidase (HRP). The number of spots in each well, representing the number of IFNy-producing cells in this well, was counted using CTL S6 ImmunoSpot® analyzer and software.
- HRP horseradish peroxidase
- HPV vaccines containing PEP001- or PEP006-linked peptides complexed with Hsc70 demonstrated increased immunogenicity as compared to the naked HPV peptides.
- the vaccines containing PEP006- linked peptides complexed with Hsc70 showed a greater immunogenicity than the vaccines containing PEPOOl-linked peptides complexed with Hsc70 under the conditions used.
- HPV vaccines containing PEP001- or PEP006-linked peptides complexed with Hsc70 elicited a greater number of IFNy-producing splenocytes than the equivalent doses of naked peptide complexed with Hsc70 at mole ratios of 1 : 1 and 2: 1.
- the vaccines containing PEP001- and PEP006-linked peptides complexed with Hsc70 also elicited a greater response than an equivalent dose of free peptides not complexed with Hsc70 at mole ratios of 1 : 1 and 2: 1.
- the vaccines containing PEP006-linked peptides complexed with Hsc70 showed a greater immunogenicity than the vaccines containing PEPOOl-linked peptides complexed with Hsc70 under the conditions used.
- TC1 cells express the oncogenes HRAS, HPV16 E6 and E7 as disclosed in Lin et al. (1996) Cancer Res. 56(l):2l-26, which is hereby incorporated by reference in its entirety.
- Low passage TC1 cells were washed in serum-free PBS and re-suspend in PBS at a concentration of 2xl0 6 cells/ml.
- C57BL/6 mice shaved on the flank three days prior to use were injected subcutaneously in the shaved area with 2xl0 5 cells in 100 pl volume.
- Vaccines were prepared according to the methods described in Section 6.2.1.
- the naked peptides, PEP001 -linked peptides, and PEP006-linked peptides were complexed with rhHsc70 protein at the ratios of 1: 1, 4: 1, and 2: 1, respectively.
- the vaccines were administered to the mice subcutaneously at days 5, 10, and 15 post TC1 cell implantation.
- Tumors were measured every 3-4 days with a caliper. Tumor volume was calculated using the formula of 1/2 c D c d 2 , where D is the major axis and d is the minor axis. Any palpable but non-measurable tumor was estimated as 0.5 mm 3 , whereas absence of tumor was recorded as 0 mm 3 . Mice were sacrificed when tumors reached 2000 mm 3 or upon ulceration, and survival curves were plotted.
- PEP073 and PEP074 comprised the amino acid sequence of EVYDFAFRDL (SEQ ID NO: 92), a murine H-2Db and a human HLA-A*24:02 epitope.
- PEP081 comprised the amino acid sequences of YMLDLQPET (SEQ ID NO: 93) and MLDLQPETT (SEQ ID NO: 94), human HLA-A*02:0l epitopes.
- PEP084 comprised the amino acid sequence of RAHYNIVTF (SEQ ID NO: 78), a murine H-2Db epitope.
- PEP086 comprised the amino acid sequence of LLMGTLGIVC (SEQ ID NO: 95), a human HLA- A*02:0l epitope.
- Each peptide also comprised the amino acid sequence of PEP006.
- the vaccine was prepared by the method described in Section 6.2.2, and the ratio of peptide to rhHsc70 protein was 2: 1 for the HPV peptide pool. The efficacy of the vaccine was assessed using the same mouse model as described in Section 6.2.2, and the vaccine comprising the pool of PEP063-066 was used as a comparator.
- the vaccine containing Hsc70 and PEP071-086 reduced tumor growth and improved survival as compared to PBS control in the TC1 HPV16 E6/E7 syngeneic tumor model.
- This example demonstrates therapeutic efficacy of a vaccine using two different formulations, one in which all peptides were initially reconstituted in DMSO and one in which only peptides which were not soluble in neutral, acidic, or basic water, were initially reconstituted in DMSO.
- the sequences of the polypeptides used in the vaccine which contain tumor associated antigens from HPV E6 and E7 oncoproteins, are provided in Table 4.
- the vaccine used in this example comprised sixteen peptides, PEP071- PEP086. Each peptide comprises the amino acid sequence PEP006 at the C-terminus.
- each peptide was tested for solubility in neutral water followed by pH-adjusted (i.e. acidic, containing HC1, or basic, containing NaOH) water if necessary.
- pH-adjusted i.e. acidic, containing HC1, or basic, containing NaOH
- the 16 peptides were solubilized at 500 pM in neutral water solution, pH adjusted water, or in 100% DMSO (when peptides could not be resuspended in aqueous solutions).
- the peptides were then mixed at equal volume to make a 500 pM working pool (each peptide @ o 31 pM).
- the peptides were subsequently diluted in aqueous buffer to the concentration desired for complexation to Hsc70.
- rh-Hsc70 was incubated for 0.5 hour at 37°C, then further incubated for 1 hour at 37° C with the pool of 16 peptides at 2: 1 molar ratio of total peptide:protein, following sterile procedures. Complexes were then incubated on ice for 15 min. The complexes were filtered and aliquoted.
- On days 5, 10, and 15 after tumor challenge mice were administered (a) 30 pg Hsc70-based vaccine (either Formulation A or Formulation B) + 10 pg QS-21 or (b) PBS subcutaneously at the diagonally opposite brachial lymph node area from the tumor site.
- Each dose of vaccine contained 30 pg Hsc70 and ⁇ 4 pg total peptide (-250 ng each peptide) along with QS-21 adjuvant. Injections were carried out with a lmL BD Syringe with a Sub-Q 26G x 5/8 inch needle.
- Tumor growth kinetics and survival were monitored. Tumor volumes were measured by caliper every 3-4 days of the study starting on day 5 after tumor challenge. Tumor length was based on the longest linear distance. Width was based on the longest linear distance perpendicular to the length. Mice were euthanized when tumor volumes reached 2000 mm 3 . Tumor volumes (mm 3 ) were calculated as length x width 2 x 0.5. For mice with two tumors, each was measured independently and the volumes summed. Mice were distributed to each treatment group randomly on day 5 post tumor inoculation. Mice without early measurable tumors were excluded from the study.
- mice per group were followed for survival using the Kaplan-Meier method and Log-rank test (p ⁇ 0.000l survival in mice treated with either vaccine formulation vs. survival in mice treated with PBS). Tumor size was assessed every 2-3 days and each group’s mean tumor volume was plotted as function of time.
- the TC-l tumor is known to develop a resistance phenotype to antigen targeting therapies which can be driven by immune editing and loss of epitopes expressed by the tumor (Smahel et al, 2007) which likely explains the eventual progression of tumors beginning on ⁇ d. 28 for both vaccine formulations.
- these data demonstrate that an efficient vaccine-induced immune response against tumor associated antigens such as HPV E6 and E7 oncoproteins can translate into significant tumor control and prolonged survival.
- Example 3 Improvement of peptide synthesis by Hsc70-binding peptides
- EVSGLEQLESIINFEKLTEWTSSNVMEFFRKNLLRLTG EVSGLEQLESIINFEKLTEWTSSNVMEFFRKNLLRLTG
- PEP006 PEP006
- SEQ ID NO: 231 EVSGLEQLESIINFEKLTEWTSSNVMEFFRKNWLRLTW
- Peptide purity was determined by reverse phase chromatography using the Vanquish Bioanalytical and Ultimate 3000 Dionex workstation, following the procedure provided in the Vanquish/Ultimate 3000 User’s Guide and Data Explorer User’s Guide included with the Chromeleon 7.0 software package.
- the synthesized peptides were cleaved from the resin and dissolved in 1: 1 acetonitrile: water (v/v) at 1 mg/mL concentration.
- the dissolved sample was analyzed by analytical HPLC using a Phenomenex Luna Cl 8 lOpm 4.6 x 250mm column. A volume of 20 pL of sample was injected, and was subject to gradient elution using a mixture of solution A (0.1% TFA in water) and solution B (0.1% TFA in acetonitrile) as mobile phase, following the gradient of Table 10.
- the column temperature was maintained at 37°C ⁇ 5°C.
- the peptides were detected by UV absorbance at the wavelengths of 214 nm and 280 nm.
- each peak represented a peptide with a specific retention time, and the area under the peak reflected the amount of this peptide.
- the peak of the correct peptide was confirmed by mass spectrometry.
- the crude purity of the peptide was calculated as the area under the peak of the correct peptide divided by the total area under the entire curve.
- the 50 peptides shown below in Table 11 were synthesized by the method described in Section 6.1.1. This group of 50 peptides contains 25 unique peptide sequences (labelled A-Y) that were synthesized with or without (“naked peptide”) the addition of a C- terminal PEP006 peptide sequence. Peptide purity was determined by reverse phase chromatography as described in section 6.3.1 above. As shown in Figure 11, addition of the PEP006 peptide sequence increased the crude purity for a majority of the peptides as compare to the corresponding naked peptide. Because of the sample complexity, many peptide separations were multi-dimensional. Three peptides were not detected in the Cl 8 column under standard reverse phase gradient up to 95%.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Oncology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Virology (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Hematology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2020559376A JP2021522239A (ja) | 2018-04-26 | 2019-04-25 | 熱ショックタンパク質結合ペプチド組成物およびその使用方法 |
| CN201980035933.5A CN112218883A (zh) | 2018-04-26 | 2019-04-25 | 热休克蛋白结合肽组合物及其使用方法 |
| EP19732758.8A EP3784688A2 (en) | 2018-04-26 | 2019-04-25 | Heat shock protein-binding peptide compositions and methods of use thereof |
| CA3096909A CA3096909A1 (en) | 2018-04-26 | 2019-04-25 | Heat shock protein-binding peptide compositions and methods of use thereof |
| AU2019261451A AU2019261451A1 (en) | 2018-04-26 | 2019-04-25 | Heat shock protein-binding peptide compositions and methods of use thereof |
| KR1020207033282A KR20210005646A (ko) | 2018-04-26 | 2019-04-25 | 열쇼크 단백질-결합 펩티드 조성물 및 그의 이용 방법 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862663083P | 2018-04-26 | 2018-04-26 | |
| US62/663,083 | 2018-04-26 | ||
| US201862692009P | 2018-06-29 | 2018-06-29 | |
| US62/692,009 | 2018-06-29 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2019210055A2 true WO2019210055A2 (en) | 2019-10-31 |
| WO2019210055A3 WO2019210055A3 (en) | 2019-12-19 |
Family
ID=67002340
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/029112 Ceased WO2019210055A2 (en) | 2018-04-26 | 2019-04-25 | Heat shock protein-binding peptide compositions and methods of use thereof |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US11065317B2 (enExample) |
| EP (1) | EP3784688A2 (enExample) |
| JP (1) | JP2021522239A (enExample) |
| KR (1) | KR20210005646A (enExample) |
| CN (1) | CN112218883A (enExample) |
| AU (1) | AU2019261451A1 (enExample) |
| CA (1) | CA3096909A1 (enExample) |
| MA (1) | MA52363A (enExample) |
| TW (1) | TW202012430A (enExample) |
| WO (1) | WO2019210055A2 (enExample) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024026452A1 (en) | 2022-07-29 | 2024-02-01 | Repertoire Immune Medicines, Inc. | T cell epitopes associated with type 1 diabetes |
| WO2025072849A1 (en) | 2023-09-29 | 2025-04-03 | Repertoire Immune Medicines, Inc. | Mhc-presentable peptides associated with type 1 diabetes |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MA52363A (fr) * | 2018-04-26 | 2021-03-03 | Agenus Inc | Compositions peptidiques de liaison à une protéine de choc thermique (hsp) et leurs méthodes d'utilisation |
| WO2021016531A1 (en) * | 2019-07-24 | 2021-01-28 | Agenus Inc. | Antigenic polypeptides and methods of use thereof |
Citations (62)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4877608A (en) | 1987-11-09 | 1989-10-31 | Rorer Pharmaceutical Corporation | Pharmaceutical plasma protein formulations in low ionic strength media |
| US5137819A (en) | 1988-07-08 | 1992-08-11 | University Of British Columbia | Cellulose binding fusion proteins for immobilization and purification of polypeptides |
| US5328694A (en) | 1990-01-19 | 1994-07-12 | Octapharma Ag | Stable injectable solution of factor VIII |
| US5496934A (en) | 1993-04-14 | 1996-03-05 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Nucleic acids encoding a cellulose binding domain |
| WO1996022107A1 (en) | 1995-01-19 | 1996-07-25 | Quadrant Holdings Cambridge Limited | Dried blood factor composition comprising trehalose |
| US5605884A (en) | 1987-10-29 | 1997-02-25 | Rhone-Poulenc Rorer Pharmaceuticals Inc. | Factor VIII formulations in high ionic strength media |
| US5733873A (en) | 1992-10-02 | 1998-03-31 | Pharmacia & Upjohn Ab | Composition comprising coagulation factor VIII formulation, process for its preparation and use of a surfactant as stabilizer |
| US5763401A (en) | 1996-07-12 | 1998-06-09 | Bayer Corporation | Stabilized albumin-free recombinant factor VIII preparation having a low sugar content |
| WO1999061056A2 (en) | 1998-05-22 | 1999-12-02 | Loeb Health Research Institute At The Ottawa Hospital | Methods and products for inducing mucosal immunity |
| US20010034042A1 (en) | 2000-01-20 | 2001-10-25 | Srivastava Pramod K. | Complexes of peptide-binding fragments of heat shock proteins and their use as immunotherapeutic agents |
| US20030232323A1 (en) | 2001-11-13 | 2003-12-18 | Wyeth | Agents that modulate immune cell activation and methods of use thereof |
| US6808710B1 (en) | 1999-08-23 | 2004-10-26 | Genetics Institute, Inc. | Downmodulating an immune response with multivalent antibodies to PD-1 |
| US7309491B2 (en) | 2003-04-11 | 2007-12-18 | Antigenics Inc. | Heat shock protein-based vaccines and immunotherapies |
| US7332582B2 (en) | 2002-05-23 | 2008-02-19 | Curetech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
| US20090304679A1 (en) | 2004-05-27 | 2009-12-10 | Weidanz Jon A | Antibodies as T cell receptor mimics, methods of production and uses thereof |
| WO2010005958A2 (en) | 2008-07-08 | 2010-01-14 | Incyte Corporation | 1,2,5-oxadiazoles as inhibitors of indoleamine 2,3-dioxygenase |
| US20100203056A1 (en) | 2008-12-09 | 2010-08-12 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| US8114845B2 (en) | 2008-08-25 | 2012-02-14 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
| US8168179B2 (en) | 2002-07-03 | 2012-05-01 | Ono Pharmaceutical Co., Ltd. | Treatment method using anti-PD-L1 antibody |
| US8168757B2 (en) | 2008-03-12 | 2012-05-01 | Merck Sharp & Dohme Corp. | PD-1 binding proteins |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| WO2013033091A1 (en) | 2011-09-01 | 2013-03-07 | Halo Maritime Defense Systems | Marine barrier and gate |
| US20130202623A1 (en) | 2010-02-16 | 2013-08-08 | Nicolas Chomont | Pd-1 modulation and uses thereof for modulating hiv replication |
| US8552154B2 (en) | 2008-09-26 | 2013-10-08 | Emory University | Anti-PD-L1 antibodies and uses therefor |
| US20130266512A1 (en) | 2010-07-23 | 2013-10-10 | University Of Southern California | Tetrazine-trans-cyclooctene Ligation for the Rapid Construction of Radionuclide Labeled Probes |
| US20130323249A1 (en) | 2012-05-31 | 2013-12-05 | Sorrento Therapeutics Inc. | Antigen Binding Proteins that Bind PD-L1 |
| WO2014022758A1 (en) | 2012-08-03 | 2014-02-06 | Dana-Farber Cancer Institute, Inc. | Single agent anti-pd-l1 and pd-l2 dual binding antibodies and methods of use |
| US20140044738A1 (en) | 2011-04-20 | 2014-02-13 | Amplimmune, Inc. | Antibodies And Other Molecules That Bind B7-H1 And PD-1 |
| US8686119B2 (en) | 2011-07-24 | 2014-04-01 | Curetech Ltd. | Variants of humanized immunomodulatory monoclonal antibodies |
| WO2014055897A2 (en) | 2012-10-04 | 2014-04-10 | Dana-Farber Cancer Institute, Inc. | Human monoclonal anti-pd-l1 antibodies and methods of use |
| US20140134191A1 (en) | 2011-03-24 | 2014-05-15 | Texas Tech University System | TCR Mimic Antibodies as Vascular Targeting Tools |
| US8735553B1 (en) | 2013-09-13 | 2014-05-27 | Beigene, Ltd. | Anti-PD1 antibodies and their use as therapeutics and diagnostics |
| US8747847B2 (en) | 2008-02-11 | 2014-06-10 | Curetech Ltd. | Monoclonal antibodies for tumor treatment |
| WO2014100079A1 (en) | 2012-12-21 | 2014-06-26 | Merck Sharp & Dohme Corp. | Antibodies that bind to human programmed death ligand 1 (pd-l1) |
| US8779108B2 (en) | 2009-11-24 | 2014-07-15 | Medimmune, Limited | Targeted binding agents against B7-H1 |
| WO2014179664A2 (en) | 2013-05-02 | 2014-11-06 | Anaptysbio, Inc. | Antibodies directed against programmed death-1 (pd-1) |
| US20140341917A1 (en) | 2011-11-28 | 2014-11-20 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| US20140356363A1 (en) | 2013-05-31 | 2014-12-04 | Sorrento Therapeutics, Inc. | Antigen Binding Proteins that Bind PD-1 |
| WO2014206107A1 (zh) | 2013-06-26 | 2014-12-31 | 上海君实生物医药科技有限公司 | 抗pd-1抗体及其应用 |
| WO2014209804A1 (en) | 2013-06-24 | 2014-12-31 | Biomed Valley Discoveries, Inc. | Bispecific antibodies |
| US8927697B2 (en) | 2008-09-12 | 2015-01-06 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| US8981063B2 (en) | 1999-11-30 | 2015-03-17 | Mayo Foundation For Medical Education And Research | B7-H1 Antibodies |
| WO2015036394A1 (en) | 2013-09-10 | 2015-03-19 | Medimmune Limited | Antibodies against pd-1 and uses thereof |
| US8993731B2 (en) | 2010-03-11 | 2015-03-31 | Ucb Biopharma Sprl | PD-1 antibody |
| WO2015058573A1 (zh) | 2013-10-25 | 2015-04-30 | 苏州思坦维生物技术有限责任公司 | 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途 |
| WO2015061668A1 (en) | 2013-10-25 | 2015-04-30 | Dana-Farber Cancer Institute, Inc. | Anti-pd-l1 monoclonal antibodies and fragments thereof |
| WO2015085847A1 (zh) | 2013-12-12 | 2015-06-18 | 上海恒瑞医药有限公司 | Pd-1抗体、其抗原结合片段及其医药用途 |
| US9074000B2 (en) | 2011-04-01 | 2015-07-07 | Memorial Sloan Kettering Cancer Center | T cell receptor-like antibodies specific for a WT1 peptide presented by HLA-A2 |
| US20150203580A1 (en) | 2014-01-23 | 2015-07-23 | Regeneron Pharmaceuticals, Inc. | Human Antibodies to PD-L1 |
| WO2015109124A2 (en) | 2014-01-15 | 2015-07-23 | Kadmon Corporation, Llc | Immunomodulatory agents |
| US20150225483A1 (en) | 2014-02-10 | 2015-08-13 | Merck Patent Gmbh | TARGETED TGFß INHIBITION |
| US20150346208A1 (en) | 2014-05-29 | 2015-12-03 | Spring Bioscience Corporation | PD-L1 Antibodies and Uses Thereof |
| WO2015195163A1 (en) | 2014-06-20 | 2015-12-23 | R-Pharm Overseas, Inc. | Pd-l1 antagonist fully human antibody |
| WO2015200119A1 (en) | 2014-06-26 | 2015-12-30 | Macrogenics, Inc. | Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof |
| WO2016000619A1 (en) | 2014-07-03 | 2016-01-07 | Beigene, Ltd. | Anti-pd-l1 antibodies and their use as therapeutics and diagnostics |
| WO2016015685A1 (zh) | 2014-07-30 | 2016-02-04 | 珠海市丽珠单抗生物技术有限公司 | 抗pd-1抗体及其应用 |
| WO2016020856A2 (en) | 2014-08-05 | 2016-02-11 | MabQuest SA | Immunological reagents |
| WO2016030350A1 (en) | 2014-08-29 | 2016-03-03 | F. Hoffmann-La Roche Ag | Combination therapy of tumor-targeted il-2 variant immunocytokines and antibodies against human pd-l1 |
| WO2016183486A1 (en) | 2015-05-13 | 2016-11-17 | Agenus Inc. | Vaccines for treatment and prevention of cancer |
Family Cites Families (125)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4690915A (en) | 1985-08-08 | 1987-09-01 | The United States Of America As Represented By The Department Of Health And Human Services | Adoptive immunotherapy as a treatment modality in humans |
| US4761470A (en) | 1985-12-16 | 1988-08-02 | Merck & Co., Inc. | Immunogenic synthetic peptide capable of eliciting herpes simplex virus neutralizing antibody |
| US5232833A (en) | 1988-09-14 | 1993-08-03 | Stressgen Biotechnologies Corporation | Accumulation of heat shock proteins for evaluating biological damage due to chronic exposure of an organism to sublethal levels of pollutants |
| GB8915019D0 (en) | 1989-06-30 | 1989-08-23 | Matthews Ruth C | Medicaments |
| US5348945A (en) | 1990-04-06 | 1994-09-20 | Wake Forest University | Method of treatment with hsp70 |
| US5188964A (en) | 1990-04-12 | 1993-02-23 | Board Of Regents, The University Of Texas System | Method and kit for the prognostication of breast cancer patient via heat shock/stress protein determination |
| SE9001705D0 (sv) * | 1990-05-11 | 1990-05-11 | Medscand Ab | Saett foer diagnostik av virusbaerande tumoerer genom immunoassay |
| US6037135A (en) | 1992-08-07 | 2000-03-14 | Epimmune Inc. | Methods for making HLA binding peptides and their uses |
| CA2118015A1 (en) | 1992-04-14 | 1993-10-28 | Jeffrey R. Marks | Method of detecting tumors containing complexes of p53 and hsp70 |
| US5750119A (en) | 1994-01-13 | 1998-05-12 | Mount Sinai School Of Medicine Of The City University Of New York | Immunotherapeutic stress protein-peptide complexes against cancer |
| US5997873A (en) | 1994-01-13 | 1999-12-07 | Mount Sinai School Of Medicine Of The City University Of New York | Method of preparation of heat shock protein 70-peptide complexes |
| US5961979A (en) | 1994-03-16 | 1999-10-05 | Mount Sinai School Of Medicine Of The City University Of New York | Stress protein-peptide complexes as prophylactic and therapeutic vaccines against intracellular pathogens |
| IL123218A0 (en) | 1995-08-18 | 1998-09-24 | Sloan Kettering Inst Cancer | Heat shock protein-based vaccines and immunotherapies |
| US5985270A (en) | 1995-09-13 | 1999-11-16 | Fordham University | Adoptive immunotherapy using macrophages sensitized with heat shock protein-epitope complexes |
| JPH11513369A (ja) | 1995-09-13 | 1999-11-16 | フォーダム ユニバーシティー | 熱ショックタンパク質を用いる治療及び予防方法 |
| US5837251A (en) | 1995-09-13 | 1998-11-17 | Fordham University | Compositions and methods using complexes of heat shock proteins and antigenic molecules for the treatment and prevention of neoplastic diseases |
| US5935576A (en) | 1995-09-13 | 1999-08-10 | Fordham University | Compositions and methods for the treatment and prevention of neoplastic diseases using heat shock proteins complexed with exogenous antigens |
| DE19602985A1 (de) | 1996-01-27 | 1997-07-31 | Max Delbrueck Centrum | Tumorzellimpfstoff für die Immuntheraphie von malignen Tumoren |
| RS50101B (sr) | 1996-02-24 | 2009-01-22 | Boehringer Ingelheim International Gmbh., | Farmaceutski preparati za imunomodulaciju |
| WO1998014207A1 (en) | 1996-10-01 | 1998-04-09 | Dana-Farber Cancer Institute | Immunological therapy for cancer |
| US6231859B1 (en) | 1996-12-02 | 2001-05-15 | Aquila Biopharmaceuticals, Inc. | Saponin adjuvant compositions |
| US5830464A (en) | 1997-02-07 | 1998-11-03 | Fordham University | Compositions and methods for the treatment and growth inhibition of cancer using heat shock/stress protein-peptide complexes in combination with adoptive immunotherapy |
| US6017540A (en) | 1997-02-07 | 2000-01-25 | Fordham University | Prevention and treatment of primary and metastatic neoplastic diseases and infectious diseases with heat shock/stress protein-peptide complexes |
| ES2265165T3 (es) | 1997-07-10 | 2007-02-01 | Mannkind Corporation | Dispositivo para inducir una respuesta ltc. |
| US6977074B2 (en) | 1997-07-10 | 2005-12-20 | Mannkind Corporation | Method of inducing a CTL response |
| EP0893507A1 (en) | 1997-07-25 | 1999-01-27 | Institut Gustave Roussy | Use of MHC class II ligands (CD4 and LAG-3) as adjuvant for vaccination and of LAG-3 in cancer treatment |
| DE19737409A1 (de) * | 1997-08-27 | 1999-03-04 | Medigene Ag | Diagnosekit für Hauttest und Verfahren zur Durchführung desselben |
| CA2302522C (en) | 1997-08-29 | 2010-08-17 | Antigenics Llc | Compositions comprising the adjuvant qs-21 and polysorbate or cyclodextrin as excipient |
| EP1030819A4 (en) | 1997-09-30 | 2001-11-21 | Cel Sci Corp | CONJUGATED IMMUNOGENIC POLYPEPTIDE FOR THE TREATMENT OF HERPES SIMPLEX VIRUS |
| US6007821A (en) | 1997-10-16 | 1999-12-28 | Fordham University | Method and compositions for the treatment of autoimmune disease using heat shock proteins |
| IL135860A0 (en) | 1997-10-31 | 2001-05-20 | Sloan Kettering Inst Cancer | Conjugate heat shock protein-binding peptides |
| US5948646A (en) | 1997-12-11 | 1999-09-07 | Fordham University | Methods for preparation of vaccines against cancer comprising heat shock protein-peptide complexes |
| JP2002506633A (ja) | 1998-03-20 | 2002-03-05 | ジェンザイム・コーポレーション | T細胞応答を誘発するための遺伝子に基づくワクチンの組成物および使用法 |
| NO315238B1 (no) | 1998-05-08 | 2003-08-04 | Gemvax As | Peptider som stammer fra leserammeforskyvingsmutasjoner i TBF<beta>II- eller BAX-genet, og farmasöytiske sammensetninger inneholdende disse,nukleinsyresekvenser som koder for slike peptider, plasmider og virusvektoreromfattende slikenukleinsy |
| PT1104306E (pt) | 1998-08-10 | 2006-05-31 | Antigenics Inc | Composicoes de cpg e adjuvantes de saponina e seus metodos |
| SK4272001A3 (en) | 1998-10-05 | 2003-02-04 | Pharmexa As | Methods for therapeutic vaccination |
| US6451316B1 (en) | 1998-10-05 | 2002-09-17 | University Of Conneticut Health Center | Methods for generating antigen-reactive T cells in vitro |
| US6475490B1 (en) | 1998-10-19 | 2002-11-05 | Fordham University | Compositions and methods for promoting tissue repair using heat shock proteins |
| US7851591B1 (en) | 1998-10-29 | 2010-12-14 | Dana Farber Cancer Institute, Inc. | Cancer immunotherapy and diagnosis using universal tumor associated antigens, including hTERT |
| GB0004547D0 (en) | 2000-02-23 | 2000-04-19 | Immunobiology Ltd | Screening method for novel vaccine candidates and compositions obtained thereby |
| US20020044948A1 (en) | 2000-03-15 | 2002-04-18 | Samir Khleif | Methods and compositions for co-stimulation of immunological responses to peptide antigens |
| CA2406472A1 (en) | 2000-04-17 | 2001-10-25 | James E. Rothman | Javelinization of protein antigens to heat shock proteins |
| EP1286693A4 (en) | 2000-06-02 | 2005-07-13 | Univ Connecticut Health Ct | COMPLEXES OF ALPHA (2) MACROGLOBULIN AND ANTIGENIC MOLECULES FOR USE IN IMMUNOTHERAPY |
| US7186515B1 (en) | 2000-06-02 | 2007-03-06 | University Of Connecticut Health Center | Alpha(2) macroglobulin receptor as a heat shock protein receptor and uses thereof |
| US6989146B2 (en) * | 2000-08-09 | 2006-01-24 | The Regents Of The University Of California | Stress proteins and peptides and methods of use thereof |
| US7132109B1 (en) | 2000-10-20 | 2006-11-07 | University Of Connecticut Health Center | Using heat shock proteins to increase immune response |
| FR2824326B1 (fr) * | 2001-05-04 | 2004-03-19 | Commissariat Energie Atomique | Melange de peptides issus des proteines e6 et/ou e7 de papillomavirus et leurs applications |
| CN1635896A (zh) | 2001-08-20 | 2005-07-06 | 康涅狄格大学健康中心 | 包含用于治疗癌症及感染性疾病的热休克蛋白或α2-巨球蛋白的组合物制备方法 |
| US20040071656A1 (en) | 2001-12-26 | 2004-04-15 | Felix Wieland | Modulation of heat-shock-protein-based immunotherapies |
| KR20040105736A (ko) | 2002-02-28 | 2004-12-16 | 안티제닉스 아이엔씨 | 스트레스 단백질의 올리고머화에 기초한 방법 및 산물 |
| US6984389B2 (en) | 2002-04-25 | 2006-01-10 | University Of Connecticut Health Center | Using heat shock proteins to improve the therapeutic benefit of a non-vaccine treatment modality |
| WO2003090686A2 (en) | 2002-04-25 | 2003-11-06 | University Of Connecticut Health Center | Using heat shock proteins to improve the therapeutic benefit of a non-vaccine treatment modality |
| JP2005533015A (ja) | 2002-05-02 | 2005-11-04 | ユニバーシティー オブ コネティカット ヘルス センター | 抗体療法の有効性を増強するための熱ショックタンパク質の使用 |
| US20050221350A1 (en) | 2002-05-29 | 2005-10-06 | Toni Weinschenk | Method for identifying immunoreactive peptides |
| WO2004007527A2 (en) * | 2002-07-11 | 2004-01-22 | Incyte Corporation | Secreted proteins |
| EP1576124A2 (en) | 2002-10-07 | 2005-09-21 | Antigenics Inc. | Heat shock protein binding fragments of cd91, and uses thereof |
| US7420037B2 (en) | 2003-02-13 | 2008-09-02 | Antigenics Inc. | Heat shock protein-based vaccines and immunotherapies |
| WO2004074454A2 (en) | 2003-02-20 | 2004-09-02 | University Of Connecticut Health Center | Methods and compositions for the treatment of cancer and infectious disease using alpha (2) macroglobulin-antigenic molecule complexes |
| CA2514500A1 (en) | 2003-02-20 | 2004-09-10 | University Of Connecticut Health Center | Methods for using compositions comprising heat shock proteins or alpha-2-macroglobulin in the treatment of cancer and infectious disease |
| CN1780850A (zh) * | 2003-02-28 | 2006-05-31 | 抗基因公司 | 凝集素在促进糖蛋白和抗原分子的低聚反应中的用途 |
| EP1617804A4 (en) | 2003-04-11 | 2007-07-25 | Antigenics Inc | IMPROVED VACCINE BASED ON HEAT SHOCK PROTEINS AND IMMUNOTHERAPIES |
| CA2538794C (en) | 2003-09-12 | 2016-04-19 | Antigenics, Inc. | Vaccine for treatment and prevention of herpes simplex virus infection |
| AU2003290460A1 (en) * | 2003-12-24 | 2005-07-14 | Leiden University Medical Center | Synthetic protein as tumor-specific vaccine |
| WO2005076009A2 (en) | 2004-01-28 | 2005-08-18 | Immatics Biotechnologies Gmbh | Method for identifying and quantifying of tumour-associated peptides |
| US8252893B2 (en) * | 2005-01-31 | 2012-08-28 | Board Of Trustees Of The University Of Arkansas | CD8 T cell epitopes in HPV 16 E6 and E7 proteins and uses thereof |
| WO2006105255A2 (en) | 2005-03-29 | 2006-10-05 | The Board Of Trustees Of The University Of Illinois | Cancer vaccines and therapeutic methods |
| WO2006120038A2 (en) | 2005-05-09 | 2006-11-16 | Vaxon Biotech | Use of native peptides and their optimized derivatives for vaccination |
| US9732131B2 (en) | 2006-02-27 | 2017-08-15 | Calviri, Inc. | Identification and use of novopeptides for the treatment of cancer |
| JP2009532664A (ja) | 2006-02-27 | 2009-09-10 | アリゾナ・ボード・オブ・リージェンツ・フォー・アンド・オン・ビハーフ・オブ・アリゾナ・ステイト・ユニバーシティ | 癌の治療のためのノボペプチドの同定および使用 |
| WO2008027800A2 (en) | 2006-08-29 | 2008-03-06 | Temple University - Of The Commonwealth System Of Higher Education | Method for enhancing the efficacy of antigen specific tumor immunotherapy |
| AT504160A1 (de) | 2006-09-11 | 2008-03-15 | Ralf Dr Kircheis | Verwendung einer mehrkomponenten-tumorvakzine |
| WO2008035350A1 (en) | 2006-09-21 | 2008-03-27 | Vaxil Biotherapeutics Ltd. | Antigen specific multi epitope vaccines |
| US7998486B2 (en) | 2006-10-25 | 2011-08-16 | Newlink Genetics Corporation | Enhanced immunogenicity of tumor associated antigens by addition of alphaGal epitopes |
| DE102006060824B4 (de) | 2006-12-21 | 2011-06-01 | Johannes-Gutenberg-Universität Mainz | Nachweis von individuellen T-Zell-Reaktionsmustern gegen Tumor-assoziierte Antigene (TAA) in Tumorpatienten als Basis für die individuelle therapeutische Vakzinierung von Patienten |
| CN103736086A (zh) | 2007-02-15 | 2014-04-23 | 曼康公司 | 用于增强t细胞应答的方法 |
| US8140270B2 (en) | 2007-03-22 | 2012-03-20 | National Center For Genome Resources | Methods and systems for medical sequencing analysis |
| MX2009012922A (es) * | 2007-05-31 | 2010-07-05 | Academisch Ziekenhuis Leiden H | Vacunacion intradermica de un peptido del virus del papiloma humano. |
| US8926961B2 (en) * | 2007-10-03 | 2015-01-06 | Board Of Trustees Of The University Of Arkansas | HPV E6 protein T cell epitopes and uses thereof |
| EP2626081B1 (en) | 2008-02-14 | 2017-03-22 | Life Sciences Research Partners VZW | Immunogenic control of tumours and tumour cells |
| EP2113253B1 (en) | 2008-04-30 | 2010-03-31 | Immatics Biotechnologies GmbH | Novel formulations of tumour-associated peptides binding to human leukocyte antigen (HLA) class I or II molecules for vaccines |
| JP2009273377A (ja) | 2008-05-12 | 2009-11-26 | Igaku Seibutsugaku Kenkyusho:Kk | Mhcクラスi分子と結合し癌細胞の表面に表出されるペプチド候補の選択方法 |
| EP2344191A4 (en) * | 2008-09-02 | 2013-02-13 | Antigen Express Inc | HUMAN PAPILLOMAVIRUS / LI-KEY HYBRIDS AND METHODS OF USE |
| RU2011144575A (ru) | 2009-04-03 | 2013-05-10 | Эйдженус Инк. | Способы получения и применения мультишаперон-антигенных комплексов |
| ES2533228T3 (es) | 2009-06-09 | 2015-04-08 | Vaxon Biotech | Identificación, optimización y uso de epítopos compartidos de HLA-B*0702 para inmunoterapia |
| EP2476440B1 (en) * | 2009-09-11 | 2017-08-02 | Proyecto de Biomedicina Cima, S.L. | Therapeutic compositions for the treatment of hpv-induced diseases |
| GB201006360D0 (en) | 2010-04-16 | 2010-06-02 | Immatics Biotechnologies Gmbh | Method for differentially quantifying naturally processed HLA-restricted peptides for cancer, autoimmune and infectious diseases immunotherapy development |
| EP2569633B1 (en) | 2010-05-14 | 2016-02-10 | The General Hospital Corporation | Compositions and methods of identifying tumor specific neoantigens |
| AU2011255463A1 (en) | 2010-05-21 | 2012-11-01 | University Of Miami | Cancer treatment |
| EP2576614A4 (en) | 2010-05-24 | 2013-11-13 | Phosimmune Inc | CLASS I-MHC PHOSPHOPEPTIDES FOR CANCER IMMUNOTHERAPY AND DIAGNOSIS |
| KR102042253B1 (ko) | 2010-05-25 | 2019-11-07 | 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 | Bambam:고처리율 서열분석 데이터의 병렬 비교 분석 |
| US9646134B2 (en) | 2010-05-25 | 2017-05-09 | The Regents Of The University Of California | Bambam: parallel comparative analysis of high-throughput sequencing data |
| FR2960542B1 (fr) * | 2010-05-27 | 2012-08-17 | Esther Suzy Arlette Fellous | Peptide en tant que medicament, en particulier pour le traitement du cancer |
| KR102759126B1 (ko) | 2010-12-30 | 2025-01-24 | 파운데이션 메디신 인코포레이티드 | 종양 샘플의 다유전자 분석의 최적화 |
| BR112013023978B1 (pt) | 2011-03-21 | 2021-09-08 | Atlantic Cancer Research Institute | Polipeptídeo com afinidade por proteínas de choque térmico e seu uso em diagnóstico de doença infecciosa, produção de resposta imune e tratamento de câncer, bem como ácido nucleico, composição e método de fracionamento de substância para pesquisa ou análise clínica de amostra biológica |
| WO2012159643A1 (en) | 2011-05-24 | 2012-11-29 | Biontech Ag | Individualized vaccines for cancer |
| PL3892295T3 (pl) | 2011-05-24 | 2023-07-24 | BioNTech SE | Zindywidualizowane szczepionki przeciwnowotworowe |
| AU2012302778B2 (en) | 2011-08-31 | 2016-11-24 | Mie University | Vaccine preparation for cancer treatment |
| WO2013158611A1 (en) | 2012-04-16 | 2013-10-24 | Agenus Inc. | Methods and compositions for the treatment of glioblastomas |
| CA2886218A1 (en) | 2012-05-25 | 2013-11-28 | Phosimmune, Inc. | Identification of mhc class i phospho-peptide antigens from breast cancer utilizing shla technology and complementary enrichment strategies |
| MX2014014199A (es) | 2012-05-25 | 2015-02-12 | Bayer Healthcare Llc | Sistema y procedimiento de prediccion de la inmunogenicidad de un peptido. |
| WO2014012051A1 (en) | 2012-07-12 | 2014-01-16 | Persimmune, Inc. | Personalized cancer vaccines and adoptive immune cell therapies |
| GB201214007D0 (en) | 2012-08-07 | 2012-09-19 | Scancell Ltd | Anti-tumour immune responses to modified self-epitopes |
| EP2891099A4 (en) | 2012-08-28 | 2016-04-20 | Broad Inst Inc | DETECTION OF DATA SEQUENCING AND BENCHMARKING VARIANTS |
| US9561266B2 (en) | 2012-08-31 | 2017-02-07 | University Of Virginia Patent Foundation | Target peptides for immunotherapy and diagnostics |
| WO2014039675A2 (en) | 2012-09-05 | 2014-03-13 | University Of Virginia Patent Foundation | Target peptides for colorectal cancer therapy and diagnostics |
| LT2901341T (lt) | 2012-09-28 | 2019-09-25 | The University Of Connecticut | Protekcinių vėžio epitopų identifikavimas, skirtas vėžio gydymui |
| EP3417874B1 (en) | 2012-11-28 | 2024-09-11 | BioNTech SE | Individualized vaccines for cancer |
| WO2014088432A1 (en) * | 2012-12-06 | 2014-06-12 | Callaghan Innovation Research Limited | Conjugate compounds |
| HK1216153A1 (zh) | 2012-12-13 | 2016-10-21 | University Of Virginia Patent Foundation | 用於卵巢癌治疗和诊断的靶向肽 |
| WO2014160902A1 (en) | 2013-03-27 | 2014-10-02 | Fred Hutchinson Cancer Research Center | Directed immune stimulation |
| EP2983702A2 (en) | 2013-04-07 | 2016-02-17 | The Broad Institute, Inc. | Compositions and methods for personalized neoplasia vaccines |
| WO2014180490A1 (en) | 2013-05-10 | 2014-11-13 | Biontech Ag | Predicting immunogenicity of t cell epitopes |
| WO2014200910A2 (en) | 2013-06-10 | 2014-12-18 | Iogenetics, Llc | Bioinformatic processes for determination of peptide binding |
| US20160186260A1 (en) | 2013-07-26 | 2016-06-30 | Sequenta, Llc | Cancer vaccination with antigen evolution |
| WO2015014375A1 (en) | 2013-07-30 | 2015-02-05 | Biontech Ag | Tumor antigens for determining cancer therapy |
| US9974849B2 (en) * | 2013-10-13 | 2018-05-22 | Bioventures, Llc | Human Papilloma virus therapeutic vaccine |
| US20160310584A1 (en) | 2013-12-06 | 2016-10-27 | The Broad Institute Inc. | Formulations for neoplasia vaccines |
| KR20230076867A (ko) | 2013-12-20 | 2023-05-31 | 더 브로드 인스티튜트, 인코퍼레이티드 | 신생항원 백신과의 병용 요법 |
| EP3090066A4 (en) | 2014-01-02 | 2017-08-30 | Memorial Sloan Kettering Cancer Center | Determinants of cancer response to immunotherapy |
| US20150315247A1 (en) | 2014-05-04 | 2015-11-05 | David Charles Binder | High-affinity peptide-based anticancer vaccination to overcome tumor resistance to immunostimulatory antibodies and to identify TCRs that can be used successfully in adoptive T cell therapy |
| GB201408255D0 (en) | 2014-05-09 | 2014-06-25 | Immatics Biotechnologies Gmbh | Novel immunotherapy against several tumours of the blood, such as acute myeloid leukemia (AML) |
| EP3191121B1 (en) | 2014-09-10 | 2020-05-27 | The University of Connecticut | Identification of immunologically protective neo-epitopes for the treatment of cancers |
| WO2016040900A1 (en) | 2014-09-14 | 2016-03-17 | Washington University | Personalized cancer vaccines and methods therefor |
| WO2017088080A1 (es) | 2015-11-25 | 2017-06-01 | Natural Response S.A. | Método para la obtención de saponinas a partir de plantas |
| MA52363A (fr) * | 2018-04-26 | 2021-03-03 | Agenus Inc | Compositions peptidiques de liaison à une protéine de choc thermique (hsp) et leurs méthodes d'utilisation |
-
2019
- 2019-04-25 MA MA052363A patent/MA52363A/fr unknown
- 2019-04-25 AU AU2019261451A patent/AU2019261451A1/en not_active Abandoned
- 2019-04-25 KR KR1020207033282A patent/KR20210005646A/ko not_active Withdrawn
- 2019-04-25 WO PCT/US2019/029112 patent/WO2019210055A2/en not_active Ceased
- 2019-04-25 TW TW108114510A patent/TW202012430A/zh unknown
- 2019-04-25 CN CN201980035933.5A patent/CN112218883A/zh active Pending
- 2019-04-25 US US16/394,812 patent/US11065317B2/en not_active Expired - Fee Related
- 2019-04-25 JP JP2020559376A patent/JP2021522239A/ja active Pending
- 2019-04-25 EP EP19732758.8A patent/EP3784688A2/en not_active Withdrawn
- 2019-04-25 CA CA3096909A patent/CA3096909A1/en active Pending
-
2021
- 2021-06-17 US US17/350,723 patent/US20220008527A1/en not_active Abandoned
Patent Citations (72)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5605884A (en) | 1987-10-29 | 1997-02-25 | Rhone-Poulenc Rorer Pharmaceuticals Inc. | Factor VIII formulations in high ionic strength media |
| US4877608A (en) | 1987-11-09 | 1989-10-31 | Rorer Pharmaceutical Corporation | Pharmaceutical plasma protein formulations in low ionic strength media |
| US5137819A (en) | 1988-07-08 | 1992-08-11 | University Of British Columbia | Cellulose binding fusion proteins for immobilization and purification of polypeptides |
| US5202247A (en) | 1988-07-08 | 1993-04-13 | University Of British Columbia | Cellulose binding fusion proteins having a substrate binding region of cellulase |
| US5328694A (en) | 1990-01-19 | 1994-07-12 | Octapharma Ag | Stable injectable solution of factor VIII |
| US5733873A (en) | 1992-10-02 | 1998-03-31 | Pharmacia & Upjohn Ab | Composition comprising coagulation factor VIII formulation, process for its preparation and use of a surfactant as stabilizer |
| US5496934A (en) | 1993-04-14 | 1996-03-05 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Nucleic acids encoding a cellulose binding domain |
| WO1996022107A1 (en) | 1995-01-19 | 1996-07-25 | Quadrant Holdings Cambridge Limited | Dried blood factor composition comprising trehalose |
| US5763401A (en) | 1996-07-12 | 1998-06-09 | Bayer Corporation | Stabilized albumin-free recombinant factor VIII preparation having a low sugar content |
| WO1999061056A2 (en) | 1998-05-22 | 1999-12-02 | Loeb Health Research Institute At The Ottawa Hospital | Methods and products for inducing mucosal immunity |
| US6808710B1 (en) | 1999-08-23 | 2004-10-26 | Genetics Institute, Inc. | Downmodulating an immune response with multivalent antibodies to PD-1 |
| US8981063B2 (en) | 1999-11-30 | 2015-03-17 | Mayo Foundation For Medical Education And Research | B7-H1 Antibodies |
| US20010034042A1 (en) | 2000-01-20 | 2001-10-25 | Srivastava Pramod K. | Complexes of peptide-binding fragments of heat shock proteins and their use as immunotherapeutic agents |
| US20030232323A1 (en) | 2001-11-13 | 2003-12-18 | Wyeth | Agents that modulate immune cell activation and methods of use thereof |
| US7332582B2 (en) | 2002-05-23 | 2008-02-19 | Curetech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| US8168179B2 (en) | 2002-07-03 | 2012-05-01 | Ono Pharmaceutical Co., Ltd. | Treatment method using anti-PD-L1 antibody |
| US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
| US7309491B2 (en) | 2003-04-11 | 2007-12-18 | Antigenics Inc. | Heat shock protein-based vaccines and immunotherapies |
| US20090304679A1 (en) | 2004-05-27 | 2009-12-10 | Weidanz Jon A | Antibodies as T cell receptor mimics, methods of production and uses thereof |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| US8779105B2 (en) | 2005-05-09 | 2014-07-15 | Medarex, L.L.C. | Monoclonal antibodies to programmed death 1 (PD-1) |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| US8747847B2 (en) | 2008-02-11 | 2014-06-10 | Curetech Ltd. | Monoclonal antibodies for tumor treatment |
| US8168757B2 (en) | 2008-03-12 | 2012-05-01 | Merck Sharp & Dohme Corp. | PD-1 binding proteins |
| WO2010005958A2 (en) | 2008-07-08 | 2010-01-14 | Incyte Corporation | 1,2,5-oxadiazoles as inhibitors of indoleamine 2,3-dioxygenase |
| US8114845B2 (en) | 2008-08-25 | 2012-02-14 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
| US8927697B2 (en) | 2008-09-12 | 2015-01-06 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| US20130291136A1 (en) | 2008-09-26 | 2013-10-31 | Emory University | Human anti-pd-1, pd-l1, and pd-l2 antibodies and uses therefor |
| US8552154B2 (en) | 2008-09-26 | 2013-10-08 | Emory University | Anti-PD-L1 antibodies and uses therefor |
| US9102727B2 (en) | 2008-09-26 | 2015-08-11 | Emory University | Human anti-PD-1 antibodies and uses therefor |
| US20100203056A1 (en) | 2008-12-09 | 2010-08-12 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| US8779108B2 (en) | 2009-11-24 | 2014-07-15 | Medimmune, Limited | Targeted binding agents against B7-H1 |
| US20130202623A1 (en) | 2010-02-16 | 2013-08-08 | Nicolas Chomont | Pd-1 modulation and uses thereof for modulating hiv replication |
| US8993731B2 (en) | 2010-03-11 | 2015-03-31 | Ucb Biopharma Sprl | PD-1 antibody |
| US20130266512A1 (en) | 2010-07-23 | 2013-10-10 | University Of Southern California | Tetrazine-trans-cyclooctene Ligation for the Rapid Construction of Radionuclide Labeled Probes |
| US20140134191A1 (en) | 2011-03-24 | 2014-05-15 | Texas Tech University System | TCR Mimic Antibodies as Vascular Targeting Tools |
| US9074000B2 (en) | 2011-04-01 | 2015-07-07 | Memorial Sloan Kettering Cancer Center | T cell receptor-like antibodies specific for a WT1 peptide presented by HLA-A2 |
| US20140044738A1 (en) | 2011-04-20 | 2014-02-13 | Amplimmune, Inc. | Antibodies And Other Molecules That Bind B7-H1 And PD-1 |
| US9205148B2 (en) | 2011-04-20 | 2015-12-08 | Medimmune, Llc | Antibodies and other molecules that bind B7-H1 and PD-1 |
| US8686119B2 (en) | 2011-07-24 | 2014-04-01 | Curetech Ltd. | Variants of humanized immunomodulatory monoclonal antibodies |
| WO2013033091A1 (en) | 2011-09-01 | 2013-03-07 | Halo Maritime Defense Systems | Marine barrier and gate |
| US20140341917A1 (en) | 2011-11-28 | 2014-11-20 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| US9175082B2 (en) | 2012-05-31 | 2015-11-03 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind PD-L1 |
| US20130323249A1 (en) | 2012-05-31 | 2013-12-05 | Sorrento Therapeutics Inc. | Antigen Binding Proteins that Bind PD-L1 |
| WO2014022758A1 (en) | 2012-08-03 | 2014-02-06 | Dana-Farber Cancer Institute, Inc. | Single agent anti-pd-l1 and pd-l2 dual binding antibodies and methods of use |
| WO2014055897A2 (en) | 2012-10-04 | 2014-04-10 | Dana-Farber Cancer Institute, Inc. | Human monoclonal anti-pd-l1 antibodies and methods of use |
| US20150355184A1 (en) | 2012-12-21 | 2015-12-10 | Robert H. Pierce | Antibodies that bind to human programmed death ligand 1 (pd-l1) |
| WO2014100079A1 (en) | 2012-12-21 | 2014-06-26 | Merck Sharp & Dohme Corp. | Antibodies that bind to human programmed death ligand 1 (pd-l1) |
| US20160075783A1 (en) | 2013-05-02 | 2016-03-17 | Anaptysbio, Inc. | Antibodies directed against programmed death-1 (pd-1) |
| WO2014179664A2 (en) | 2013-05-02 | 2014-11-06 | Anaptysbio, Inc. | Antibodies directed against programmed death-1 (pd-1) |
| US20140356363A1 (en) | 2013-05-31 | 2014-12-04 | Sorrento Therapeutics, Inc. | Antigen Binding Proteins that Bind PD-1 |
| WO2014209804A1 (en) | 2013-06-24 | 2014-12-31 | Biomed Valley Discoveries, Inc. | Bispecific antibodies |
| WO2014206107A1 (zh) | 2013-06-26 | 2014-12-31 | 上海君实生物医药科技有限公司 | 抗pd-1抗体及其应用 |
| WO2015036394A1 (en) | 2013-09-10 | 2015-03-19 | Medimmune Limited | Antibodies against pd-1 and uses thereof |
| US8735553B1 (en) | 2013-09-13 | 2014-05-27 | Beigene, Ltd. | Anti-PD1 antibodies and their use as therapeutics and diagnostics |
| WO2015061668A1 (en) | 2013-10-25 | 2015-04-30 | Dana-Farber Cancer Institute, Inc. | Anti-pd-l1 monoclonal antibodies and fragments thereof |
| WO2015058573A1 (zh) | 2013-10-25 | 2015-04-30 | 苏州思坦维生物技术有限责任公司 | 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途 |
| WO2015085847A1 (zh) | 2013-12-12 | 2015-06-18 | 上海恒瑞医药有限公司 | Pd-1抗体、其抗原结合片段及其医药用途 |
| WO2015109124A2 (en) | 2014-01-15 | 2015-07-23 | Kadmon Corporation, Llc | Immunomodulatory agents |
| US20150203580A1 (en) | 2014-01-23 | 2015-07-23 | Regeneron Pharmaceuticals, Inc. | Human Antibodies to PD-L1 |
| US20150225483A1 (en) | 2014-02-10 | 2015-08-13 | Merck Patent Gmbh | TARGETED TGFß INHIBITION |
| US20150346208A1 (en) | 2014-05-29 | 2015-12-03 | Spring Bioscience Corporation | PD-L1 Antibodies and Uses Thereof |
| WO2015195163A1 (en) | 2014-06-20 | 2015-12-23 | R-Pharm Overseas, Inc. | Pd-l1 antagonist fully human antibody |
| WO2015200119A1 (en) | 2014-06-26 | 2015-12-30 | Macrogenics, Inc. | Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof |
| WO2016000619A1 (en) | 2014-07-03 | 2016-01-07 | Beigene, Ltd. | Anti-pd-l1 antibodies and their use as therapeutics and diagnostics |
| WO2016015685A1 (zh) | 2014-07-30 | 2016-02-04 | 珠海市丽珠单抗生物技术有限公司 | 抗pd-1抗体及其应用 |
| WO2016020856A2 (en) | 2014-08-05 | 2016-02-11 | MabQuest SA | Immunological reagents |
| WO2016030350A1 (en) | 2014-08-29 | 2016-03-03 | F. Hoffmann-La Roche Ag | Combination therapy of tumor-targeted il-2 variant immunocytokines and antibodies against human pd-l1 |
| WO2016183486A1 (en) | 2015-05-13 | 2016-11-17 | Agenus Inc. | Vaccines for treatment and prevention of cancer |
| US20160331821A1 (en) | 2015-05-13 | 2016-11-17 | Agenus Inc. | Vaccines for treatment and prevention of cancer |
Non-Patent Citations (78)
| Title |
|---|
| "Genbank", Database accession no. NM_005345 |
| "Pathogenic and Clinical Microbiology: A Laboratory Manual", vol. 2, June 1994, JOHN WILEY & SONS, INC. |
| "UniProtKB", Database accession no. P08107 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| ANDERSEN, M. H. ET AL., TISSUE ANTIGENS, vol. 55, 2000, pages 519 - 531 |
| BANNWARTHTREZECIAK, HELV. CHIM. ACTA, vol. 70, 1987, pages 175 - 186 |
| BARRIOS ET AL., EUR. J. IMMUNOL., vol. 22, 1992, pages 1365 - 1372 |
| BARTKOWIAK ET AL., PROC NATL ACAD SCI U S A., vol. 112, no. 38, 2015 |
| BASUSRIVASTAVA, J. EXP. MED., vol. 189, 1999, pages 797 - 202 |
| BLYTHE, M. J. ET AL., BIOINFORMATICS, vol. 18, 2002, pages 434 - 439 |
| BOEGEL ET AL., GENOME MEDICINE, vol. 4, 2012, pages 102 |
| BRUSIC, V. ET AL., IMMUNOLOGY AND CELL BIOLOGY, vol. 80, 2002, pages 280 - 285 |
| BUUS, S., CURRENT OPINION IN IMMUNOLOGY, vol. 11, 1999, pages 209 - 213 |
| CRAIG, SCIENCE, vol. 260, 1993, pages 1902 - 1903 |
| DE BONT ET AL., TRAV. CHIM PAYS BAS, vol. 106, 1987, pages 641,642 |
| EXPERT OPIN. BIOL. THER., vol. 9, no. 2, February 2009 (2009-02-01), pages 179 - 86 |
| FLOWER, D. R.DOYTCHINOVA, I. A., APPLIED BIOINFORMATICS, vol. 1, 2002, pages 167 - 176 |
| GETHING ET AL., NATURE, vol. 355, 1992, pages 33 - 45 |
| GUAN ET AL., GENE, vol. 67, 1987, pages 21 - 30 |
| GUAN, P. ET AL., APPLIED BIOINFORMATICS, vol. 2, 2003, pages 63 - 66 |
| HAAS ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 2250 - 2254 |
| HICKEY ET AL., NUCLEIC ACIDS RES., vol. 14, 1986, pages 4127 - 45 |
| HUNT ET AL., GENE, vol. 87, 1990, pages 199 - 204 |
| INOUYEINOUYE, NUCLEIC ACIDS RES., vol. 13, 1985, pages 3101 - 3109 |
| JUNG, G. ET AL., BIOLOGICALS, vol. 29, 2001, pages 179 - 181 |
| KARLINALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 2264 - 2268 |
| KARLINALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5877 |
| KITAS ET AL., J. ORG. CHEM., vol. 55, 1990, pages 4181 - 4187 |
| KLAPPA ET AL., EMBO J., vol. 17, 1998, pages 927 - 935 |
| KWOK, W. W. ET AL., TRENDS IN IMMUNOLOGY, vol. 22, 2001, pages 583 - 588 |
| LAI ET AL., MOL. CELL. BIOL., vol. 4, 1984, pages 2802 - 10 |
| LEVY ET AL., CELL, vol. 67, 1991, pages 265 - 274 |
| LIN ET AL., CANCER RES., vol. 56, no. 1, 1996, pages 21 - 26 |
| LIN ET AL., MOL. BIOL. CELL, vol. 4, 1993, pages 1109 - 1119 |
| LINDQUIST ET AL., ANNU. REV. GENETICS, vol. 22, 1988, pages 631 - 677 |
| LISRIVASTAVA, EMBO J., vol. 12, 1993, pages 3143 - 3151 |
| LUSSOW ET AL., EUR. J. IMMUNOL., vol. 21, 1991, pages 2297 - 2302 |
| MAFFEI, A.HARRIS, P. E., PEPTIDES, vol. 19, 1998, pages 179 - 198 |
| MAKI ET AL., PROC. NATL. ACAD SCI., vol. 87, 1990, pages 5658 - 5562 |
| MALLIOS, R. R., BIOINFORMATICS, vol. 15, 1999, pages 432 - 439 |
| MANURI ET AL., VACCINE, vol. 25, no. 17, 2007, pages 3302 - 10 |
| MATTEUCCI ET AL., J. AM. CHEM. SOC., vol. 103, 1981, pages 3185 |
| MERRIFIELD, J. AM. CHEM. SOC., vol. 85, 1963, pages 2149 |
| MYERSMILLER, CABIOS, vol. 4, 1988, pages 11 - 17 |
| PENG ET AL., J. IMMUNOL. METHODS, vol. 204, 1997, pages 13 - 21 |
| PENNINGTON, METH. MOLEC. BIOL., vol. 35, 1994, pages 195 - 2 |
| PERICH, METHODS ENZYMOL., vol. 289, 1997, pages 245 - 266 |
| PERICHJOHNS, TETRAHEDRON LETTERS, vol. 29, 1988, pages 2369 - 2372 |
| PETTY ET AL.: "Current Protocols in Molecular Biology", vol. 2, 1996, GREENE PUBLISH. ASSOC. & WILEY INTERSCIENCE, article "Metal-chelate affinity chromatography" |
| RAMMENSEE ET AL., IMMUNOGENETICS, vol. 50, 1999, pages 213 - 219 |
| ROMISCH, K., TRENDS IN BIOCHEMICAL SCIENCES, vol. 26, 2001, pages 531 |
| RUTHER ET AL., EMBO J., vol. 2, 1983, pages 1791 |
| SARGENT ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 86, 1989, pages 1968 - 1972 |
| SCHIRLE, M. ET AL., JOURNAL OF IMMUNOLOGICAL METHODS, vol. 257, 2001, pages 1 - 16 |
| SETTE ET AL., J. IMMUNOL., vol. 141, 1991, pages 3893 |
| SHILOWEINBERG, PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 6789 - 6792 |
| SINGH, H.RAGHAVA, G. P. S., BIOINFORMATICS, vol. 17, 2001, pages 1236 - 1237 |
| SMITH, METHODS MOL. CELL BIO., vol. 4, 1993, pages 220 - 229 |
| SRIVASTAVA ET AL., PROC. NATL. ACAD. SCI., vol. 85, 1987, pages 3807 - 3811 |
| STAERKAER ET AL., TETRAHEDRON LETTERS, vol. 32, 1991, pages 4033 - 4034 |
| TAGUCHI T ET AL., J IMMUNOL METHODS, vol. 128, 1990, pages 65 - 73 |
| TING ET AL., DNA, vol. 7, 1988, pages 275 - 286 |
| TOMME ET AL., PROTEIN ENG., vol. 7, 1994, pages 117 - 123 |
| TOWNSEND ET AL., CELL, vol. 62, 1990, pages 285 |
| TSUNASAWA ET AL., J. BIOL. CHEM., vol. 260, 1985, pages 5382 - 5391 |
| VALERIO ET AL., INT. J. PEPTIDE PROTEIN RES., vol. 33, 1989, pages 428 - 438 |
| VAN BERGEN EN HENEGOUWEN ET AL., GENES DEV., vol. 1, 1987, pages 525 - 31 |
| VAN HEEKESCHUSTER, J. BIOL. CHEM, vol. 264, 1989, pages 5503 - 5509 |
| VITA R. ET AL., NUCLEIC ACIDS RES., vol. 43, 2015, pages D405 - D412 |
| VOGELPOWELL: "A Compendium of Vaccine Adjuvants and Excipients", 1995, PLENUM PRESS, pages: 141 - 228 |
| WANG ET AL., J. IMMUNOL., vol. 165, 2001, pages 490 - 497 |
| WELCH ET AL., J. CELL. BIOL., vol. 101, 1985, pages 1198 - 1211 |
| WELCH, SCIENTIFIC AMERICAN, May 1993 (1993-05-01), pages 56 - 64 |
| WU ET AL., METHODS IN ENZYMOL, vol. 152, 1987, pages 343 - 349 |
| YAMAZAKI ET AL., NUCL. ACIDS RES, vol. 17, pages 7108 |
| YOUNG, ANNU. REV. IMMUNOL., vol. 8, 1990, pages 401 - 420 |
| YU, K. ET AL., MOLECULAR MEDICINE, vol. 8, 2002, pages 137 - 48 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024026452A1 (en) | 2022-07-29 | 2024-02-01 | Repertoire Immune Medicines, Inc. | T cell epitopes associated with type 1 diabetes |
| WO2025072849A1 (en) | 2023-09-29 | 2025-04-03 | Repertoire Immune Medicines, Inc. | Mhc-presentable peptides associated with type 1 diabetes |
Also Published As
| Publication number | Publication date |
|---|---|
| TW202012430A (zh) | 2020-04-01 |
| MA52363A (fr) | 2021-03-03 |
| US20200000905A1 (en) | 2020-01-02 |
| EP3784688A2 (en) | 2021-03-03 |
| JP2021522239A (ja) | 2021-08-30 |
| US11065317B2 (en) | 2021-07-20 |
| WO2019210055A3 (en) | 2019-12-19 |
| AU2019261451A2 (en) | 2020-12-10 |
| US20220008527A1 (en) | 2022-01-13 |
| CA3096909A1 (en) | 2019-10-31 |
| AU2019261451A1 (en) | 2020-12-03 |
| KR20210005646A (ko) | 2021-01-14 |
| CN112218883A (zh) | 2021-01-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220008527A1 (en) | Heat Shock Protein-Binding Peptide Compositions And Methods Of Use Thereof | |
| JP6925980B2 (ja) | がんの処置および予防のためのワクチン | |
| JP5883804B2 (ja) | 単純ヘルペスウイルス感染の治療および予防用ワクチン | |
| WO2019018796A1 (en) | VACCINE EPITOPES AGAINST HERPES SIMPLEX VIRUS RECOGNIZED SPECIFICALLY BY MEMORY T LYMPHOCYTES RESIDING IN FABRICS | |
| US7420037B2 (en) | Heat shock protein-based vaccines and immunotherapies | |
| CA3163485A1 (en) | Teipp peptide variant and uses thereof | |
| US20220275049A1 (en) | Antigenic polypeptides and methods of use thereof | |
| AU2019300038B2 (en) | Self-assembling peptide scaffold | |
| US20220257733A1 (en) | Antigenic polypeptides and methods of use thereof | |
| WO2023081861A9 (en) | Enhanced expression via autotransporters | |
| MHC | Mycobacterium tuberculosis Heat Shock |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19732758 Country of ref document: EP Kind code of ref document: A2 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 3096909 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020559376 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20207033282 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2019732758 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2019732758 Country of ref document: EP Effective date: 20201126 |
|
| ENP | Entry into the national phase |
Ref document number: 2019261451 Country of ref document: AU Date of ref document: 20190425 Kind code of ref document: A |