WO2019199807A1 - T7 rna polymerase variants - Google Patents
T7 rna polymerase variants Download PDFInfo
- Publication number
- WO2019199807A1 WO2019199807A1 PCT/US2019/026561 US2019026561W WO2019199807A1 WO 2019199807 A1 WO2019199807 A1 WO 2019199807A1 US 2019026561 W US2019026561 W US 2019026561W WO 2019199807 A1 WO2019199807 A1 WO 2019199807A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- rna polymerase
- rna
- variant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1241—Nucleotidyltransferases (2.7.7)
- C12N9/1247—DNA-directed RNA polymerase (2.7.7.6)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1068—Template (nucleic acid) mediated chemical library synthesis, e.g. chemical and enzymatical DNA-templated organic molecule synthesis, libraries prepared by non ribosomal polypeptide synthesis [NRPS], DNA/RNA-polymerase mediated polypeptide synthesis
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/07—Nucleotidyltransferases (2.7.7)
- C12Y207/07006—DNA-directed RNA polymerase (2.7.7.6)
Definitions
- RNA polymerase Transcription of deoxyribonucleic acid (DNA) to ribonucleic acid (RNA) during gene expression is a fundamental cellular process that occurs when RNA polymerase attaches to a DNA template to begin polymerization of RNA. Essential cellular processes such as transcription generally occur at 37 °C, and many enzymes including RNA polymerase are typically inactive at temperatures above 37 °C. Accordingly, RNA polymerase variants having increased thermal stability at high temperatures are needed for RNA production at elevated temperatures.
- the present disclosure provides T7 RNA polymerase (RNAP) variants with enhanced thermostability.
- Use of these variants for RNA synthesis reactions results in an improvement in RNA yield and product profile (relative to wild-type T7 RNAP, even at temperatures above 37 °C).
- These variants were rationally designed through the identification of individual mutations predicted to improve protein stability and minimize impact on affinity.
- Variants engineered to include specific combinations of those mutations were then tested to identify T7 RNAP variants with improved properties, for example, improved RNA production at elevated temperatures.
- some embodiments of the present disclosure provide a T7 RNAP variant comprising at least one amino acid substitution in the amino acid sequence identified by SEQ ID NO: 1, wherein at least one amino acid substitution is at a position selected from the group consisting of 1320, 1396, F546, S684 and G788.
- the present disclosure provides a T7 RNAP variant comprising at least two amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein at least two amino acid substitutions are at positions selected from the group consisting of 1320, 1396, F546, S684, and G788.
- the T7 RNAP variant comprises amino acid substitutions at positions: 1320, 1396, F546, S684, and G788 (Ml) of the amino acid sequence identified by SEQ ID NO: 1.
- the T7 RNAP variant comprises amino acid substitutions at positions: 1320, 1396, and G788 (M2) of the amino acid sequence identified by SEQ ID NO: 1.
- the T7 RNAP variant comprises amino acid substitutions at position: 1396, S684, and G788 (M3) of the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, the T7 RNAP variant comprises amino acid substitutions at positions: 1320, S684, and G788 (M4) of the amino acid sequence identified by SEQ ID NO: 1.
- the amino acid sequence of SEQ ID NO: 1 is the wild-type sequence of T7 RNAP.
- compositions, kits, systems, and methods comprising a T7 RNAP variant described herein.
- the present disclosure provides methods for producing ribonucleic acid (RNA). These methods, in some embodiments, comprise combining a T7 RNA polymerase variant as provided herein with nucleoside triphosphates and a deoxyribonucleic acid (DNA) template encoding an RNA of interest, and producing the RNA of interest.
- RNA ribonucleic acid
- dsRNA double stranded RNA
- FIG. 2 is a graph showing comparison of %RNA produced by T7 RNA polymerase variants based on temperature.
- T7 RNAP Bacteriophage T7 RNA polymerase
- Wild-type T7 RNAP comprises 883 amino acids, corresponding to SEQ ID NO: 1. Wild-type T7 RNAP has polymerase activity at 37 °C, pH 7.5, and is inactive at higher temperatures.
- T7 RNA polymerase variants disclosed herein may be used in a variety of methods performed at a temperature of 37 °C or greater.
- T7 RNA polymerase T7 RNA polymerase variants that differ from the amino acid sequence of a naturally occurring T7 RNAP identified by SEQ ID NO:l.
- T7 RNAP variants comprising at least one amino acid substitution in the amino acid sequence of SEQ ID NO: 1, wherein at least one substitution is at a position(s) selected from the group consisting of 1320, 1396, F546, S684 and G788.
- At least one amino acid substitution is at position 1320 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least one amino acid substitution is at position 1396 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least one amino acid substitution is at position F546 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least one amino acid substitution is at position S684 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least one amino acid substitution is at position G788 in the amino acid sequence identified by SEQ ID NO: 1.
- T7 RNAP variants comprising at least two, at least three, or at least four amino acid substitutions in the amino acid sequence of SEQ ID NO: 1, wherein at least two, at least three, at least four amino acid, or all five substitutions are at positions selected from the group consisting of 1320, 1396, F546, S684, and G788.
- the T7 RNAP variant comprises at least two amino acid substitutions in the amino acid sequence of SEQ ID NO: 1, wherein at least two amino acid substitutions are at positions selected from the group consisting of 1320, 1396, F546, S684, and G788.
- At least two amino acid substitutions are at positions 1320 and 1396 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least two amino acid substitutions are at positions 1320 and F546 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least two amino acid substitutions are at positions 1320 and S684 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least two amino acid substitutions are at positions 1320 and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least two amino acid substitutions are at positions 1396 and F546 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least two amino acid substitutions are at positions 1396 and S684 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least two amino acid substitutions are at positions 1396 and S684 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least two amino acid substitutions are at positions 1396 and S684 in
- At least two amino acid substitutions are at positions 1396 and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least two amino acid substitutions are at positions F546 and S684 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least two amino acid substitutions are at positions F546 and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least two amino acid substitutions are at positions S684 and G788 in the amino acid sequence identified by SEQ ID NO: 1.
- the T7 RNAP variant comprises at least three amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein at least three amino acid substitutions are at positions selected from the group consisting of 1320, 1396, F546, S684, and G788.
- At least three amino acid substitutions are at positions 1320, 1396, and F546 in the amino acid sequence identified by SEQ ID NO: 1.
- At least three amino acid substitutions are at positions 1320, 1396 and S684 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least three amino acid substitutions are at positions 1320, 1396, and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least three amino acid substitutions are at positions 1320, F546, and S684 in the amino acid sequence identified by SEQ ID NO:
- At least three amino acid substitutions are at positions 1320, F546, and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least three amino acid substitutions are at positions 1320, S684, and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least three amino acid substitutions are at positions 1396, F546, and S684 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least three amino acid substitutions are at positions 1396, S684, and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least three amino acid substitutions are at positions 1396, F546, and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least three amino acid substitutions are at positions F546, S684, and G788 in the amino acid sequence identified by SEQ ID NO: 1.
- the T7 RNAP variant comprises at least four amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein at least two amino acid substitutions are at positions selected from the group consisting of 1320, 1396, F546, S684, and G788.
- At least four amino acid substitutions are at positions 1320, 1396, F546, and S684 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least four amino acid substitutions are at positions 1320, 1396, F546, and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least four amino acid substitutions are at positions 1320, F546, S684, and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least four amino acid substitutions are at positions 1320, 1396, S684, and G788 in the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, at least four amino acid substitutions are at positions 1396, F546, S684, and G788 in the amino acid sequence identified by SEQ ID NO: 1.
- the T7 RNAP variant comprises five amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein the five amino acid substitutions are at positions 1320, 1396, F546, S684, and G788.
- amino acids may be substituted with another amino acid at positions 1320, 1396, F546, S684, and G788 in the amino acid sequence identified by SEQ ID NO: 1.
- amino acid substitutions include, but are not limited to, I320L, I320V, I396L, I396V, F546W, F546Y, S684A, S684V, G788A, and G788V of the amino acid sequence identified by SEQ ID NO: 1.
- the T7 RNAP variant in some embodiments, has at least one amino acid substitution at a position selected from the group consisting of 1320, 1396, F546, S684 and G788 in SEQ ID NO: 1, wherein the amino acid substitution at position 1320 is I320L or I320V, wherein the amino acid substitution at position 1396 is I396L or I396V, wherein the amino acid substitution at position F546 is F546W or F546Y, wherein the amino acid substitution at position S684 is S684A or S684V, and/or wherein the amino acid substitution at position G788 is G788A or G788V.
- the T7 RNAP variant has at least two amino acid substitutions at a position selected from the group consisting of 1320, 1396, F546, S684, and G788 in SEQ ID NO: 1, wherein the amino acid substitution at position 1320 is I320L or I320V, wherein the amino acid substitution at position 1396 is I396L or I396V, wherein the amino acid substitution at position F546 is F546W or F546Y, wherein the amino acid substitution at position S684 is S684A or S684V, and/or wherein the amino acid substitution at position G788 is G788A or G788V.
- the T7 RNAP variant has at least three amino acid substitutions at a position selected from the group consisting of 1320, 1396, F546, S684, and G788 in SEQ ID NO: 1, wherein the amino acid substitution at position 1320 is I320L or I320V, wherein the amino acid substitution at position 1396 is I396L or I396V, wherein the amino acid substitution at position F546 is F546W or F546Y, wherein the amino acid substitution at position S684 is S684A or S684V, and/or wherein the amino acid substitution at position G788 is G788A or G788V.
- the T7 RNAP variant has at least four amino acid substitutions at a position selected from the group consisting of 1320, 1396, F546, S684, and G788 in SEQ ID NO: 1, wherein the amino acid substitution at position 1320 is I320L or I320V, wherein the amino acid substitution at position 1396 is I396L or I396V, wherein the amino acid substitution at position F546 is F546W or F546Y, wherein the amino acid substitution at position S684 is S684A or S684V, and/or wherein the amino acid substitution at position G788 is G788A or G788V.
- the T7 RNAP variant has at least five amino acid substitutions at a position selected from the group consisting of 1320, 1396, F546, S684, and G788 in SEQ ID NO: 1, wherein the amino acid substitution at position 1320 is I320L or I320V, wherein the amino acid substitution at position 1396 is I396L or I396V, wherein the amino acid substitution at position F546 is F546W or F546Y, wherein the amino acid substitution at position S684 is S684A or S684V, and/or wherein the amino acid substitution at position G788 is G788A or G788V.
- the T7 RNAP variant comprises at least two amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein the at least two amino acid substitutions are selected from the group consisting of I320L, I320V, I396L, I396V, F546W, F546Y, S684A, S684V, G788A, and G788V.
- the T7 RNAP variant comprises at least three amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein the at least three amino acid substitutions are selected from the group consisting of I320L, I320V, I396L, I396V, F546W, F546Y, S684A, S684V, G788A, and G788V.
- the T7 RNAP variant comprises at least four amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein the at least four amino acid substitutions are selected from the group consisting of I320L, I320V, I396L, I396V, F546W, F546Y, S684A, S684V, G788A, and G788V.
- the T7 RNAP variant comprises at least five amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein the at least five amino acid substitutions are selected from the group consisting of I320L, I320V, I396L, I396V, F546W, F546Y, S684A, S684V, G788A, and G788V.
- the T7 RNAP variant comprises at least two amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein the at least two amino acid substitutions are selected from the group consisting of I320L, I396L, F546W, S684A, and G788A. In some embodiments, the T7 RNAP variant comprises at least three amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein the at least three amino acid substitutions are at positions selected from I320L, I396L, F546W, S684A, and G788A.
- the T7 RNAP variant comprises at least four amino acid substitutions in the amino acid sequence identified by SEQ ID NO: 1, wherein the at least four amino acid substitutions are selected from the group consisting of I320L, I396L, F546W, S684A, and G788A.
- the T7 RNAP variant comprising I320L, I396L, and G788A amino acid substitutions comprises the amino acid sequence identified by SEQ ID NO: 3. In some embodiments, the T7 RNAP variant comprising I396L, S684A, and G788A amino acid substitutions comprises the amino acid sequence identified by SEQ ID NO: 4. In some embodiments, the T7 RNAP variant comprising I320L, S684A, and G788A amino acid substitutions comprises the amino acid sequence identified by SEQ ID NO: 5. In some embodiments, the T7 RNAP variant comprising I320L, I396L, F546W, S684A, and G788A amino acid substitutions comprises the amino acid sequence identified by SEQ ID NO: 2.
- the T7 RNAP variant comprises the amino acid sequence identified by SEQ ID NO: 3. In some embodiments, the T7 RNAP variant comprises the amino acid sequence identified by SEQ ID NO: 4. In some embodiments, the T7 RNAP variant comprises the amino acid sequence identified by SEQ ID NO: 5. In some embodiments,
- the T7 RNAP variant comprises the amino acid sequence identified by SEQ ID NO: 2.
- T7 RNAP variants further comprising at least one substitution of an amino acid that is not at position 1320, 1396, F546, S684, or G788 of SEQ ID NO: 1.
- the additional amino acid substitution(s) is not made at conserved amino acids, or at amino acids residing within a conserved motif, where such residues are essential for protein activity.
- the additional an amino acid substitution may, however, be incorporated into a non-conserved region of a T7 RNAP variant such that the T7 RNAP variant retains its activity.
- the T7 RNA variants of the present disclosure further comprise at least one amino acid substitution that is not described herein, provided the additional amino acid substitute does not inhibit polymerase activity.
- a T7 RNA variant comprises an amino acid substitution at position 1320 and at least one additional amino acid substitution.
- a T7 RNA variant comprises an amino acid substitution at position 1396 and at least one additional amino acid substitution.
- a T7 RNA variant comprises an amino acid substitution at position F546 and at least one additional amino acid substitution.
- a T7 RNA variant comprises an amino acid substitution at position S684 and at least one additional amino acid substitution.
- a T7 RNA variant comprises an amino acid substitution at position G788 and at least one additional amino acid substitution.
- a T7 RNAP variant in some embodiments, comprises two, three, four, or five amino acid substitutions at positions selected from 1320, 1396, F546, S684, and G788 in an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% identity to SEQ ID NO: 1.
- identity refers to a relationship between the sequences of two or more polypeptides, as determined by comparing (aligning) the sequences. Identity measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (e.g ., “algorithms”). Identity of related molecules can be readily calculated by known methods. “Percent (%) identity” as it applies to amino acid sequences is defined as the percentage of amino acid residues in the candidate amino acid sequence that are identical with the residues in the amino acid sequence of a second sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent identity. Identity depends on a calculation of percent identity but may differ in value due to gaps and penalties introduced in the calculation.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- Techniques for determining identity are codified in publicly available computer programs.
- Exemplary computer software to determine homology between two sequences include, but are not limited to, GCG program package (Devereux, J. et al., Nucleic Acids Research, 12(1): 387, 1984), the BLAST suite (Altschul, S. F. et al., Nucleic Acids Res. 25: 3389, 1997), and FASTA (Altschul, S. F. et al., J. Molec. Biol. 215: 403, 1990).
- Other techniques include: the Smith- Waterman algorithm (Smith, T.F. et al, J. Mol. Biol. 147: 195, 1981; the Needleman-Wunsch algorithm
- RNA polymerase examples include, but are not limited to, RNA polymerase from Bacteriophage T3 (NCBI Reference Sequence: NP_52330l.l, SEQ ID NO: 11), RNA polymerase from Bacteriophage SP6 (UniProt: P06221, SEQ ID NO: 12), RNA Polymerase from Erwinia phage FE44 (NCBI Reference Sequence: YP_0087667l9.l, SEQ ID NO: 13), RNA polymerase from Kluyvera bacteriophage Kvpl (GenBank: ACJ14548.1, SEQ ID NO: 14), and RNA polymerase from Yersinia bacteriophage phiYe03-l2 (UniProt: Q9T145, SEQ ID NO:
- nucleic acids encoding a T7 RNAP variant are provided herein.
- the nucleic acid encodes a T7 RNAP variant of SEQ ID NO: 2.
- the nucleic acid encodes a T7 RNAP variant of SEQ ID NO: 3.
- the nucleic acid encodes a T7 RNAP variant of SEQ ID NO: 4.
- the nucleic acid encodes a T7 RNAP variant of SEQ ID NO: 5.
- Some aspects of this disclosure provide a T7 RNAP variant having increased RNA polymerase activity as compared to a naturally occurring T7 RNA polymerase.
- RNA polymerase activity refers to the property of the T7 RNAP variant to synthesize RNA polymers.
- the activity of a T7 RNAP variant is assessed based on fidelity and polymerization kinetics (e.g ., rate of polymerization).
- one unit of a T7 RNAP variant may incorporate 10 nmoles of NTP into acid insoluble material (e.g., RNA product) in 30 minutes at a temperature of 37 °C.
- the T7 RNAP variant may remain active (able to catalyze the polymerization reaction at a temperature of 37 °C or greater). In some embodiments, the T7 RNAP variant may remain active at a temperature of 42 °C, or higher. In some
- the T7 RNAP variant may remain active at a temperature of 42 °C, 43 °C, 44 °C, 45 °C, 46 °C, 47 °C, 48 °C, 49 °C, 50 °C, 51 °C, 52 °C, 53 °C, 54 °C, 55 °C, 55 °C, 56 °C, 57 °C, 58 °C, 59 °C, 60 °C, 61 °C, 62 °C, 63 °C, 64 °C, 65 °C, 66 °C, 67 °C, 68 °C, 69 °C, 70 °C, 71 °C, 72 °C, 73 °C, 74 °C, 75 °C, 76 °C, 77 °C, 78 °C, 79 °C, or 80 °C.
- the T7 RNAP variant may remain active at a temperature greater than 37 °C for 15 minutes to 48 hours, or longer.
- the T7 RNAP variant may remain active at a temperature greater than 37 °C for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 24, 36, 42, or 48 hours.
- T7 RNAP variants described herein may remain active at an elevated temperature that denatures a control RNA polymerase.
- the T7 RNAP variant in some embodiments, retains greater than 10% of its activity at an elevated temperature (e.g ., above 37 °C) that would otherwise inactivate (i.e ., less than 20%, less than 10%, less than 5%, less than 2 %, less than 1%, or 0% of its original activity) a control RNA polymerase.
- the T7 RNAP variant may retain 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% activity at an elevated temperature (e.g., above 37 °C) that would otherwise inactivate a control RNA polymerase.
- an elevated temperature e.g., above 37 °C
- the T7 RNAP variant may retain 10-100%, 25-100%, or 50- 100% activity at an elevated temperature (e.g., above 37 °C) that would otherwise inactivate a control RNA polymerase. In some embodiments, the T7 RNAP variant may retain 10-90%, 10-85%, 10-80%, 10-75%, 10-70%, 10-65%, 10-60%, 10-55%, 25-90%, 25-85%, 25-80%, 25-75%, 25-70%, 25-65%, 25-60%, 25-55%, 50-90%, 50-85%, 50-80%, 50-75%, 50-70%, 50-65%, 50-60%, or 50-55% activity at an elevated temperature (e.g., above 37 °C) that would otherwise inactivate a control RNA polymerase.
- an elevated temperature e.g., above 37 °C
- the T7 RNAP variant may produce at least 10% more RNA product than a control RNA polymerase at a temperature of 37 °C or greater. In some embodiments, the T7 RNAP variant produces at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or at least 100% more RNA product than a control RNA polymerase at a temperature greater than 37 °C.
- T7 RNAP variant having improved thermal stability as compared to a control T7 RNA polymerase, which is a naturally occurring T7 RNA polymerase.
- Thermal stability refers to the property of the T7 RNAP variant to resist denaturation at elevated temperatures.
- a control T7 RNA polymerase may be partially or completely denatured (inactivated) at a temperature of 42 °C, and a T7 RNAP variant is considered“thermostable” and does not denature at 42 °C.
- the T7 RNAP variant has increased thermal stability (e.g ., increased resistance to denaturation) at a temperature greater than 37 °C, greater than 38 °C, greater than 39 °C, greater than 40 °C, greater than 41 °C, greater than 42 °C, greater than 43 °C, greater than 44 °C, greater than 45 °C, greater than 46 °C, greater than 47 °C, greater than 48 °C, greater than 49 °C, greater than 50 °C, greater than 51 °C, greater than 52 °C, greater than 53 °C, greater than 54 °C, greater than 55 °C, greater than 56 °C, greater than 57 °C, greater than 58 °C, greater than 59 °C, greater than 60 °C, greater than 6l°C, greater than 62 °C, greater than 63 °C, greater than 64 °C, greater than 65 °C, greater than 66 °C, greater than 67
- the present disclosure encompasses the use of a T7 RNAP variant in a variety of methods including, but not limited to, methods of producing RNA (e.g., in vitro transcription, in vivo transcription), methods of producing labeled RNA probes (e.g., radiolabeled RNA probes), methods for preparing a RNA vaccine, methods of polymerizing nucleotides, methods for amplifying RNA, and methods for producing proteins.
- methods of producing RNA e.g., in vitro transcription, in vivo transcription
- methods of producing labeled RNA probes e.g., radiolabeled RNA probes
- methods for preparing a RNA vaccine e.g., methods for preparing a RNA vaccine
- methods of polymerizing nucleotides e.g., in amplifying RNA, and methods for producing proteins.
- T7 RNAP variants described herein have increased thermal stability as compared to a control RNA polymerase, thus methods of use of the T7 RNAP variants described herein may be performed at a temperature greater than 37 °C.
- the method of use of the T7 RNAP variant is performed at a temperature greater than 37 °C, greater than 38 °C, greater than 39 °C, greater than 40 °C, greater than 41 °C, greater than 42 °C, greater than 43 °C, greater than 44 °C, greater than 45 °C, greater than 46 °C, greater than 47 °C, greater than 48 °C, greater than 49 °C, greater than 50 °C, greater than 51 °C, greater than 52 °C, greater than 53 °C, greater than 54 °C, greater than 55 °C, greater than 56 °C, greater than 57 °C, greater than 58 °C, greater than 59 °C, greater than 60 °C, greater than 61 °C, greater than 62 °C, greater than 63 °C, greater than 64 °C, greater than 65 °C, greater than 66 °C, greater than 67 °C, greater than 68 °C
- T7 RNAP variants disclosed herein provide certain advantages over T7 RNA polymerases, for example, for producing a RNA of interest at a temperature of 37 °C or greater.
- a T7 RNAP variant produces a greater amount of a RNA of interest than a control RNA polymerase at a temperature of 37 °C or greater.
- the amount of RNA of interest produced by the T7 RNAP variant is at least 1.2-fold greater than an amount of the RNA of interest produced using a control RNA polymerase at a temperature of 37 °C or greater. In some embodiments, the amount of RNA of interest produced by the T7 RNAP variant is at least 1.3-fold greater, at least 1.4-fold greater, at least 1.5-fold greater, at least 1.6-fold greater, at least 1.7-fold greater, at least 1.8-fold greater, at least 1.9-fold greater, at least 2-fold greater, at least 2.5- fold greater, at least 3 -fold greater, at least 4-fold greater, at least 5 -fold greater, at least 6- fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10- fold greater, at least 1 l-fold greater, at least 12-fold greater, at least 13 -fold greater, at least 14-fold greater, at least l5-fold greater, at least 20-fold greater, at least 25-
- RNA e.g ., RNA product, labeled RNA, RNA vaccine, or amplified RNA
- pH e.g., pH 8
- temperature e.g., 15 °C to 70 °C
- length of time e.g., 5 min to 72 hrs
- salt concentration e.g., sodium chloride, potassium chloride, sodium acetate, and/or potassium acetate at a concentration of 5 mM to 1 M
- presence of phosphate and divalent ions e.g. Mg 2+
- buffer is added to a reaction mixture, for example, to achieve a particular pH value and/or salt concentration.
- buffers include, without limitation, phosphate buffer, Tris buffer, MOPS buffer, HEPES buffer, citrate buffer, acetate buffer, malate buffer, MES buffer, histidine buffer, PIPES buffer, bis-tris buffer, and ethanolamine buffer.
- stability improving agents are added to a reaction mixture, for example, to improve activity and/or stability of various proteins.
- stability improving agents include polyamines (e.g. spermidine, putrescine, cadaverine etc.), carrier proteins (e.g . BSA, etc.), pyrophosphatase, glycerol, diols (e.g. 1, 2-propanediol, etc.), DMSO, salts (e.g. NaCl, MgCl 2 , MnCk), reducing agents (e.g. Dithiothreitol (DTT), Tris (2- carboxyethyl) phosphine hydrochloride (TCEP), beta-mercaptoethanol).
- polyamines e.g. spermidine, putrescine, cadaverine etc.
- carrier proteins e.g . BSA, etc.
- pyrophosphatase e.g. 1, 2-propanediol, etc.
- a reaction mixture during a RNA polymerization reaction is incubated for 0.5-24 hours at a temperature of 37°C, greater than 37 °C, greater than 38 °C, greater than 39 °C, greater than 40 °C, greater than 41 °C, greater than 42 °C, greater than 43 °C, greater than 44 °C, greater than 45 °C, greater than 46 °C, greater than 47 °C, greater than 48 °C, greater than 49 °C, greater than 50 °C, greater than 51 °C, greater than 52 °C, greater than 53 °C, greater than 54 °C, greater than 55 °C, greater than 56 °C, greater than 57 °C, greater than 58 °C, greater than 59 °C, greater than 60 °C, greater than 61 °C, greater than 62 °C, greater than 63 °C, greater than 64 °C, greater than 65 °C, greater than 66 °C, greater than
- RNA produced by the methods provided herein may be any form of RNA, including single-stranded RNA (ssRNA) and double- stranded RNA (dsRNA).
- single-stranded RNA include messenger RNA (mRNA), micro RNA (miRNA), small interfering RNA (siRNA), piwi-interacting RNA (piRNA), and antisense RNA.
- Double- stranded RNA herein includes wholly double- stranded molecules that do not contain a single- stranded region (e.g., a loop or overhang), as well as partially double- stranded molecules that contain a double-stranded region and a single- stranded region (e.g., a loop or overhang).
- RNA of interest is RNA of interest is dsRNA, ssRNA, siRNA, miRNA, piRNA, mRNA, shRNA or guide RNA (gRNA).
- RNA produced by the methods provided herein may be modified as described herein.
- RNA is produced according to a method described herein and subsequently modified. In some embodiments, RNA is produced according to a method described herein using a modified starting material. In some embodiments, the modified starting material is a modified nucleobase. In some embodiments, the modified starting material is a modified nucleoside. In some embodiments, the modified starting material is a modified nucleotide. In some embodiments, modified RNA comprises a backbone modification. In some instances, backbone modification results in a longer half-life for the RNA due to reduced nuclease-mediated degradation. This is turn results in a longer half-life. Examples of suitable backbone modifications include, but are not limited to, phosphorothioate
- RNA may comprise other modifications, including modifications at the base or the sugar moieties.
- examples include RNA having sugars which are covalently attached to low molecular weight organic groups other than a hydroxyl group at the 3 ' position and other than a phosphate group at the 5 ' position ( e.g ., a 2'-0-alkylated ribose), RNA having sugars such as arabinose instead of ribose.
- RNA also embrace substituted purines and pyrimidines such as C-5 propyne modified bases (Wagner el al, Nature Biotechnology 14:840-844, 1996).
- purines and pyrimidines include, but are not limited to, 5-methylcytosine, 2-aminopurine, 2-amino-6-chloropurine, 2,6-diaminopurine, and hypoxanthine.
- modified RNA production may include use of modified nucleotides in the reaction mixture such as 5’-methyl-CTP, pseudouridine, 2’-Omethyl- UTP, 2-fluoro modified pyrimidines. Other such modifications are well known to those of skill in the art.
- a DNA template encoding the RNA of interest may be used in the methods described herein.
- a DNA template includes a promoter, optionally an inducible promoter, operably linked to nucleotide sequence encoding a desired RNA product and, optionally, a transcriptional terminator.
- a DNA template is typically provided on a vector, such as a plasmid, although other template formats may be used (e.g., linear DNA templates generated by polymerase chain reaction (PCR), chemical synthesis, or other means known in the art).
- more than one DNA template is used in a reaction mixture. In some embodiments, 2, 3, 4, 5, or more different DNA templates are used in a reaction mixture.
- a promotor or terminator may be a naturally-occurring sequence or an engineered sequence.
- an engineered sequence is modified to enhance
- the promotor is a naturally-occurring sequence.
- the promoter is an engineered sequence.
- the terminator is a naturally-occurring sequence. In other embodiments, the terminator is an engineered sequence.
- the T7 RNAP variant in any suitable form may be used in the methods described herein.
- the T7 RNAP variant is provided as a cell lysate from cells that express the T7 RNAP variant.
- the T7 RNAP variant is provided as an enzyme preparation from cells that express the T7 RNAP variant.
- the enzyme preparation may be purified, partially purified, or unpurified.
- the enzyme preparation comprises the T7 RNAP variant and cells or cellular components used to express the T7 RNAP variant.
- the enzyme preparation comprises the T7 RNAP variant purified ( e.g ., essentially free) from cells or cellular components.
- the T7 RNAP variant is provided by nucleic acids encoding the T7 RNAP variant.
- kits comprises a T7 RNAP variant provided herein.
- the kit comprises a nucleic acid vector for expressing a T7 RNAP variant as described herein.
- the kit further comprises at least one reagent for performing a method described herein including, but not limited to, methods of producing RNA, methods of labeled RNA probes, methods of preparing a RNA vaccine, methods of polymerizing nucleotides, and methods for amplifying RNA.
- the at least one reagent includes, but is not limited to, a ribonucleoside triphosphate, a reaction buffer, and a DNA template.
- the kit described herein may include one or more containers housing components for performing the methods described herein and optionally instructions of uses. Any of the kit described herein may further comprise components needed for performing the assay methods.
- Each component of the kits may be provided in liquid form (e.g., in solution), or in solid form, (e.g., a dry powder). In certain cases, some of the components may be reconstitutable or otherwise processible (e.g., to an active form), for example, by the addition of a suitable solvent or other species (e.g., water or buffer), which may or may not be provided with the kit.
- kits may optionally include instructions and/or promotion for use of the components provided.
- “instructions” can define a component of instruction and/or promotion, and typically involve written instructions on or associated with packaging of the disclosure. Instructions also can include any oral or electronic instructions provided in any manner such that a user will clearly recognize that the instructions are to be associated with the kit, for example, audiovisual (e.g., videotape, DVD, etc.), Internet, and/or web-based communications, etc.
- the written instructions may be in a form prescribed by a governmental agency regulating the manufacture, use, or sale of pharmaceuticals or biological products, which can also reflect approval by the agency of manufacture, use or sale for animal administration.
- kits includes all methods of doing business including methods of education, hospital and other clinical instruction, scientific inquiry, drug discovery or development, academic research, pharmaceutical industry activity including pharmaceutical sales, and any advertising or other promotional activity including written, oral and electronic communication of any form, associated with the disclosure. Additionally, the kits may include other components depending on the specific application, as described herein.
- kits may contain any one or more of the components described herein in one or more containers.
- the components may be prepared sterilely, packaged in a syringe and shipped refrigerated. Alternatively it may be housed in a vial or other container for storage.
- kits may include the active agents premixed and shipped in a vial, tube, or other container.
- kits may have a variety of forms, such as a blister pouch, a shrink wrapped pouch, a vacuum sealable pouch, a sealable thermoformed tray, or a similar pouch or tray form, with the accessories loosely packed within the pouch, one or more tubes, containers, a box or a bag.
- the kits may be sterilized after the accessories are added, thereby allowing the individual accessories in the container to be otherwise unwrapped.
- the kits can be sterilized using any appropriate sterilization techniques, such as radiation sterilization, heat
- kits may also include other components, depending on the specific application, for example, containers, cell media, salts, buffers, reagents, syringes, needles, a fabric, such as gauze, for applying or removing a disinfecting agent, disposable gloves, a support for the agents prior to administration, etc.
- RNA polymerase variants for example, RNA polymerase proteins from one or more organisms, which comprise at least one amino acid substitution as described herein.
- at least of the amino acid residues, identified below by a dot, of a RNA polymerase protein may be mutated.
- the 1320, 1396, F546, S684, and G788 residues of the amino acid sequence provided in SEQ ID NO: 1, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 11-15 are mutated.
- RNA polymerase sequences from various species were aligned to demonstrate that corresponding homologous amino acid residues of 1320, 1396, F546, S684, and G788 of SEQ ID NO: 1 can be identified in other RNA polymerase proteins, allowing the generation of RNA polymerase variants with corresponding mutations of the homologous amino acid residues.
- the alignment was carried out using the NCBI Constraint-based Multiple Alignment Tool (COBALT(accessible at st-va.ncbi. nlm.nih.gov/tools/cobalt), with the following parameters. Alignment parameters: Gap penalties -11,-1; End-Gap penalties - 5,-1.
- CDD Parameters Use RPS BLAST on; Blast E-value 0.003; Find conserveed columns and Recompute on.
- Query Clustering Parameters Use query clusters on; Word Size 4; Max cluster distance 0.8; Alphabet Regular.
- RNA polymerase sequences in the alignment are: (T7): Wild-type T7 RNA polymerase from Bacteriophage T7, GenBank: FJ881694.1, SEQ ID NO: 1; (T3): RNA polymerase from Bacteriophage T3, NCBI Reference Sequence: NP_52330l.l, SEQ ID NO: 11; (SP6) RNA polymerase from Bacteriophage SP6, UniProt: P06221, SEQ ID NO: 12; and (FE44) RNA Polymerase from Erwinia phage FE44, NCBI Reference Sequence: YP_0087667l9.l, SEQ ID NO: 13. Amino acid residues 1320, 1396, F546, S684, and G788 in wild-type T7 RNA polymerase and the homologous amino acids in the aligned sequences are identified with a dot above the amino acid residues.
- NDVLADFYSQFADQLHETQLDKMPPLPKKGNLNLQDILKSDFAFA 884 (SEQ ID NO: 11)
- FE44 839 NDVLADFYDQFADQLHESQLDKMPEMPAKGSLDLQEILKSDFAFA 883 (SEQ ID NO: 13)
- the alignment demonstrates that amino acid sequences and amino acid residues that are homologous to a T7 RNA polymerase amino acid sequence or amino acid residue can be identified across RNA polymerase sequences, including but not limited to RNA polymerase sequences from different species, by identifying the amino acid sequence or residue that aligns with the T7 RNA polymerase amino acid sequence or the T7 RNA polymerase residue using alignment programs and algorithms known in the art.
- RNA polymerase variants in which one or more of the amino acid residues identified by a dot in SEQ ID NOs: 11-13 (e.g ., T3, SP6, and FE44, respectively) are mutated as described herein.
- the residues 1320, 1396, F546, S684, and G788 in T7 RNA polymerase of SEQ ID NO: 1 that correspond to the residues identified in SEQ ID NOs: 11-13 by a dot are referred to herein as“homologous” or“corresponding” residues.
- homologous residues can be identified by sequence alignment, e.g., as described above, and by identifying the sequence or residue that aligns with the T7 RNA polymerase sequence or residue.
- mutations in T7 RNA polymerase sequences that correspond to mutations identified in SEQ ID NO: 1 herein, e.g., mutations of residues 1320, 1396, F546, S684, and G788 in SEQ ID NO: 1, are referred to herein as“homologous” or “corresponding” mutations.
- the amino acid substitution corresponding to the amino acid substitution at position 1320 in SEQ ID NO: 1 for the aligned sequences above are V321 for T3, 1293for SP6, and V320 for FE44.
- RNA polymerase sequences from different species are known in the art. Amino acid residues corresponding to residues 1320, 1396, F546, S684, and G788 in T7 RNA polymerase of SEQ ID NO: 1 may be identified as described herein for RNA polymerase sequences known in the art. Any of the identified RNA polymerase sequences may be used in accordance with the present disclosure.
- Example 2 Cell-free synthesis of RNA using a wild-type T7 RNA polymerase or a thermostable T7 RNA polymerase variant
- Mutations were created via site directed mutagenesis using primers. Mutations in the T7 RNA polymerase variants described herein are shown in Table 1. A variant version of the polymerase was generated via overlap PCR reactions using specific primers and native T7 RNA polymerase (Uniprot P00573) as the template. Furthermore, six histidine residues were introduced into these variant polymerases at the N-terminus to facilitate with protein purification during the PCR step via custom primers. The obtained PCR product was cloned into a vector pBAD24 using Nhel and Hindlll restriction enzymes. Such a process was carried out for each individual mutation. This process was repeated using a pre-existing variant as the PCR template to generate more than one mutation.
- Each variant polymerase was sequenced to ensure accuracy at DNA level as well as at the protein level after purification.
- the wild type T7 RNA polymerase was also his-tagged and cloned in pBAD24 similarly to serve as a control for native activity.
- Table 1 Mutant T7 RNA polymerase variants.
- the plasmids carrying different his-tagged variant polymerase sequences were transformed into E. coli BL21 strain lacking the chromosomal T7 RNAP to generate host strains for protein expression.
- the transformed E. coli strains were grown using 1% inoculum into Luria Broth (with carbenicillin antibiotic) at 37°C with a constant agitation of 250 rpm. Cultures were induced with 0.2% Arabinose for 4 hours when the ODeoo reached 0.6. At the end of 4 hours of induction, cultures were harvested via centrifugation and the collected biomass was kept frozen at -80°C for future testing. Samples were collected before induction and at the end of study for SDS-PAGE analysis (to verify protein expression) and for ODeoo determination.
- Luria Broth (Sigma Aldrich) was used for cell growth (10 g/L Tryptone, 5 g/L yeast extract and 5 g/L NaCl).
- IX Wash buffer (20 mM Sodium phosphate, 500 mM NaCl, 40 mM Imidazole, at pH 7.4) was used for resuspending biomass, for column equilibration and for washing the column.
- the composition of elution buffer used is as follows: 20 mM Sodium phosphate, 500 mM NaCl, 750 mM Imidazole, at pH 7.4.
- the composition of 2X dialysis buffer used is as follows: 2X PBS, 5 mM DTT, 0.01% Triton X 100.
- thermostability/ activity testing the following commercially available chemicals/ reagents were used: Ribonucleotide solution (ATP/ GTP/ CTP/ UTP);spermidine ; MgS0 4 , Thermostable inorganic pyrophosphatase (TIPP).
- the composition of 10X reaction buffer (10X RB) is as follows: 300 mM MgS04, 20 mM Spermidine.
- the quench buffer composition is as follows: 20 mM Tris-HCl pH 8.0, 10 mM EDTA pH 8. After quenching the reactions, DNase I was used to remove the background DNA template.
- RNA loading dye (2X) was used while running agarose gels. DNA template used was a linearized plasmid carrying the coding sequence (524 bp).
- the biomass was lysed, and the generated crude lysate was clarified and used to purify the target protein of interest.
- the biomass was first resuspended in IX Wash buffer and then lysed using high pressure homogenization. Following lysis, the crude lysates were centrifuged for 60 minutes at l5,000g, 4 °C. After centrifugation the supernatant (clarified lysate) was decanted and used for purification.
- the clarified lysates were used for Ni ion affinity chromatography-based purification using FPLC (AKTA prime plus) using ion exchange / gradient elution protocol. 1 mL his- columns were procured from GE Healthcare. All buffers used are listed above. Following purification, the proteins were dialyzed overnight for 16 hours at the end of which the proteins were stocked in -20°C using 50% glycerol (final concentration).
- IVT in vitro transcription
- candidate mutant polymerases were performed between 37 °C - 54 °C.
- the reactions were set-up at 25 pL scale in PCR plates and incubated for two hours at the test temperature using a thermal cycler. Following this, the reactions were quenched and processed for downstream analysis.
- the IVT reaction mixture is described in Table 2.
- Table 2 IVT reaction mixture composition (25 pL).
- RNA product verification/ quantification via agarose gel electrophoresis or via HPLC.
- agarose gel electrophoresis For agarose gel electrophoresis, 5 pL was removed from the quenched reaction mixture and added to 10 pL of quench buffer and mixed well in a PCR plate. Next, 15 pL of 2X RNA dye was added and this mixture was heated at 70 °C for 10 mins in a thermalcycler. About, 10 pL of this mixture was then run on a 2% agarose gel stained with SYBR safe for 60 mins at 140 V before imaging.
- RNA synthesized in the reaction was purified via an adapted RNASwift extraction protocol and quantitated using a reverse phase ion pair chromatography as described (Nwokeji, A. O., Kilby, P. M., Portwood, D. E., & Dickman, M. J. (2016). RNASwift: A rapid, versatile RNA extraction method free from phenol and chloroform. Analytical Biochemistry, 512, 36 -46).
- RNA polymerase served as reference control for native T7 RNA polymerase activity.
- a negative control was also included, where T7 RNA polymerase was replaced with water. No dsRNA product was detected from the negative control reactions (FIG. 1).
- M3 makes most dsRNA from 37 °C - 42.3 °C; followed by M4 up to 40.l°C; followed by M2 up to 38.5°C.
- M2, M3 and M4 T7 RNA polymerases make more dsRNA relative to the wild-type at temperatures ranging from 37 °C - 46.5 °C.
- Ml T7 RNA polymerase makes more dsRNA relative to the wild-type at temperatures ranging from 42.3 °C - 46.5 °C.
- Table 3 indicates the fold increase in dsRNA titer relative to the wild type polymerase.
- Table 4 indicates the average dsRNA titer (ng / pL) of mutant and wild-type T7 RNA polymerases.
- Table 3 Fold increase in dsRNA titer relative to WT by Ml, M2, M3 and M4 T7 RNA polymerases.
- WT retains 90% of its activity up to 40.1 °C and has an activity of only 12% relative to its maximum at 42.3 °C.
- WT polymerase loses activity at 44.5 °C and higher.
- the fold increase in dsRNA titer relative to the control wild type is represented in Table 3. It is seen that Ml has a 5.3-fold increase in titer relative to the wild type at 42.3 °C.
- M2, M3 and M4 make greater amount of RNA at all tested temperatures relative to the wild type polymerase. At 42.3 °C M2, M3, M4 make 8.9, 13.3 and 9.5 fold greater amount of RNA than the wild type protein.
- M1-M4 have improved thermostability relative to WT.
- RNA polymerase from Kluyvera bacteriophage Kvpl Kluyvera bacteriophage Kvpl
- composition it is to be understood that methods of using the composition for any of the purposes disclosed herein are included, and methods of making the composition according to any of the methods of making disclosed herein or other methods known in the art are included, unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise.
- values that are expressed as ranges can assume any specific value within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise. It is also to be understood that unless otherwise indicated or otherwise evident from the context and/or the understanding of one of ordinary skill in the art, values expressed as ranges can assume any subrange within the given range, wherein the endpoints of the subrange are expressed to the same degree of accuracy as the tenth of the unit of the lower limit of the range.
- any particular embodiment of the present invention may be explicitly excluded from any one or more of the claims. Where ranges are given, any value within the range may explicitly be excluded from any one or more of the claims. Any embodiment, element, feature, application, or aspect of the compositions and/or methods of the invention, can be excluded from any one or more claims. For purposes of brevity, all of the embodiments in which one or more elements, features, purposes, or aspects is excluded are not set forth explicitly herein.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Plant Pathology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Physics & Mathematics (AREA)
- Bioinformatics & Computational Biology (AREA)
- Biophysics (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Enzymes And Modification Thereof (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP19719092.9A EP3775183A1 (en) | 2018-04-10 | 2019-04-09 | T7 rna polymerase variants |
| CN201980025099.1A CN112218947A (zh) | 2018-04-10 | 2019-04-09 | T7 rna聚合酶变体 |
| JP2020555861A JP2021520815A (ja) | 2018-04-10 | 2019-04-09 | T7rnaポリメラーゼバリアント |
| AU2019253693A AU2019253693A1 (en) | 2018-04-10 | 2019-04-09 | T7 RNA polymerase variants |
| US17/046,665 US20210180034A1 (en) | 2018-04-10 | 2019-04-09 | T7 rna polymerase variants |
| CA3095620A CA3095620A1 (en) | 2018-04-10 | 2019-04-09 | T7 rna polymerase variants |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862655747P | 2018-04-10 | 2018-04-10 | |
| US62/655,747 | 2018-04-10 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019199807A1 true WO2019199807A1 (en) | 2019-10-17 |
Family
ID=66248824
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/026561 Ceased WO2019199807A1 (en) | 2018-04-10 | 2019-04-09 | T7 rna polymerase variants |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20210180034A1 (https=) |
| EP (1) | EP3775183A1 (https=) |
| JP (1) | JP2021520815A (https=) |
| CN (1) | CN112218947A (https=) |
| AU (1) | AU2019253693A1 (https=) |
| CA (1) | CA3095620A1 (https=) |
| WO (1) | WO2019199807A1 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021228905A3 (en) * | 2020-05-11 | 2022-01-13 | Thermo Fisher Scientific Baltics Uab | Mutant polymerases and methods of using the same |
| GB202406294D0 (en) | 2024-05-06 | 2024-06-19 | Thermo Fisher Scientific Baltics Uab | Methods and compositions for producing capped mRNA |
| US12492420B2 (en) | 2024-03-29 | 2025-12-09 | New England Biolabs, Inc. | Compositions, kits, and methods for in vitro transcription |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112980811B (zh) * | 2021-03-06 | 2022-02-25 | 苏州瀚源新酶生物科技有限公司 | Rna聚合酶突变体及其应用、重组载体及其制备方法和应用、重组工程菌及其应用 |
| JP2025078889A (ja) * | 2022-02-03 | 2025-05-21 | 天野エンザイム株式会社 | 酵素製剤 |
| CN120082531A (zh) * | 2023-12-28 | 2025-06-03 | 翌圣生物科技(上海)股份有限公司 | T7 rna聚合酶突变体及其应用 |
| CN118374471A (zh) * | 2024-05-08 | 2024-07-23 | 珍奥集团股份有限公司 | 一种不产生免疫原性副产物、具备高转录活性的t7 rna聚合酶突变体与应用 |
| CN121160664B (zh) * | 2024-06-17 | 2026-04-24 | 南京诺唯赞生物科技股份有限公司 | Rna聚合酶变体 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001066705A1 (en) * | 2000-03-07 | 2001-09-13 | Akzo Nobel N.V. | Rna polymerase mutants with increased thermostability |
| EP2377928A2 (en) * | 2010-04-16 | 2011-10-19 | Roche Diagnostics GmbH | Novel T7 RNA polymerase variants with enhanced thermostability |
| WO2017123748A1 (en) * | 2016-01-13 | 2017-07-20 | New England Biolabs, Inc. | Thermostable variants of t7 rna polymerase |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB0611444D0 (en) * | 2006-06-09 | 2006-07-19 | Medical Res Council Technology | Rnase H2 complex and genes therefor |
| EP2912180A1 (en) * | 2012-10-29 | 2015-09-02 | Technische Universität Dortmund | T7 rna polymerase variants and methods of using the same |
| SG11201607720XA (en) * | 2014-03-20 | 2016-10-28 | Univ Texas | T7 rna polymerase variants with expanded substrate range and enhanced transcriptional yield |
-
2019
- 2019-04-09 JP JP2020555861A patent/JP2021520815A/ja not_active Withdrawn
- 2019-04-09 AU AU2019253693A patent/AU2019253693A1/en not_active Abandoned
- 2019-04-09 CN CN201980025099.1A patent/CN112218947A/zh active Pending
- 2019-04-09 CA CA3095620A patent/CA3095620A1/en active Pending
- 2019-04-09 US US17/046,665 patent/US20210180034A1/en not_active Abandoned
- 2019-04-09 EP EP19719092.9A patent/EP3775183A1/en not_active Withdrawn
- 2019-04-09 WO PCT/US2019/026561 patent/WO2019199807A1/en not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001066705A1 (en) * | 2000-03-07 | 2001-09-13 | Akzo Nobel N.V. | Rna polymerase mutants with increased thermostability |
| EP2377928A2 (en) * | 2010-04-16 | 2011-10-19 | Roche Diagnostics GmbH | Novel T7 RNA polymerase variants with enhanced thermostability |
| WO2017123748A1 (en) * | 2016-01-13 | 2017-07-20 | New England Biolabs, Inc. | Thermostable variants of t7 rna polymerase |
Non-Patent Citations (12)
| Title |
|---|
| "GenBank", Database accession no. ACJ14548.1 |
| ADAM J. MEYER ET AL: "Transcription yield of fully 2'-modified RNA can be increased by the addition of thermostabilizing mutations to T7 RNA polymerase mutants", NUCLEIC ACIDS RESEARCH, vol. 43, no. 15, 3 September 2015 (2015-09-03), pages 7480 - 7488, XP055422628, ISSN: 0305-1048, DOI: 10.1093/nar/gkv734 * |
| ALTSCHUL, S. F. ET AL., J. MOLEC. BIOL., vol. 215, 1990, pages 403 |
| ALTSCHUL, S. F. ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 |
| CHAKRABORTY, A. ET AL., SCI REP., vol. 3, 2013, pages 1746 |
| DATABASE EMBL [online] 11 November 2008 (2008-11-11), LINGOHR R.J. ET AL: "RNA polymerase [Kluyvera phage Kvp1]", XP002791371, Database accession no. ACJ14548 * |
| DATABASE EMBL [online] 15 April 2005 (2005-04-15), PAJUNEN M.I. ET AL.: "RNA polymerase [Yersinia phage phiYe03-12]", XP002791372, Database accession no. CAB63592 * |
| DEVEREUX, J. ET AL., NUCLEIC ACIDS RESEARCH, vol. 12, no. 1, 1984, pages 387 |
| NEEDLEMAN, S.B. ET AL., J. MOL. BIOL., vol. 48, 1970, pages 443 |
| NWOKEJI, A. O.; KILBY, P. M.; PORTWOOD, D. E.; DICKMAN, M. J.: "RNASwift: A rapid, versatile RNA extraction method free from phenol and chloroform", ANALYTICAL BIOCHEMISTRY, vol. 512, 2016, pages 36 - 46, XP029711378, DOI: doi:10.1016/j.ab.2016.08.001 |
| SMITH, T.F. ET AL., J. MOL. BIOL., vol. 147, 1981, pages 195 |
| WAGNER ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 840 - 844 |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021228905A3 (en) * | 2020-05-11 | 2022-01-13 | Thermo Fisher Scientific Baltics Uab | Mutant polymerases and methods of using the same |
| US12448612B2 (en) | 2020-05-11 | 2025-10-21 | Thermo Fisher Scientific Baltics Uab | Mutant polymerases and methods of using the same |
| US12492420B2 (en) | 2024-03-29 | 2025-12-09 | New England Biolabs, Inc. | Compositions, kits, and methods for in vitro transcription |
| GB202406294D0 (en) | 2024-05-06 | 2024-06-19 | Thermo Fisher Scientific Baltics Uab | Methods and compositions for producing capped mRNA |
| WO2025233286A2 (en) | 2024-05-06 | 2025-11-13 | Thermo Fisher Scientific Baltics Uab | The use of arca and 2'o-methyl transferase enzyme to produce cap1 structure of 5' mrna cap |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3775183A1 (en) | 2021-02-17 |
| CA3095620A1 (en) | 2019-10-17 |
| CN112218947A (zh) | 2021-01-12 |
| AU2019253693A1 (en) | 2020-10-22 |
| JP2021520815A (ja) | 2021-08-26 |
| US20210180034A1 (en) | 2021-06-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20210180034A1 (en) | T7 rna polymerase variants | |
| Songailiene et al. | HEPN-MNT toxin-antitoxin system: the HEPN ribonuclease is neutralized by OligoAMPylation | |
| Vincent et al. | Cells of Escherichia coli contain a protein-tyrosine kinase, Wzc, and a phosphotyrosine-protein phosphatase, Wzb | |
| Zhou et al. | Recombinant purine nucleoside phosphorylases from thermophiles: preparation, properties and activity towards purine and pyrimidine nucleosides | |
| López-López et al. | Intragenomic 16S rDNA divergence in Haloarcula marismortui is an adaptation to different temperatures | |
| Valderrama et al. | AccR is a master regulator involved in carbon catabolite repression of the anaerobic catabolism of aromatic compounds in Azoarcus sp. CIB | |
| Fang et al. | Characterization and application of a thermophilic Argonaute from archaeon Thermococcus thioreducens | |
| US20130203635A1 (en) | Nucleic acid ligation method | |
| Messing et al. | Structure and biological function of the RNA pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus | |
| Severinova et al. | Localization of the Escherichia coli RNA polymerase β′ subunit residue phosphorylated by bacteriophage T7 kinase Gp0. 7 | |
| EP3697930B1 (en) | Primer-independent dna polymerases and their use for dna synthesis | |
| Brocker et al. | Target genes, consensus binding site, and role of phosphorylation for the response regulator MtrA of Corynebacterium glutamicum | |
| Zylberman et al. | Evolution of vitamin B2 biosynthesis: 6, 7-dimethyl-8-ribityllumazine synthases of Brucella | |
| Dubey et al. | MnoSR is a bona fide two-component system involved in methylotrophic metabolism in Mycobacterium smegmatis | |
| Ping et al. | Whole‐cell biosynthesis of cytarabine by an unnecessary protein‐reduced Escherichia coli that coexpresses purine and uracil phosphorylase | |
| Roovers et al. | The open reading frame TTC1157 of Thermus thermophilus HB27 encodes the methyltransferase forming N2-methylguanosine at position 6 in tRNA | |
| Sun et al. | An Argonaute from Thermus parvatiensis exhibits endonuclease activity mediated by 5′ chemically modified DNA guides: Argonaute using 5′ chemically modified DNA guides | |
| Mura et al. | Structure and function of an archaeal homolog of survival protein E (SurEα): An acid phosphatase with purine nucleotide specificity | |
| Gao et al. | Expression and functional study of VpV262 Pol, a moderately halophilic DNA polymerase from the Vibrio parahaemolyticus phage VpV262 | |
| Hashimi et al. | DNA gyrase from the albicidin producer Xanthomonas albilineans has multiple-antibiotic-resistance and unusual enzymatic properties | |
| Teplyakov et al. | Crystal structure of the bacterial YhcH protein indicates a role in sialic acid catabolism | |
| Marsic et al. | New DNA polymerase from the hyperthermophilic marine archaeon Thermococcus thioreducens | |
| Wang et al. | A programmable DNA cleavage nuclease from mesophilic bacteria Clostridium beijerinckii | |
| Okuda et al. | Systematic characterization of the ADP-ribose pyrophosphatase family in the Cyanobacterium Synechocystis sp. strain PCC 6803 | |
| Lan et al. | Structural evolution of the selectivity clamp confers ADPR-PP specificity in Namat, a phage nicotinamide ADP-ribose transferase |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19719092 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3095620 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020555861 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2019253693 Country of ref document: AU Date of ref document: 20190409 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019719092 Country of ref document: EP Effective date: 20201110 |