WO2019195514A1 - Methods for detecting and quantifying fgf21 - Google Patents

Methods for detecting and quantifying fgf21 Download PDF

Info

Publication number
WO2019195514A1
WO2019195514A1 PCT/US2019/025726 US2019025726W WO2019195514A1 WO 2019195514 A1 WO2019195514 A1 WO 2019195514A1 US 2019025726 W US2019025726 W US 2019025726W WO 2019195514 A1 WO2019195514 A1 WO 2019195514A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
seq
acid sequence
antibody
conservative substitutions
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/025726
Other languages
English (en)
French (fr)
Inventor
John Hok Nin LOWE
Junichiro Sonoda
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
F Hoffmann La Roche AG
Genentech Inc
Original Assignee
F Hoffmann La Roche AG
Genentech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020207031566A priority Critical patent/KR20200140852A/ko
Priority to BR112020019756-4A priority patent/BR112020019756A2/pt
Priority to AU2019247778A priority patent/AU2019247778A1/en
Priority to CN201980022872.9A priority patent/CN112005119A/zh
Priority to JP2020554225A priority patent/JP2021520492A/ja
Priority to CA3092388A priority patent/CA3092388A1/en
Application filed by F Hoffmann La Roche AG, Genentech Inc filed Critical F Hoffmann La Roche AG
Priority to MX2020010387A priority patent/MX2020010387A/es
Priority to EP19718949.1A priority patent/EP3775930A1/en
Publication of WO2019195514A1 publication Critical patent/WO2019195514A1/en
Priority to IL277726A priority patent/IL277726A/en
Anticipated expiration legal-status Critical
Priority to US17/063,640 priority patent/US20210025890A1/en
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/577Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/74Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/26Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against hormones ; against hormone releasing or inhibiting factors
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/557Immunoassay; Biospecific binding assay; Materials therefor using kinetic measurement, i.e. time rate of progress of an antigen-antibody interaction
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/475Assays involving growth factors
    • G01N2333/50Fibroblast growth factors [FGF]

Definitions

  • the present invention relates to antibodies that bind to FGF21 as well as immunoassay methods and kits using the same.
  • Fibroblast growth factor 21 is an endocrine member of the FGF superfamily and plays a role in the regulation of glucose and lipid metabolism.
  • FGF21 requires FGF-receptor (FGFR) isoforms and the membrane-bound co-receptor Klotho- beta (KLB) for signaling (Ogawa et al. Proc. Natl. Acad. Sci. USA 104(18):7432-37 (2007); US 2010/0184665).
  • FGF21 is a potent disease-modifying protein that has beneficial effects on glucose homeostasis and insulin sensitivity, and has been shown to reverse obesity and type 2 diabetes in animal disease models (Kharitonenkov et al. J.
  • FGF21 can be proteolytically cleaved at both the N-terminus and the C- terminus, and such cleavage has been shown to affect the activity of FGF21.
  • the first four amino acids which have the sequence His-Pro-Ile-Pro (HPIP (SEQ ID NO: 76)) in human FGF21 can be cleaved by a dipeptidyl peptidase (Dunshee et al. (2016)).
  • the endopeptidase fibroblast activation protein cleaves the most terminal 10 amino acids, which have the amino acid sequence Ser-Gln- Gly-Arg-Ser-Pro-Ser-Tyr-Ala-Ser (SQGRSPSYAS (SEQ ID NO: 77)) in human FGF21 (Dunshee et al. (2016)).
  • FGF21 that lacks the four N-terminal amino acids is fully active; whereas, FGF21 that lacks the last ten C-terminal amino acids cannot bind the co- receptor KLB and is inactive (Yie et al. FEBS Letters 583 : 19-24 (2009)).
  • Circulating FGF21 has been proposed to be a biomarker for metabolic disorders such as diabetes as increased serum levels of FGF21 were observed in obese subjects, in subjects with nonalcoholic fatty liver disease (NAFLD) and in subjects with type 2 diabetes (Zhang et al. Diabetes 57(5): 1246-1253 (2008); Li et al. Diabetes Res. Clin. Pract. 93(1): 10-16 (2011)).
  • NASH nonalcoholic fatty liver disease
  • type 2 diabetes Zhang et al. Diabetes 57(5): 1246-1253 (2008); Li et al. Diabetes Res. Clin. Pract. 93(1): 10-16 (2011).
  • the present disclosure provides antibodies that bind Fibroblast growth factor 21 (FGF21) and use of such antibodies in immunoassay methods for the detection and quantification of FGF21 protein, e.g, total and/or active FGF21 protein, in a sample.
  • FGF21 Fibroblast growth factor 21
  • the present disclosure provides immunoassays for determining the amount of total FGF21 protein in a sample.
  • the method to determine the amount of total FGF21 protein in a sample can include contacting a capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 with the sample to generate a sample-capture antibody combination material, (b) contacting the sample-capture antibody combination material with a detector antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, (c) detecting the detector antibody bound to the sample- capture antibody combination material and (d) calculating an amount of total FGF21 protein present in the sample based on the level of the detector antibody bound.
  • the capture antibody and the detector antibody bind to different epitopes within amino acid residues 5-172 of FGF21.
  • the present disclosure provides immunoassays for determining the amount of active FGF21 protein in a sample.
  • the method to determine the amount of active FGF21 protein in a sample can include (a) contacting a capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 with the sample to generate a sample-capture antibody combination material, (b) contacting the sample-capture antibody combination material with a detector antibody that binds to an epitope present within amino acid residues 173-182 of FGF21, (c) detecting the detector antibody bound to the sample- capture antibody combination material and (d) calculating an amount of active FGF21 protein present in the sample based on the level of the detector antibody bound.
  • the present disclosure provides immunoassays for determining the ratio of active FGF21 protein to total FGF21 protein in a sample.
  • the method can include (i) contacting a first capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 with the sample to generate a first sample-capture antibody combination material, (ii) contacting the first sample-capture antibody combination material with a first detector antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, (iii) detecting the first detector antibody bound to the sample-capture antibody combination material and (iv) calculating an amount of total FGF21 protein present in the sample based on the level of the first detector antibody bound.
  • the method can further include (i) contacting a second capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 with the sample to generate a second sample-capture antibody combination material, (ii) contacting the second sample-capture antibody combination material with a second detector antibody that binds to an epitope present within amino acid residues 173-182 of FGF21, (iii) detecting the second detector antibody bound to the sample-capture antibody combination material and (iv) calculating an amount of active FGF21 protein present in the sample based on the level of the second detector antibody bound.
  • the method can include comparing the calculated amount of total FGF21 protein with the calculated amount of active FGF21 protein to determine the ratio of active FGF21 protein to total FGF21 protein in the sample.
  • the first capture antibody and second capture antibody are the same antibody.
  • the first capture antibody and the first detector antibody bind to different epitopes within amino acid residues 5-172 of FGF21.
  • the immunoassay method is an enzyme-linked immunosorbent assay (ELISA). In certain embodiments, the immunoassay method detects the amount of total or active FGF21 protein in the sample at an in-well sensitivity from about 2 pg/ml to about 20 pg/ml.
  • ELISA enzyme-linked immunosorbent assay
  • the immunoassay method is a single molecule detection assay, e.g ., that uses the Quanterix Simoa HD-l AnalyzerTM. In certain embodiments, the immunoassay method detects the amount of total or active FGF21 protein in the sample at an in-well sensitivity from about 0.2 pg/ml to about 0.5 pg/ml.
  • kits for performing immunoassay methods for the detection and quantification of FGF21 protein further provides kits for performing immunoassay methods for the detection and quantification of FGF21 protein.
  • the present disclosure provides kits for determining the amount of total FGF21 protein in a sample.
  • the kit for quantifying the amount of total FGF21 protein includes (a) a capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, (b) a detector antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 and (c) a detection agent.
  • the capture antibody and the detector antibody bind to different epitopes within amino acid residues 5-172 of FGF21.
  • kits for determining the amount of active FGF21 protein in a sample includes (a) a capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, (b) a detector antibody that binds to an epitope present within amino acid residues 173-182 of FGF21 and (c) a detection agent.
  • kits for determining the amount of active FGF21 protein in a sample can include (a) a first capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, (b) a first detector antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, (c) a second capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, (d) a second detector antibody that binds to an epitope present within amino acid residues 173-182 of FGF21 and (e) one or more detection agents.
  • a first capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21
  • a first detector antibody that binds to an epitope present within amino acid residues 5-172 of FGF21
  • a second capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21
  • a second detector antibody that binds to an epitope present within amino acid residue
  • the first capture antibody and second capture antibody are the same antibody. In certain embodiments, the first capture antibody and the first detector antibody bind to different epitopes within amino acid residues 5-172 of FGF21.
  • the detection agent for detecting the detector antibody, first detector antibody and/or second detector antibody can be selected from a group consisting of a streptavidin-P-D-galactopyranose conjugate, a streptavidin- horseradish peroxidase conjugate and a combination thereof. In certain embodiments, the streptavidin-P-D-galactopyranose conjugate has a concentration from about 100 pM to about 400 pM.
  • kits of the present disclosure can further include resorufm P-D-galactopyranoside, tetramethylbenzidine, hydrogen peroxide or combinations thereof.
  • a kit of the present disclosure can include a streptavidin-P-D-galactopyranose conjugate as the detection agent and can further include resorufm P-D-galactopyranoside.
  • a kit of the present disclosure can include a streptavidin-horseradish peroxidase conjugate as the detection agent and can further include tetramethylbenzidine and hydrogen peroxide.
  • a kit disclosed herein detects the amount of total or active FGF21 protein in the sample at an in-well sensitivity from about 2 pg/ml to about 20 pg/ml. In certain embodiments, a kit disclosed herein detects the amount of total or active FGF21 protein in the sample at an in-well sensitivity from about 0.2 pg/ml to about 0.5 pg/ml.
  • the capture antibody, first capture antibody or second capture antibody is immobilized to a paramagnetic bead. In certain embodiments, the capture antibody, first capture antibody and/or second capture antibody binds to FGF21 with a K d from about 10 10 M to 10 13 M. In certain embodiments, the detector antibody, first detector antibody and second detector antibody is conjugated to biotin. In certain embodiments, the detector antibody and/or first detector antibody binds to FGF21 with a K d from about 10 10 M to 10 13 M. In certain embodiments, the detector antibody and/or first detector antibody for use in determining the amount of total FGF21 protein has a concentration from about 0.1 pg/ml to about 1 pg/ml. In certain embodiments, the detector antibody and/or second detector antibody for use in determining the amount of active FGF21 protein has a concentration from about 1 pg/ml to about 3 pg/ml.
  • the capture antibody, first capture antibody and/or second capture antibody includes or competitively binds to an antibody that includes: (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 26 and 27, e.g ., 26, and conservative substitutions thereof, (b) a heavy chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 30 and 31, e.g.
  • a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 34 and 35, e.g., 34, and conservative substitutions thereof
  • a light chain variable region CDR1 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 38 and 39, e.g, 38, and conservative substitutions thereof
  • a light chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 42 and 43, e.g, 42, and conservative substitutions thereof
  • a light chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 46 and 47, e.g, 46, and conservative substitutions thereof.
  • the capture antibody, first capture antibody and/or second capture antibody includes or competitively binds to an antibody that includes: (a) a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 54, 55, 74 and 75, e.g, 54, and conservative substitutions thereof; and (b) a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 50, 51, 70 and 71, e.g, 50, and conservative substitutions thereof.
  • the capture antibody, first capture antibody and/or second capture antibody includes or competitively binds to an antibody that includes: (a) a heavy chain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 22, 23, 66 and 67, e.g, 22, and conservative substitutions thereof; and (b) a light chain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 18, 19, 62 and 63, e.g, 18, and conservative substitutions thereof.
  • the detector antibody and/or first detector antibody includes or competitively binds to an antibody that includes: (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 28 and 29, e.g, 29, and conservative substitutions thereof, (b) a heavy chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 32 and 33, e.g, 33, and conservative substitutions thereof, (c) a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 36 and 37, e.g, 37, and conservative substitutions thereof, (d) a light chain variable region CDR1 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 40 and 41, e.g ., 41, and conservative substitutions thereof, (e) a light chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 44
  • the detector antibody and/or first detector antibody includes or competitively binds to an antibody that includes: (a) a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 56, 57, 72 and 73, e.g. , 57, and conservative substitutions thereof; and (b) light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 52, 53, 68 and 69, e.g. , 53, and conservative substitutions thereof.
  • the detector antibody and/or first detector antibody includes or competitively binds to an antibody that includes: (a) a heavy chain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 24, 25, 64 and 65, e.g. , 25, and conservative substitutions thereof; and (b) a light chain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 20, 21, 60 and 61, e.g. , 21, and conservative substitutions thereof.
  • an antibody used in the disclosed immunoassay methods can be a monoclonal antibody, a chimeric antibody, a humanized antibody or a human antibody. In certain embodiments, an antibody used in the disclosed
  • immunoassay methods can be an antibody fragment, e.g. , a Fv, Fab, Fab’, scFv, diabody or F(ab’) 2 fragment.
  • the sample being analyzed is a blood sample obtained from a subject. In certain embodiments, the sample is a plasma sample obtained from a subject.
  • an isolated anti-FGF2l antibody or an antigen-binding portion thereof, comprises: (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 26-29, and conservative substitutions thereof; (b) a heavy chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 30-33, and conservative substitutions thereof; (c) a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 34-37, and conservative substitutions thereof; (d) a light chain variable region CDR1 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 38-41, and conservative substitutions thereof; (e) a light chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 42-45, and conservative substitutions thereof; and (f) a
  • an isolated anti-FGF2l antibody comprises: (a) a heavy chain variable domain (VH) sequence comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 54-57 and 72-75; and (b) a light chain variable domain (VH) sequence comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 50-53 and 68- 71.
  • VH heavy chain variable domain
  • VH light chain variable domain
  • an isolated anti-FGF2l antibody comprises: (a) a heavy chain sequence comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 22-25 and 64-67; and (b) a light chain sequence comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 18-21 and 60-63.
  • Figure 1 Depicts the results of an ELISA screen of 80 hybridoma supernatants expressing anti-FGF2l antibodies.
  • Figure 2 Depicts the dose response of intact versus cleaved FGF21 detection by sandwich ELISA using mAb4 or mAb9 capture antibodies and the mAbl 1 detector antibody.
  • Figure 3 Depicts the BIACORE® surface plasmon resonance analysis of anti-FGF2l antibodies mAb4, mAb9, mAbl l and mAbl5.
  • Figure 4 Depicts a schematic diagram showing anti-FGF2l antibody binding to FGF21 (FGF19 is used as negative control).
  • Figure 5 Depicts a schematic diagram of a non-limiting embodiment of colorimetric ELISA methods for detecting total FGF21 and active FGF21.
  • Figure 6 Depicts a non-limiting embodiment of a protocol for performing total and active FGF21 ELISA assays.
  • Figure 7 Depicts the results of ELISA assays using either mAb4 or mAbl 1 capture antibodies and various detection antibodies.
  • Figure 8 Depicts a comparison of the sensitivity of detecting wild-type and cleaved human FGF21 using exemplary total and active FGF21 ELISA assays.
  • Figure 9 Depicts detection of human FGF21 using an exemplary total FGF21 ELISA assay.
  • Figure 10 Depicts an ELISA assay indicating that exemplary anti-FGF2l antibodies do not cross-react with mouse FGF21.
  • Figure 11 Depicts a comparison of the sensitivities of capture antibodies mAb4 and mAb9 in exemplary total and active FGF21 ELISA assays.
  • Figure 12 Depicts the effect of coat buffer and concentration on the sensitivity of an exemplary total FGF21 ELISA assay using mAb4 as the capture antibody and mAh 15 as the detector antibody.
  • Figure 13 Depicts the effect of coat buffer and concentration on the sensitivity of an exemplary active FGF21 ELISA assay using mAb4 as the capture antibody and the sheep C-terminal pAb as the detector antibody.
  • Figure 14 Depicts the effect of biotin-conjugated detector antibody and HRP concentration on the sensitivity of an exemplary total FGF21 ELISA assay using mAb4 as the capture antibody and mAh 15 as the detector antibody.
  • Figure 15 Depicts a schematic diagram of a non-limiting embodiment of single molecule detection methods for detecting total FGF21 and active FGF21 using the Quanterix Simoa HD-l AnalyzerTM (“Quanterix Simoa”).
  • Figure 16 Depicts a non-limiting embodiment of a two-step assay protocol for exemplary total FGF21 and active FGF21 assays using the Quanterix Simoa.
  • Figure 17 Depicts the dose response of intact versus cleaved FGF21 detection by exemplary total FGF21 and active FGF21 assays using the Quanterix Simoa.
  • Figure 18 Depicts a non-limiting embodiment of a protocol for performing exemplary total and active FGF21 assays using the Quanterix Simoa.
  • Figure 19 Depicts the standard curves in exemplary total and active FGF21 assays using the Quanterix Simoa.
  • Figure 20 Depicts the standard curve performance in exemplary total and active FGF21 assays using the Quanterix Simoa.
  • Figure 21 Depicts a comparison of the sensitivity of detecting total and active FGF21 in the presence of B A010 and IL-12 buffers in exemplary total and active FGF21 assays using the Quanterix Simoa.
  • Figure 22 Depicts the effect of high bead (HB) and low bead (LB) concentrations on the sensitivity of exemplary total and active FGF21 assays using the Quanterix Simoa.
  • Figure 23 Depicts a comparison of the sensitivity of detecting total and active FGF21 using three capture paramagnetic bead lots in exemplary total and active FGF21 assays using the Quanterix Simoa.
  • Figure 24 Depicts a comparison of the sensitivity of detecting total and active FGF21 using various detection antibodies in an exemplary total FGF21 assay using the Quanterix Simoa.
  • Figure 25 Depicts an analysis of the hook effect in an exemplary total FGF21 assay using mAb4 as the capture antibody and mAh 15 as the detector antibody using the Quanterix Simoa.
  • Figure 26 Depicts the detection of total FGF21 and active FGF21 in plasma and serum samples from a healthy donor using exemplary total and active FGF21 ELISA assays.
  • Figure 27 Depicts the detection of total FGF21 and active FGF21 in plasma samples or plasma samples treated with MS-SAFE from donors that are hypertensive and donors that are not on medication using exemplary total and active FGF21 ELISA assays.
  • Figure 28 A Depicts the detection of total FGF21 and active FGF21 in plasma samples from healthy and type 2 diabetic patients using exemplary total and active FGF21 assays (Day 1) using the Quanterix Simoa.
  • Figure 28B Depicts the detection of total FGF21 and active FGF21 in plasma samples from healthy and type 2 diabetic patients using exemplary total and active FGF21 assays (Day 2) using the Quanterix Simoa.
  • Figure 29 Depicts the reproducibility of exemplary total and active FGF21 assays used for the detection of total FGF21 and active FGF21 in plasma samples from healthy and type 2 diabetic patients using the Quanterix Simoa.
  • Figure 30 Depicts the linearity of dilution of exemplary total and active FGF21 assays used for the detection of total FGF21 and active FGF21 in plasma samples from type 2 diabetic patients using the Quanterix Simoa.
  • Figure 31 Depicts the determination of lower limit of quantification (LLOQ) in exemplary total and active FGF21 assays used for the detection of total FGF21 and active FGF21 in plasma samples from type 2 diabetic patients using the Quanterix Simoa.
  • LLOQ lower limit of quantification
  • Figure 32 Depicts the specificity of exemplary total and active FGF21 assays used for the detection of total FGF21 and active FGF21 in plasma samples from type 2 diabetic patients using the Quanterix Simoa.
  • Figure 33 Depicts the detection of total FGF21 and active FGF21 in plasma samples prepared using P800 or K 2 -EDTA using exemplary total and active FGF21 assays using the Quanterix Simoa.
  • Figure 34 Depicts an analysis of total FGF21 and active FGF21 detected in P800 and K 2 -EDTA plasma samples from the GC29819 study in exemplary total and active FGF21 assays using the Quanterix Simoa.
  • Figure 35 Depicts a correlation between the amount of total FGF21 and active FGF21 detected in P800 and K 2 -EDTA plasma samples (GC29819 clinical Study) quantitated using an exemplary total FGF21 assay using the Quanterix Simoa.
  • Figure 36 Depicts a correlation between the amount of total FGF21 and active FGF21 detected in P800 and K 2 -EDTA plasma samples (GC29819 Study) quantitated using an exemplary active FGF21 assay using the Quanterix Simoa.
  • Figure 37 Depicts an evaluation of the stability of the P800 plasma samples from the GC29819 study using exemplary total and active FGF21 assays using the Quanterix Simoa.
  • Figure 38 Depicts the effect of assay diluent containing 10 pg/ml of mouse or sheep IgG on the total and active assays using the Quanterix Simoa.
  • Figure 39 Depicts the effect of assay diluent containing 10 pg/ml of mouse and sheep IgG on the total and active assays using the Quanterix Simoa.
  • Figure 40 Depicts the effect of assay diluent containing 10 pg/ml of mouse or sheep IgG on the standard curves on the total and active assays using the Quanterix Simoa.
  • Figure 41 A Depicts the sequences of the light chain variable regions of exemplary anti-FGF2l antibodies.
  • Light chain variable region sequences are disclosed as SEQ ID NOs: 50, 51, 52, 53, 71, 70, 69 and 68, respectively, in order of appearance.
  • CDR-L1 sequences are disclosed as SEQ ID NOs: 38, 39, 40, 41, 38, 39, 40 and 41, respectively, in order of appearance;
  • CDR-L2 sequences are disclosed as SEQ ID NOs: 42, 43, 44, 45, 42, 43, 44 and 45, respectively, in order of appearance;
  • CDR-L3 sequences are disclosed as SEQ ID NOs: 46, 47, 48, 49, 46, 47, 48 and 49, respectively, in order of appearance.
  • Figure 41B Depicts the sequences of the heavy chain variable regions of exemplary anti-FGF2l antibodies.
  • Heavy chain variable region sequences are disclosed as SEQ ID NOs: 54, 55, 56, 57, 75, 74, 73 and 72, respectively, in order of appearance.
  • CDR-H1 sequences are disclosed as SEQ ID NOs: 26, 27, 28, 29, 26, 27, 28 and 29, respectively, in order of appearance;
  • CDR-H2 sequences are disclosed as SEQ ID NOs: 30, 31, 32, 33, 30, 31, 32 and 33, respectively, in order of appearance;
  • CDR-H3 sequences are disclosed as SEQ ID NOs: 34, 35, 36, 37, 34, 35, 36 and 37, respectively, in order of appearance.
  • “about” or“approximately,” as used herein, can mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, e.g ., the limitations of the measurement system. For example,“about” can mean within 1 or more than 1 standard deviation, per the practice in the given value. Where particular values are described in the application and claims, unless otherwise stated the term “about” can mean an acceptable error range for the particular value, such as ⁇ 10% of the value modified by the term“about.”
  • polypeptide and“protein,” as used interchangeably herein, refer to polymers of amino acids of any length.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
  • the terms“polypeptide” and“protein” as used herein specifically encompass antibodies.
  • FGF21 Fibroblast growth factor 21
  • mammals such as primates (e.g ., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • the term encompasses“full-length,” unprocessed FGF21 as well as any form of FGF21 that results from processing in the cell.
  • the term also encompasses naturally occurring variants of FGF21, e.g., splice variants or allelic variants, unless otherwise indicated.
  • a non-limiting example of a full-length human FGF21 amino acid is shown below:
  • total FGF21 includes unprocessed forms of FGF21 as well as all forms of FGF21 that result from cellular processing, e.g, N- terminally-cleaved FGF21 and C-terminally-cleaved FGF21.
  • a non-limiting example of a human FGF21 amino acid that lacks the ten C-terminal amino acids is:
  • the term“total FGF21” includes FGF21 proteins that have the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 58 or SEQ ID NO: 59.
  • active FGF21 refers to an FGF21 protein that retains its C-terminal fragment.
  • the term includes processed forms of FGF21, such as those where the N-terminal fragment of FGF21, e.g ., amino acid residues 1-4 of SEQ ID NO: 1, has been cleaved.
  • the term“active FGF21” includes FGF21 proteins that have the amino acid sequence set forth in SEQ ID NO: 1 or the amino acid sequence set forth in SEQ ID NO: 59.
  • antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
  • an“antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
  • antibody fragments include, but are not limited to, Fv, Fab, Fab’, Fab’-SH, F(ab’) 2 ; diabodies; linear antibodies; single-chain antibody molecules (e.g., scFv); and multispecific antibodies formed from antibody fragments.
  • an antibody“which binds” an antigen of interest e.g, a FGF2l protein
  • an antibody“which binds” an antigen of interest is one that binds the antigen with sufficient affinity such that the antibody is useful as an assay reagent, e.g, as a capture antibody or as a detection antibody. Typically, such an antibody does not significantly cross-react with other polypeptides.
  • the term“specific binding” or“specifically binds to” or is“specific for” a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction.
  • anti-FGF21 antibody refers to an antibody that is capable of binding FGF21 with sufficient affinity such that the antibody is useful as an agent in targeting FGF21, e.g. , as an agent in the assays described herein.
  • the extent of binding of an anti-FGF2l antibody to an unrelated, non- FGF21 protein is less than about 10% of the binding of the antibody to FGF21 as measured, e.g., by a radioimmunoassay (RIA).
  • an antibody that binds to FGF21 has a dissociation constant (K d ) of ⁇ 1 M, ⁇ 100 mM, ⁇ 10 mM, ⁇ 1 mM,
  • nM 100 mM, ⁇ 10 pM, ⁇ lpM, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM or
  • the K d of an antibody that binds to FGF21, disclosed herein can be 10 3 M or less or 10 8 M or less, e.g., from 10 8 M to 10 13 M, e.g., from 10 9 M to 10 13 M.
  • the K d of an antibody that binds to FGF21, disclosed herein can be 10 10 M to 10 13 M.
  • an anti- FGF21 antibody binds to an epitope of FGF21 that is conserved among FGF21 from different species.
  • An“acceptor human framework” for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
  • An acceptor human framework“derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In certain embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
  • the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
  • Binding affinity refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K d ). Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.
  • An“affinity matured” antibody refers to an antibody with one or more alterations in one or more hypervariable regions (CDRs), compared to a parent antibody which does not possess such alterations, such alterations resulting in an improvement in the affinity of the antibody for antigen.
  • An“antibody that competes for binding” with a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more.
  • An exemplary competition assay is described in“Antibodies,” Harlow and Lane (Cold Spring Harbor Press, Cold Spring Harbor, NY).
  • A“capture antibody,” as used herein, refers to an antibody that specifically binds a target molecule, e.g ., a form of FGF21, in a sample. Under certain conditions, the capture antibody forms a complex with the target molecule such that the antibody-target molecule complex can be separated from the rest of the sample. In certain embodiments, such separation may include washing away substances or material in the sample that did not bind the capture antibody.
  • a capture antibody may be attached to a solid support surface, such as, for example but not limited to, a plate or a bead, e.g. , a paramagnetic bead.
  • A“detection antibody,” as used herein, refers to an antibody that specifically binds a target molecule in a sample or in a sample-capture antibody combination material. Under certain conditions, the detection antibody forms a complex with the target molecule or with a target molecule-capture antibody complex.
  • a detection antibody is capable of being detected either directly through a label, which may be amplified, or indirectly, e.g. , through use of another antibody that is labeled and that binds the detection antibody.
  • the detection antibody is typically conjugated to a moiety that is detectable by some means, for example, including but not limited to, biotin or ruthenium.
  • chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
  • The“class” of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
  • IgD, IgE, IgG, and IgM may be further divided into subclasses (isotypes), e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi, and IgA 2.
  • the heavy chain constant domains that correspond to the different classes of immunoglobulins are called a, d, e, g, and m, respectively.
  • cytotoxic agent refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction.
  • Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g ., At 211 , 1 13 1 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of bacterial,
  • “Effector functions” refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC);
  • phagocytosis down regulation of cell surface receptors (e.g, B cell receptor); and B cell activation.
  • B cell receptor e.g, B cell receptor
  • Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
  • the term includes native sequence Fc regions and variant Fc regions.
  • a human IgG heavy chain Fc region extends from Cys226, or from
  • the C-terminal lysine (Lys447) of the Fc region may or may not be present.
  • numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Rabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
  • “Framework” or“FR” refers to variable domain residues other than hypervariable region (CDR) residues.
  • the FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the CDR and FR sequences generally appear in the following sequence in VH (or VL): FRl-Hl(Ll)-FR2-H2(L2)- FR3 -H3 (L3 )-FR4.
  • the terms“full-length antibody,”“intact antibody” and“whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
  • A“human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody- encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • A“human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences is a subgroup as in Kabat et ah, Sequences of Proteins of
  • the subgroup is subgroup kappa I as in Kabat et ak, supra. In certain embodiments, for the VH, the subgroup is subgroup III as in Kabat et ak, supra.
  • A“humanized” antibody refers to a chimeric antibody comprising amino acid residues from non-human CDRs and amino acid residues from human FRs.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDRs ( e.g .,
  • CDRs correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
  • a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
  • A“humanized form” of an antibody, e.g., a non-human antibody, refers to an antibody that has undergone humanization.
  • variable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence (also referred to herein as“complementarity determining regions” or“CDRs”) and/or form structurally defined loops (“hypervariable loops”) and/or contain the antigen-contacting residues (“antigen contacts”).
  • CDR residues and other residues in the variable domain are numbered herein according to Kabat et al., supra.
  • antibodies comprise six CDRs: three in the VH (Hl, H2, H3), and three in the VL (Ll, L2, L3).
  • Exemplary CDRs herein include:
  • An“immunoconjugate” refers to an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent.
  • An“isolated” antibody is one which has been separated from a component of its natural environment.
  • an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g, SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g, ion exchange or reverse phase HPLC).
  • electrophoretic e.g, SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis
  • chromatographic e.g, ion exchange or reverse phase HPLC
  • An“isolated” nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment.
  • An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
  • isolated nucleic acid encoding an antibody refers to one or more nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
  • the term“monoclonal antibody,” as used herein, refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g ., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
  • polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
  • each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
  • the modifier“monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the presently disclosed subject matter may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage- display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
  • A“naked antibody” refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel.
  • the naked antibody may be present in a pharmaceutical formulation.
  • “Native antibodies” refer to naturally occurring immunoglobulin molecules with varying structures.
  • native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CH1, CH2, and CH3). Similarly, from N- to C-terminus, each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain.
  • VH variable heavy domain
  • VL variable region
  • the light chain of an antibody may be assigned to one of two types, called kappa (K) and lambda (l), based on the amino acid sequence of its constant domain.
  • “Purified” polypeptide refers to a polypeptide that has been increased in purity, such that it exists in a form that is more pure than it exists in its natural environment and/or when initially synthesized and/or amplified under laboratory conditions. Purity is a relative term and does not necessarily mean absolute purity.
  • package insert refers to instructions customarily included in commercial packages that contain information concerning the use of the components of the package.
  • Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
  • the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
  • the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code.
  • the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
  • % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
  • variable region or“variable domain” refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen.
  • the variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (CDRs).
  • FRs conserved framework regions
  • CDRs hypervariable regions
  • antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
  • host cell refers to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
  • Host cells include“transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
  • vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
  • the term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
  • Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as“expression vectors.”
  • label refers to any chemical group or moiety that can be linked to a substance that is to be detected or quantitated, e.g, an antibody.
  • a label is a detectable label that is suitable for the sensitive detection or quantification of a substance.
  • detectable labels include, but are not limited to, luminescent labels, e.g ., fluorescent, phosphorescent,
  • chemiluminescent, bioluminescent and electrochemiluminescent labels include radioactive labels, enzymes, particles, magnetic substances, electroactive species and the like.
  • a detectable label may signal its presence by participating in specific binding reactions.
  • Non-limiting examples of such labels include haptens, antibodies, biotin, streptavidin, his-tag, nitrilotriacetic acid, glutathione S-transferase, glutathione and the like.
  • detection means refers to a moiety or technique used to detect the presence of the detectable antibody through signal reporting that is then read out in an assay.
  • a detection means employ reagents, e.g. , a detection agent, that amplify an immobilized label such as the label captured onto a microtiter plate, e.g. , avidin, streptavidin-HRP or streptavidin-P-D-gal actopyranose.
  • detecting includes identifying the mere presence of the target molecule in a sample as well as determining whether the target molecule is present in the sample at detectable levels.
  • An“individual” or“subject,” as used interchangeably herein, is a mammal. Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). In certain embodiments, the individual or subject is a human.
  • sample refers to a small portion of a larger quantity of material.
  • a sample includes, but is not limited to, cells in culture, cell supernatants, cell lysates, serum, blood plasma, biological fluid (e.g, blood, plasma, serum, stool, urine, lymphatic fluid, ascites, ductal lavage, saliva and
  • the source of the sample may be solid tissue (e.g., from a fresh, frozen, and/or preserved organ, tissue sample, biopsy or aspirate), blood or any blood constituents, bodily fluids (such as, e.g., urine, lymph, cerebral spinal fluid, amniotic fluid, peritoneal fluid or interstitial fluid), or cells from the individual, including circulating cells.
  • solid tissue e.g., from a fresh, frozen, and/or preserved organ, tissue sample, biopsy or aspirate
  • bodily fluids such as, e.g., urine, lymph, cerebral spinal fluid, amniotic fluid, peritoneal fluid or interstitial fluid
  • cells from the individual including circulating cells.
  • the presently disclosed subject matter provides methods for the detection and quantification of FGF21 protein.
  • the present disclosure provides immunoassays for determining the amount of total FGF21 and/or active FGF21 protein in a sample.
  • the present disclosure further provides immunoassay methods for determining the ratio of active FGF21 protein to total FGF21 protein in a sample.
  • the immunoassay methods of the present disclosure use the anti- FGF21 antibodies disclosed herein.
  • Non-limiting examples of anti-FGF2l antibodies for use in the presently disclosed methods are provided in Tables 8-13 and 16-19.
  • the present disclosure provides immunoassay methods for the detection and quantification of human FGF21 protein.
  • the immunoassay methods can be used for the detection and quantification of FGF21, e.g ., total human FGF21 and/or active human FGF21 protein, in a sample.
  • the immunoassay methods of the present disclosure can incorporate strategies known in the art, including but not limited to, sandwich assay, enzyme-linked immunosorbent assay (ELISA) assay, a digital form of ELISA, electrochemical assay (ECL) assay and magnetic immunoassay.
  • the immunoassay method is a single molecule immunoassay, e.g. , using a single molecule array.
  • the immunoassay method can be performed using a Quanterix instrument, e.g. , a Simoa HD- 1 AnalyzerTM.
  • the methods of the present disclosure comprise contacting a sample obtained from a subject with a capture anti-FGF2l antibody, such as those described herein, under conditions permissive for the binding of the capture anti- FGF21 antibody to FGF21 protein in the sample.
  • a capture anti-FGF2l antibody such as those described herein
  • the sample can be incubated with a capture antibody that binds to an epitope present on FGF21 to generate a sample-capture antibody combination material.
  • the conditions for the incubation of the sample and the capture antibody can be selected to maximize the sensitivity of the assay and/or to minimize dissociation, as well as to ensure that the FGF21 protein present in the sample binds to the capture antibody.
  • the capture antibodies used in the immunoassay methods disclosed herein can be used at a concentration from about 0.1 pg/ml to about 5.0 pg/ml.
  • the capture antibodies can be used at a concentration from about 0.1 pg/ml to about 0.5 pg/ml, from about 0.1 pg/ml to about 1.0 pg/ml, from about 0.1 pg/ml to about 1.5 pg/ml, from about 0.1 pg/ml to about 2.0 pg/ml, from about 0.1 pg/ml to about 2.5 pg/ml, from about 0.1 pg/ml to about 3.0 pg/ml, from about 0.1 pg/ml to about 3.5 mg/ml, from about 0.1 pg/ml to about 4.0 pg/ml, from about 0.1 pg/ml to about 4.5 pg/ml, from about 0.5
  • the capture antibody can be diluted in a coating buffer.
  • coating buffers include PBS, a carbonate buffer, a bicarbonate buffer or combinations thereof.
  • the coating buffer is sodium bicarbonate.
  • the coating buffer is PBS.
  • the coating buffer can be used at a concentration from about 10 mM to about 1 M.
  • the coating buffer can be used at a concentration from about 10 mM to about 100 mM, from about 10 mM to about 200 mM, from about 10 mM to about 300 mM, from about 10 mM to about 400 mM, from about 10 mM to about 500 mM, from about 10 mM to about 600 mM, from about 10 mM to about 700 mM, from about 10 mM to about 800 mM, from about 10 mM to about 900 mM, from about 100 mM to about 1 M, from about 200 mM to about 1 M, from about 300 mM to about 1 M, from about 400 mM to about 1 M, from about 500 mM to about 1 M, from about 600 mM to about 1 M, from about 700 mM to about 1 M, from about 800 mM to about 1 M or from about 900 mM to about 1 M.
  • Capture antibodies can be immobilized on a solid phase.
  • the solid phase can be any inert support or carrier that is useful in immunometric assays, including supports in the form of, e.g. , surfaces, particles, porous matrices, beads and the like.
  • supports include small sheets, SEPHADEX®, gels, polyvinyl chloride, plastic beads and assay plates or test tubes manufactured from polyethylene, polypropylene, polystyrene, and the like, including 96-well microtiter plates, as well as particulate materials such as filter paper, agarose, cross-linked dextran, and other polysaccharides.
  • the solid phase used for immobilization can be beads.
  • a capture antibody disclosed herein is immobilized to paramagnetic beads.
  • the immobilized capture antibodies are coated on a microtiter plate that can be used to analyze several samples at one time.
  • the paramagnetic beads coupled to the capture antibody can be used at a concentration from about 0.1 x 10 7 beads/ml to about 10.0 x 10 7 beads/ml, e.g ., from about 0.1 x 10 7 beads/ml to about 0.5 x 10 7 beads/ml, from about 0.1 x 10 7 beads/ml to about 1.0 x 10 7 beads/ml, from about 0.1 x 10 7 beads/ml to about 2.0 x 10 7 beads/ml, from about 0.1 x 10 7 beads/ml to about 3.0 x 10 7 beads/ml, from about 0.1 x 10 7 beads/ml to about 4.0 x 10 7 beads/ml, from about 0.1 x 10 7 beads/ml to about 5.0 x 10 7 beads/ml, from about 0.1 x 10 7 beads/ml to about 6.0 x 10 7 beads/ml, from about 0.1 x 10 7 beads/ml to about 7.0 x 10 7 beads/ml, from
  • the paramagnetic beds can be used at a concentration from about 0.5 x 10 7 beads/ml to about 2.0 x 10 7 beads/ml. In certain embodiments, the paramagnetic beds can be used at a concentration of about 1.0 x 10 7 beads/ml, e.g. , about 1.22 x 10 7 beads/ml, or at a concentration of about 0.5 x 10 7 beads/ml, e.g. , about 0.59 x 10 7 beads/ml.
  • the immunoassay methods disclosed herein can further include contacting a sample-capture antibody combination material with a detector antibody.
  • the detector antibody binds to an epitope present on FGF21.
  • the detector antibody binds to an epitope present on the sample-capture antibody combination material, but not on the capture antibody in the absence of FGF21.
  • the detector antibody bound to the sample-capture antibody combination is subsequently measured or quantified using a detection means, e.g. , one or more detection agents, for the detection antibody to determine the amount of FGF21 protein, e.g. , total FGF21 or active FGF21 protein, bound by the detector antibody.
  • the detector antibody can be used in a concentration from about 0.1 pg/ml to about 5.0 pg/ml
  • the detector antibody can be used at a concentration from about 0.1 pg/ml to about 0.5 pg/ml, from about 0.1 pg/ml to about 1.0 pg/ml, from about 0.1 pg/ml to about 1.5 pg/ml, from about 0.1 pg/ml to about 2.0 pg/ml, from about 0.1 pg/ml to about 2.5 pg/ml, from about 0.1 pg/ml to about 3.0 pg/ml, from about 0.1 pg/ml to about 3.5 pg/ml, from about 0.1 pg/ml to about 4.0 pg/ml, from about 0.1 pg/ml to about 4.5 pg/ml, from about 0.5 pg/ml to about 5.0
  • an immunoassay for detecting total FGF21 protein can use a detector antibody at a concentration between about 0.1 pg/ml to about 1.0 pg/ml, e.g ., about 0.4 pg/ml or about 0.8 pg/ml.
  • an immunoassay for detecting active FGF21 protein can use a detector antibody at a concentration between about 1.0 pg/ml to about 3.0 pg/ml, e.g. , about 1.1 pg/ml or about 2.1 pg/ml.
  • the anti-FGF2l antibodies for use in the disclosed methods can be labeled.
  • Labels include, but are not limited to, labels or moieties that are detected directly, such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels, as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g. , through an enzymatic reaction or molecular interaction.
  • Non-limiting examples of labels include the radioisotopes 32 P, 14 C, 125 I, 3 ⁇ 4 and 131 I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luciferases, e.g. , firefly luciferase and bacterial luciferase (see U.S. Patent No.
  • the detector antibody is labeled with biotin, e.g. , the detector antibody is conjugated to biotin.
  • the detection agent for the biotinylated detector antibody is avidin, streptavidin-HRP or streptavidin-P-D-galactopyranose (SBG).
  • the readout of the detection agent is fluorimetric or colorimetric.
  • tetramethylbenzidine and hydrogen peroxide can be used as the readout.
  • the detection agent is streptavidin- HRP
  • the readout can be colorimetric by using tetramethylbenzidine and hydrogen peroxide.
  • resorufm b-D-galactopyranoside can be used as the readout.
  • the detection agent is SBG
  • the readout can be fluorimetric by using resorufm b-D-galactopyranoside.
  • the detection agent e.g ., SBG
  • the detection agent can be used at a concentration from about 50 to about 500 pM.
  • the detection agent can be used at a concentration from about 50 to about 100 pM, from about 50 to about 150 pM, from about 50 to about 200 pM, from about 50 to about 250 pM, from about 50 to about 300 pM, from about 50 to about 350 pM, from about 50 to about 400 pM, from about 50 to about 450 pM, from about 100 to about 500 pM, from about 150 to about 500 pM, from about 200 to about 500 pM, from about 250 to about 500 pM, from about 300 to about 500 pM, from about 350 to about 500 pM, from about 400 to about 500 pM, from about 450 to about 500 pM, from about 100 to about 400 pM or from about 200 to about 400 pM.
  • the detection agent can be used at a concentration from about 100 pM to about 400 pM, e.g. , SBG can be used at a concentration of about 110 pM, about 155 pM or about 310 pM. In certain embodiments, SBG is used at a concentration of about 310 pM.
  • the detection agent e.g. , HRP
  • the detection agent can be used at a dilution from about 1/10 to about 1/1000.
  • the detection agent can be used at a dilution from about 1/10 to about 1/100, from about 1/10 to about 1/500, from about 1/100 to about 1/1000 or from about 1/500 to about 1/1000.
  • the detection agent can be used at a dilution from about 1/100 to about 1/1000, e.g. , HRP can be used at a dilution of about 1/100 or about 1/500.
  • the methods of the present disclosure can include blocking the capture antibody with a blocking buffer.
  • the blocking buffer can include PBS, bovine serum albumin (BSA) and/or a biocide, e.g. , ProClinTM (Sigma-Aldrich, Saint Louis, MO).
  • the method can include multiple washing steps.
  • the solution used for washing is generally a buffer (e.g, a“washing buffer”) such as, but not limited to, a PBS buffer that includes a detergent, e.g, Tween 20.
  • the capture antibody can be washed after blocking and/or the sample can be separated from the capture antibody to remove uncaptured material, e.g. , by washing.
  • an immunoassay method for the detection of total FGF21 protein can use one or more antibodies that bind to an epitope present within amino acid residues 5-172 of FGF21, e.g, amino acid residues 5-172 of SEQ ID NO: 1.
  • the capture antibody is an antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 and the detector antibody is an antibody that binds to an epitope present within amino acid residues 5-172 of FGF21.
  • the capture antibody and the detector antibody are the same antibody, while in other embodiments, the capture antibody and the detector antibody are different antibodies but both bind to an epitope present within amino acid residues 5-172 of FGF21. In certain embodiments, the capture antibody and the detector antibody bind to different epitopes within amino acid residues 5-172 of FGF21. For example, but not by way of limitation, the capture antibody and the detector antibody bind to epitopes within amino acid residues 5-172 of FGF21 that do not overlap. In certain embodiments, the capture antibody and the detector antibody bind to epitopes within amino acid residues 5-172 of FGF21 that partially overlap.
  • an immunoassay for determining the amount of total FGF21 protein in a sample can include (a) contacting a capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 with the sample to generate a sample-capture antibody combination material; (b) contacting the sample-capture antibody combination material with a detector antibody that binds to an epitope present within amino acid residues 5-172 of FGF21; (c) detecting the detector antibody bound to the sample-capture antibody combination material; and (d) calculating an amount of total FGF21 protein present in the sample based on the level of the detector antibody bound.
  • an immunoassay method of the present disclosure can be used to detect the amount of active FGF21 protein in a sample, e.g, by detecting FGF21 protein that retains its C-terminal fragment.
  • an immunoassay method for the detection of total FGF21 protein can use one or more antibodies that bind to an epitope present within amino acid residues 173-182 of FGF21, e.g, amino acid residues 173-182 of SEQ ID NO: 1, and one or more antibodies that bind to an epitope present within amino acid residues 5-172 of FGF21.
  • an immunoassay method to detect the amount of active FGF21 protein can use a capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 and a detector antibody that binds to an epitope present within amino acid residues 173-182 of FGF21.
  • the detector antibody that binds to amino acid residues 173-182 of FGF21 can be the anti-FGF2l antibody from Epitope Diagnostics, Inc., San Diego, CA, sold under catalog number 31002.
  • the detector antibody that binds to amino acid residues 173-182 of FGF21 can be the anti-FGF2l antibody from Epitope Diagnostics, Inc., San Diego, CA, sold under catalog number 30661.
  • an immunoassay method for determining the amount of active FGF21 protein in a sample can include (a) contacting a capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 with the sample to generate a sample-capture antibody combination material; (b) contacting the sample-capture antibody combination material with a detector antibody that binds to an epitope present within amino acid residues 173-182 of FGF21; (c) detecting the detector antibody bound to the sample-capture antibody combination material; and (d) calculating an amount of active FGF21 protein present in the sample based on the level of the detector antibody bound.
  • the present disclosure further provides immunoassay methods for determining the ratio of active FGF21 protein to total FGF21 protein in a sample. For example, but not by way of limitation, such methods can involve combining an immunoassay for detecting total FGF21 protein with an immunoassay for detecting active FGF21 protein.
  • the immunoassay methods for determining the ratio of active FGF21 protein to total FGF21 protein in a sample can include (a)(i) contacting a first capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 with the sample to generate a first sample-capture antibody combination material; (ii) contacting the first sample-capture antibody combination material with a first detector antibody that binds to an epitope present within amino acid residues 5-172 of FGF21; (iii) detecting the first detector antibody bound to the sample-capture antibody combination material; and (iv) calculating an amount of total FGF21 protein present in the sample based on the level of the first detector antibody bound; and (b)(i) contacting a second capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 with the sample to generate a second sample-capture antibody combination material; (ii) contacting the second sample- capture antibody combination material with a second detector antibody that binds
  • the methods can further include comparing the amount of total FGF21 protein as determined by step (a) with the amount of active FGF21 protein as determined by step (b) to determine the ratio of active FGF21 protein to total FGF21 protein in the sample.
  • the first capture antibody and second capture antibody are the same antibody.
  • the first capture antibody and second capture antibody are different antibodies but both bind to an epitope present within amino acid residues 5-172 of FGF21.
  • the first capture antibody and the first detector antibody bind to different epitopes within amino acid residues 5-172 of FGF21.
  • the first capture antibody and the first detector antibody bind to epitopes within amino acid residues 5-172 of FGF21 that do not overlap.
  • the first capture antibody and the first detector antibody bind to epitopes within amino acid residues 5-172 of FGF21 that partially overlap.
  • the immunoassay methods disclosed herein have a detection sensitivity, e.g ., an in-well sensitivity, from about 2 pg/ml to about 20 pg/ml.
  • a detection sensitivity e.g ., an in-well sensitivity
  • an immunoassay disclosed herein has a sensitivity from about 2 pg/ml to about 3 pg/ml, from about 2 pg/ml to about 4 pg/ml, from about 2 pg/ml to about 5 pg/ml, from about 2 pg/ml to about 6 pg/ml, from about 2 pg/ml to about 7 pg/ml, from about 2 pg/ml to about 8 pg/ml, from about 2 pg/ml to about 10 pg/ml, from about 2 pg/ml to about 11 pg/ml, from about 2 pg/ml to about 12 pg/ml
  • an immunoassay disclosed herein has a sensitivity of about 2 pg/ml or greater, 1 pg/ml or greater or 0.5 pg/ml or greater. In certain embodiments, an immunoassay disclosed herein has a detection sensitivity, e.g. , an in-well sensitivity, from about 0.2 pg/ml to about 2.0 pg/ml, e.g. , from about 0.2 pg/ml to about 0.5 pg/ml, from about 0.2 pg/ml to about 1.0 pg/ml or from about 0.2 pg/ml to about 1.5 pg/ml.
  • a detection sensitivity e.g. , an in-well sensitivity
  • an immunoassay disclosed herein e.g, a single molecule immunoassay using the Simoa HD-l AnalyzerTM
  • a sensitivity e.g. , an in-well sensitivity, from about 0.2 pg/ml to about 0.5 pg/ml.
  • the samples analyzed by the immunoassay methods of the present disclosure can be clinical samples, cells in culture, cell supernatants, cell lysates, serum samples, blood plasma samples, other biological fluid (e.g, lymphatic fluid) samples or tissue samples.
  • the source of the sample may be solid tissue (e.g., from a fresh, frozen and/or preserved organ, tissue sample, serum, blood plasma, biopsy or aspirate) or cells from a subject.
  • the sample is a blood sample.
  • the sample is a plasma sample.
  • the sample e.g, blood or plasma sample
  • a sample can be treated with a cocktail of protease and phosphatase inhibitors, e.g, MS-SAFE (Sigma-Aldrich, Saint Louis, MO).
  • the sample is treated with an anti-coagulant or collected in tube that contains an anti-coagulant, e.g, K 2 -EDTA.
  • the sample can be collected using the P800 Blood Collection System (BD Biosciences, San Jose, CA).
  • the present disclosure further provides antibodies that bind to FGF21, e.g, human FGF21.
  • Antibodies of the present disclosure are useful for detecting and quantifying FGF21 protein levels in a sample.
  • the antibodies of the present disclosure can be used in immunoassay methods for the detection and quantification of FGF21 protein, disclosed herein.
  • antibodies of the present disclosure can be used to detect the levels of total FGF21 protein and/or active FGF21 protein in a sample.
  • an antibody of the present disclosure can be humanized.
  • an antibody of the present disclosure comprises an acceptor human framework, e.g, a human immunoglobulin framework or a human consensus framework.
  • an antibody of the present disclosure can be a monoclonal antibody, including a chimeric, humanized or human antibody.
  • an antibody of the present disclosure can be chimeric.
  • an antibody of the present disclosure can be an antibody fragment, e.g, a Fv, Fab, Fab’, scFv, diabody or F(ab’) 2 fragment.
  • the antibody is an IgG.
  • the antibody is selected from IgGl, IgG2, IgG3 and IgG4.
  • the antibody is a full-length antibody, e.g ., an intact IgGl antibody, or other antibody class or isotype as defined herein.
  • the anti-FGF2l antibodies disclosed herein can be labeled, e.g. , conjugated to biotin.
  • an antibody of the present disclosure can incorporate any of the features, singly or in combination, as described in Sections 1-7, detailed below.
  • an antibody of the present disclosure provides isolated antibodies that bind to a FGF21 protein.
  • an antibody of the present disclosure can bind to an epitope present within amino acid residues 5-172 of FGF21, e.g. , amino acid residues 5- 172 of SEQ ID NO: 1.
  • an antibody of the present disclosure can bind to an epitope present within amino acid residues 173-182 of FGF21, e.g. , amino acid residues 173-182 of SEQ ID NO: 1.
  • an antibody of the present disclosure does not bind to an epitope present within amino acid residues 1-4 of FGF21, e.g. , amino acid residues 1-4 of SEQ ID NO: 1.
  • Non-limiting examples of anti- FGF21 antibodies are disclosed in Tables 8-13 and 16-19 and Figure 41 A-B.
  • anti-FGF2l antibodies comprising, in certain embodiments, at least one, two, three, four, five or six CDRs selected from (a) CDR-H1 comprising an amino acid sequence of any one of SEQ ID NOs: 26-29 and conservative substitutions thereof; (b) CDR-H2 comprising an amino acid sequence of any one of SEQ ID NOs: 30-33 and conservative substitutions thereof; (c) CDR-H3 comprising an amino acid sequence of any one of SEQ ID NOs: 34-37 and conservative substitutions thereof; (d) CDR-L1 comprising an amino acid sequence of any one of SEQ ID NOs: 38- 41 and conservative substitutions thereof; (e) CDR-L2 comprising SEQ ID NOs: 42-45 and conservative substitutions thereof; and (f) CDR-L3 comprising an amino acid sequence of any one of SEQ ID NOs: 46-49 and conservative substitutions thereof.
  • anti-FGF2l antibodies that, in certain embodiments, comprise: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 26 and conservative substitutions thereof; (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 30 and conservative substitutions thereof; (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 34 and conservative substitutions thereof; (d) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 38 and conservative substitutions thereof; (e) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 42 and conservative substitutions thereof; and (f) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 46 and conservative substitutions thereof.
  • anti-FGF2l antibodies that, in certain embodiments, comprise: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 27 and conservative substitutions thereof; (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 31 and conservative substitutions thereof; (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 35; (d) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 39 and conservative substitutions thereof; (e) CDR- L2 comprising the amino acid sequence of SEQ ID NO: 43 and conservative
  • anti-FGF2l antibodies that, in certain embodiments, comprise: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28 and conservative substitutions thereof; (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 32 and conservative substitutions thereof; (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 36 and conservative substitutions thereof; (d) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 40 and conservative substitutions thereof; (e) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 44 and conservative substitutions thereof; and (f) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 48 and conservative substitutions thereof.
  • anti-FGF2l antibodies that, in certain embodiments, comprise: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 29 and conservative substitutions thereof; (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 33 and conservative substitutions thereof; (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 37 and conservative substitutions thereof; (d) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 41 and conservative substitutions thereof; (e) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 45 and conservative substitutions thereof; and (f) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 49 and conservative substitutions thereof.
  • an anti-FGF2l antibody of the present disclosure comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%,
  • a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity contains substitutions (e.g ., conservative substitutions), insertions or deletions relative to the reference sequence, but an anti-FGF2l antibody comprising that sequence retains the ability to bind to FGF21.
  • substitutions e.g ., conservative substitutions
  • an anti-FGF2l antibody comprising that sequence retains the ability to bind to FGF21.
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted.
  • an anti-FGF2l antibody of the present disclosure comprises a VH sequence comprising an amino acid sequence of any one of SEQ ID NOs: 54-57 and 72-75.
  • an anti-FGF2l antibody of the present disclosure comprises a light chain variable domain (VL) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to an amino acid sequence of any one of SEQ ID NOs: 50-53 and 68-71.
  • VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity contains substitutions (e.g., conservative substitutions), insertions or deletions relative to the reference sequence, but an anti-FGF2l antibody comprising that sequence retains the ability to bind to FGF21.
  • an anti-FGF2l antibody of the present disclosure comprises a VL sequence comprising an amino acid sequence of any one of SEQ ID NOs: 50-53 and 68-71.
  • an anti-FGF2l antibody of the present disclosure comprises a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 54.
  • an anti-FGF2l antibody of the present disclosure comprises a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 50.
  • the VH comprises one, two or three CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 26, (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 30, and (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 34.
  • the VL comprises one, two or three CDRs selected from: (a) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 38, (b) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 42, and (c) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 46.
  • an anti-FGF2l antibody of the present disclosure comprises a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 55.
  • an anti-FGF2l antibody of the present disclosure comprises a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 51.
  • the VH comprises one, two or three CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 27, (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 31, and (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 35.
  • the VL comprises one, two or three CDRs selected from: (a) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 39, (b) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 43, and (c) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 47.
  • an anti-FGF2l antibody of the present disclosure comprises a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 56.
  • an anti-FGF2l antibody of the present disclosure comprises a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 52.
  • the VH comprises one, two or three CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 32, and (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 36.
  • the VL comprises one, two or three CDRs selected from: (a) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 40, (b) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 44, and (c) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 48.
  • an anti-FGF2l antibody of the present disclosure comprises a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 57.
  • an anti-FGF2l antibody of the present disclosure comprises a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 53.
  • the VH comprises one, two or three CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 29, (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 33, and (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 37.
  • the VL comprises one, two or three CDRs selected from: (a) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 41, (b) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 45, and (c) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 49.
  • an anti-FGF2l antibody of the present disclosure comprises a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 75.
  • an anti-FGF2l antibody of the present disclosure comprises a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 71.
  • the VH comprises one, two or three CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 26, (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 30, and (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 34.
  • the VL comprises one, two or three CDRs selected from: (a) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 38, (b) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 42, and (c) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 46.
  • an anti-FGF2l antibody of the present disclosure comprises a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 74.
  • an anti-FGF2l antibody of the present disclosure comprises a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 70.
  • the VH comprises one, two or three CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 27, (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 31, and (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 35.
  • the VL comprises one, two or three CDRs selected from: (a) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 39, (b) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 43, and (c) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 47.
  • an anti-FGF2l antibody of the present disclosure comprises a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 73.
  • an anti-FGF21 antibody of the present disclosure comprises a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 69.
  • the VH comprises one, two or three CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 32, and (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 36.
  • the VL comprises one, two or three CDRs selected from: (a) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 40, (b) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 44, and (c) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 48.
  • an anti-FGF2l antibody of the present disclosure comprises a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 72.
  • an anti-FGF2l antibody of the present disclosure comprises a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 68.
  • the VH comprises one, two or three CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 29, (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 33, and (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 37.
  • the VL comprises one, two or three CDRs selected from: (a) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 41, (b) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 45, and (c) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 49.
  • an anti-FGF2l antibody of the present disclosure comprises a full-length heavy chain (HC) sequence having at least 90%, 91%, 92%,
  • a HC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity contains substitutions (e.g ., conservative substitutions), insertions or deletions relative to the reference sequence, but an anti-FGF2l antibody comprising that sequence retains the ability to bind to FGF21.
  • substitutions e.g ., conservative substitutions
  • an anti-FGF2l antibody comprising that sequence retains the ability to bind to FGF21.
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted.
  • an anti-FGF2l antibody of the present disclosure comprises a HC sequence comprising an amino acid sequence of any one of SEQ ID NOs: 22-25 and 64-67.
  • an anti-FGF21 antibody of the present disclosure comprises a full-length light chain (LC) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to an amino acid sequence of any one of SEQ ID NOs: 18-21 and 60-63.
  • a LC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity contains substitutions (e.g ., conservative substitutions), insertions or deletions relative to the reference sequence, but an anti-FGF2l antibody comprising that sequence retains the ability to bind to FGF21.
  • an anti-FGF2l antibody of the present disclosure comprises a LC sequence comprising an amino acid sequence of any one of SEQ ID NOs: 18-21 and 60- 63.
  • an anti-FGF2l antibody of the present disclosure comprises a HC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 22.
  • an anti-FGF2l antibody of the present disclosure comprises a LC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 18.
  • an anti-FGF2l antibody of the present disclosure comprises a HC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 23.
  • an anti-FGF2l antibody of the present disclosure comprises a LC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 19.
  • an anti-FGF2l antibody of the present disclosure comprises a HC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 24.
  • an anti-FGF2l antibody of the present disclosure comprises a LC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 20.
  • an anti-FGF2l antibody of the present disclosure comprises a HC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 25.
  • an anti-FGF2l antibody of the present disclosure comprises a LC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 21.
  • an anti-FGF2l antibody of the present disclosure comprises a HC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 67.
  • an anti-FGF2l antibody of the present disclosure comprises a LC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 63.
  • an anti-FGF2l antibody of the present disclosure comprises a HC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 66.
  • an anti-FGF2l antibody of the present disclosure comprises a LC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 62.
  • an anti-FGF2l antibody of the present disclosure comprises a HC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 65.
  • an anti-FGF2l antibody of the present disclosure comprises a LC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 61.
  • an anti-FGF2l antibody of the present disclosure comprises a HC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 64.
  • an anti-FGF2l antibody of the present disclosure comprises a LC sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 60.
  • an anti-FGF2l antibody comprising a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above.
  • an anti-FGF2l antibody is provided, wherein the antibody comprises a full-length HC as in any of the embodiments provided above, and a full-length LC as in any of the embodiments provided above.
  • an anti-FGF2l antibody of the present disclosure can have a dissociation constant (K d ) of ⁇ 1 M, ⁇ 100 mM, ⁇ 10 mM, ⁇ 1 mM, ⁇ 100 mM,
  • an antibody of the present disclosure can have a K d of about 10 3 or less or 1 O 8 M or less, e.g. , from 1 O 8 M to 10 13 M, e.g. , from 1 O 9 M to 10 13 M.
  • an anti-FGF2l antibody, disclosed herein can have a K d of about 10 10 M to 10 13 M.
  • a capture antibody or a detector antibody of the present disclosure binds to FGF21 with a K d from about 10 10 M to 10 13 M.
  • K d can be measured by a radiolabeled antigen binding assay (RIA).
  • an RIA can be performed with a Fab version of an antibody of interest and its antigen.
  • a solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of ( 125 I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody- coated plate (see, e.g. , Chen et al., J. Mol. Biol. 293:865-881(1999)).
  • MICROTITER ® multi-well plates (Thermo Scientific) are coated overnight with 5 pg/ml of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23 °C).
  • a non-adsorbent plate (Nunc #269620)
  • 100 pM or 26 pM [ 125 I] -antigen are mixed with serial dilutions of a Fab of interest (e.g, consistent with assessment of the anti-VEGF antibody, Fab-l2, in Presta et al., Cancer Res.
  • the Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g, about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g, for one hour). The solution is then removed and the plate washed eight times with 0.1% polysorbate 20 (TWEEN-20 ® ) in PBS. When the plates have dried, 150 pl/well of scintillant (MICROSCINT-20TM; Packard) is added, and the plates are counted on a TOPCOUNTTM gamma counter (Packard) for ten minutes. Concentrations of each Fab that give less than or equal to 20% of maximal binding are chosen for use in competitive binding assays.
  • K d can be measured using a BIACORE ® surface plasmon resonance assay.
  • a BIACORE ® surface plasmon resonance assay For example, but not by way of limitation, an assay using a BIACORE ® -2000, a BIACORE ® -3000, a BIACORE X100 or a BIACORE T200 processing unit (Biacore, Inc., Piscataway, NJ) is performed at 25°C with immobilized antigen CM5 chips at -10 response units (RET).
  • RET -10 response units
  • carboxymethylated dextran biosensor chips (CM5, Biacore, Inc.) are activated with N- ethyl-A’- (3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and X- hydroxysuccinimide (NHS) according to the supplier’s instructions.
  • Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 pg/ml ( ⁇ 0.2 mM) before injection at a flow rate of 5 pl/minute to achieve approximately 10 response units (RU) of coupled protein. Following the injection of antigen, 1 M ethanolamine is injected to block unreacted groups.
  • an antibody of the present disclosure is an antibody fragment.
  • Antibody fragments include, but are not limited to, Fab, Fab’, Fab’-SH, F(ab’) 2 , Fv, and scFv fragments, and other fragments described below.
  • Fab, Fab’, Fab’-SH, F(ab’) 2 fragments described below.
  • F(ab’) 2 fragments described below.
  • scFv fragments see, e.g., Pluckthiin, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York), pp. 269-315 (1994); see also WO 93/16185; and U.S. Patent Nos.
  • an antibody of the present disclosure can be a diabody.
  • Diabodies are antibody fragments comprising two antigen-binding sites that may be bivalent or bispecific. See , for example, EP 404,097; WO 1993/01161; Hudson et ak, Nat. Med. 9: 129-134 (2003); and Hollinger et ah, Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Triabodies and tetrabodies, which are additional antibody fragments within the scope of the antibodies of the present disclosure, are also described in Hudson et ak, Nat. Med 9: 129-134 (2003).
  • an antibody of the present disclosure can be a single domain antibody.
  • Single-domain antibodies are antibody fragments that comprise all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
  • a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, MA; see, e.g., U.S. Patent No.
  • Antibody fragments can be made by various techniques including, but not limited to, proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g, E. coli or phage), as described herein.
  • recombinant host cells e.g, E. coli or phage
  • an antibody of the present disclosure is a chimeric antibody.
  • Certain chimeric antibodies are described in the art, e.g, in U.S. Patent No. 4,816,567; and Morrison et ak, Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)).
  • a chimeric antibody of the present disclosure comprises a non human variable region (e.g, a variable region derived from a mouse, rat, hamster, rabbit or non-human primate, such as a monkey) and a human constant region.
  • a chimeric antibody can be a“class switched” antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
  • a chimeric antibody of the present disclosure can be a humanized antibody.
  • a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
  • a humanized antibody comprises one or more variable domains in which CDRs, e.g ., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences.
  • a humanized antibody optionally will also comprise at least a portion of a human constant region.
  • some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g, the antibody from which the CDR residues are derived), e.g, to restore or improve antibody specificity or affinity.
  • a non-human antibody e.g, the antibody from which the CDR residues are derived
  • Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the“best-fit” method (see, e.g, Sims et al. J. Immunol. 151 :2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g, Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J. Immunol., 151 :2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g, Almagro and Fransson, Front. Biosci.
  • an antibody of the present disclosure can be a human antibody.
  • Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008). Human antibodies can be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal’s chromosomes.
  • Human variable regions from intact antibodies generated by such animals may be further modified, e.g., by combining with a different human constant region.
  • Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor ./. Immunol., 133 : 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147: 86 (1991).) Human antibodies generated via human B-cell hybridoma technology are also described in Li et al., Proc. Natl. Acad. Sci. USA, 103 :3557-3562 (2006).
  • hybridomas Human hybridoma technology (Trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical
  • Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain.
  • Antibodies of the present disclosure can be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics.
  • repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev. Immunol ., 12: 433-455 (1994).
  • Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
  • scFv single-chain Fv
  • Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
  • naive repertoire can be cloned (e.g, from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993).
  • naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol., 227: 381-388 (1992).
  • Patent publications describing human antibody phage libraries include, for example: US Patent No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598,
  • Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein. 6. Multispecific Antibodies
  • an antibody of the present disclosure can be a multispecific antibody, e.g ., a bispecific antibody.
  • Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different epitopes. In certain embodiments, one of the binding specificities is for an epitope present on FGF21 and the other is for any other antigen.
  • Bispecific antibodies can be prepared as full-length antibodies or antibody fragments.
  • Multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein and Cuello, Nature 305: 537 (1983)), WO 93/08829, and Traunecker et ak, EMBO J 10: 3655 (1991)), and“knob-in-hole” engineering (see, e.g. , U.S. Patent No. 5,731,168). Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004A1); cross-linking two or more antibodies or fragments (see, e.g., US Patent No.
  • Engineered antibodies with three or more functional antigen binding sites, including“Octopus antibodies,” are also included herein (see, e.g,
  • amino acid sequence variants of an antibody can be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody or by peptide synthesis. Such modifications include, but are not limited to, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final antibody, i.e., modified, possesses the desired characteristics, e.g, antigen binding. a) Substitution, Insertion, and Deletion Variants
  • Antibody variants can have one or more amino acid substitutions, insertions and/or deletions. Sites of interest for such variation include, but are not limited to, the CDRs, and FRs. Non-limiting examples of conservative substitutions are shown in Table 1 under the heading of“preferred substitutions.” Non-limiting examples of more substantial changes are provided in Table 1 under the heading of“exemplary substitutions,” and as further described below in reference to amino acid side chain classes. Amino acid substitutions can be introduced into an antibody of interest and the products screened for a desired activity, e.g. , retained/improved antigen binding, decreased immunogenicity or improved complement dependent cytotoxicity (CDC) or antibody-dependent cell-mediated cytotoxicity (ADCC). Table 1
  • Amino acids may be grouped according to common side-chain properties:
  • non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • a type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody, e.g., a humanized or human antibody.
  • a parent antibody e.g., a humanized or human antibody.
  • the resulting variant(s) selected for further study will have modifications, e.g. , improvements, in certain biological properties such as, but not limited to, increased affinity, reduced immunogenicity, relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody.
  • a non-limiting example of a substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g. , using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more CDR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g, binding affinity).
  • alterations can be made in CDRs, e.g, to improve antibody affinity.
  • Such alterations may be made in CDR“hotspots,” i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g, Chowdhury , Methods Mol. Biol. 207: 179-196 (2008)), and/or residues that contact antigen, with the resulting variant VH or VL being tested for binding affinity.
  • CDR“hotspots i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g, Chowdhury , Methods Mol. Biol. 207: 179-196 (2008)), and/or residues that contact antigen, with the resulting variant VH or VL being tested for binding affinity.
  • Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al.
  • affinity maturation diversity can be introduced into the variable genes chosen for maturation by any of a variety of methods (e.g ., error-prone PCR, chain shuffling or oligonucleotide-directed mutagenesis).
  • a secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity.
  • Another method to introduce diversity involves CDR-directed approaches, in which several CDR residues (e.g., 4-6 residues at a time) are randomized.
  • CDR residues involved in antigen binding can be specifically identified, e.g, using alanine scanning mutagenesis or modeling.
  • CDR-H3 and CDR-L3 in particular are often targeted.
  • substitutions, insertions and/or deletions can occur within one or more CDRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen.
  • conservative alterations e.g, conservative substitutions as provided herein
  • Such alterations may, for example, be outside of antigen contacting residues in the CDRs.
  • each CDR either is unaltered or contains no more than one, two or three amino acid substitutions.
  • a useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called“alanine scanning mutagenesis” as described by Cunningham and Wells (1989) Science, 244: 1081-1085.
  • a residue or group of target residues e.g, charged residues such as arg, asp, his, lys, and glu
  • a neutral or negatively charged amino acid e.g, alanine or polyalanine
  • Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions.
  • a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution.
  • Variants may be screened to determine whether they contain the desired properties.
  • Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g. , for Antibody-directed enzyme prodrug therapy (ADEPT)) or a polypeptide which increases the serum half-life of the antibody.
  • an enzyme e.g. , for Antibody-directed enzyme prodrug therapy (ADEPT)
  • ADEPT Antibody-directed enzyme prodrug therapy
  • Antibodies of the present disclosure can, in certain embodiments, be altered to increase or decrease the extent to which the antibody is glycosylated.
  • the addition or deletion of glycosylation sites of an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
  • the carbohydrate attached thereto can be altered.
  • Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. HBTECH 15:26-32 (1997).
  • the oligosaccharide may include various carbohydrates, e.g.
  • oligosaccharide structure modifications of the oligosaccharide in an antibody of the present disclosure can be made in order to create antibody variants with certain improved properties.
  • antibody variants having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region.
  • the amount of fucose in such antibody can be from about 1% to about 80%, from about 1% to about 65%, from about 5% to about 65% or from about 20% to about 40% and values in between.
  • the amount of fucose can be determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e.g. , complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example.
  • Asn297 refers to the asparagine residue located at about position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 can also be located about ⁇ 3 amino acids upstream or downstream of position 297, /. e. , between positions 294 and 300, due to minor sequence variations in antibodies.
  • Such fucosylation variants may have improved ADCC function. See, e.g. , US Patent
  • Defucosylated antibodies can be produced in any cell line that are deficient in protein fucosylation.
  • Non-limiting examples of cell lines include Lecl3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 Al, Presta, L; and WO 2004/056312 Al, Adams et al. , especially at Example 11), and knockout cell lines, such as alpha-l,6- fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g. , Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng ., 94(4):680-688 (2006); and W02003/085107).
  • Antibodies variants are further provided with bisected oligosaccharides, e.g. , in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Non-limiting examples of such antibody variants are described, e.g. , in WO 2003/011878 (Jean-Mairet et al.); US Patent No. 6,602,684 (Umana et al.); and US 2005/0123546 (Umana et al.). Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided.
  • Such antibody variants can have improved CDC function.
  • Such antibody variants are described, e.g. , in WO 1997/30087 (Patel et al.); WO 1998/58964 (Raju, S.); and WO 1999/22764 (Raju, S.).
  • one or more amino acid modifications can be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant.
  • the Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g., a substitution) at one or more amino acid positions.
  • the present disclosure provides antibody variants that possess some but not all effector functions.
  • Such limited effector function can make the antibody variants desirable candidates for applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious.
  • In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
  • Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
  • non-radioactive assays methods can be employed (see, for example, AC TITM non-radioactive cytotoxicity assay for flow cytometry (Cell Technology, Inc. Mountain View, CA; and CYTOTOX 96 ® non radioactive cytotoxicity assay (Promega, Madison, WI).
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest may be assessed in vivo , e.g., in an animal model such as that disclosed in Clynes et al. Proc. Nat’l Acad. Sci. USA 95:652-656 (1998).
  • Clq binding assays can also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity. See, e.g, Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402.
  • a CDC assay can be performed (see, for example, Gazzano- Santoro et al., J. Immunol. Methods 202: 163 (1996); Cragg, M.S. et al., Blood 101 :1045- 1052 (2003); and Cragg, M.S. and M.J. Glennie, Blood 103:2738-2743 (2004)).
  • FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art (see, e.g, Petkova, S.B. et al., Int’l. Immunol. 18(12): 1759- 1769 (2006)).
  • alterations can be made in the Fc region that result in altered (i.e., either improved or diminished) Clq binding and/or Complement Dependent Cytotoxicity (CDC), e.g, as described in US Patent No. 6,194,551,
  • Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056).
  • Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called“DANA” Fc mutant with substitution of residues 265 and 297 to alanine (US Patent No. 7,332,581).
  • antibody variants of the present disclosure comprise an Fc region with one or more amino acid substitutions that improve ADCC, e.g. , substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
  • alteration made in the Fc region of an antibody can produce a variant antibody with an increased half-life and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), are described in US2005/0014934A1 (Hinton et al.). Those antibodies comprise an Fc region with one or more substitutions therein, which improve binding of the Fc region to FcRn.
  • FcRn neonatal Fc receptor
  • Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (US Patent No. 7,371,826).
  • cysteine engineered antibodies e.g. ,“thioMAbs”
  • one or more residues of an antibody are substituted with cysteine residues.
  • the substituted residues occur at accessible sites of the antibody.
  • reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
  • any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region.
  • Cysteine engineered antibodies can be generated as described, e.g ., in U.S. Patent No. 7,521,541.
  • antibodies of the present disclosure can be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers.
  • water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-l, 3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g, g, g,
  • Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
  • conjugates of an antibody and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided.
  • the nonproteinaceous moiety is a carbon nanotube (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)).
  • the radiation can be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the antibody-nonproteinaceous moiety are killed.
  • antibodies disclosed herein can be produced using any available or known technique in the art.
  • antibodies can be produced using recombinant methods and compositions, e.g ., as described in U.S. Patent No. 4,816,567. Detailed procedures to generate antibodies are described in the Examples below.
  • the presently disclosed subject matter further provides an isolated nucleic acid encoding an antibody disclosed herein.
  • the isolated nucleic acid can encode an amino acid sequence that includes the VL and/or an amino acid sequence comprising the VH of the antibody, e.g. , the light and/or heavy chains of the antibody.
  • the isolated nucleic acid can include a nucleotide sequence that encodes a heavy chain variable region amino acid sequence having the sequence set forth in SEQ ID NO: 54, and/or a nucleotide sequence that encodes a light chain variable region amino acid sequence having the sequence set forth in SEQ ID NO: 50.
  • the isolated nucleic acid can include a nucleotide sequence that encodes a heavy chain variable region amino acid sequence having the sequence set forth in SEQ ID NO: 57, and/or a nucleotide sequence that encodes a light chain variable region amino acid sequence having the sequence set forth in SEQ ID NO: 53.
  • the nucleic acid can be present in one or more vectors, e.g. , expression vectors.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • a“plasmid” refers to a circular double stranded DNA loop into which additional DNA segments can be ligated.
  • viral vector Another type of vector is a viral vector, where additional DNA segments can be ligated into the viral genome.
  • Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g, bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • vectors e.g, non-episomal mammalian vectors
  • expression vectors are capable of directing the expression of genes to which they are operably linked.
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids (vectors).
  • the disclosed subject matter is intended to include such other forms of expression vectors, such as viral vectors (e.g, replication defective retroviruses, adenoviruses and adeno-associated viruses) that serve equivalent functions.
  • the nucleic acid encoding an antibody of the present disclosure and/or the one or more vectors including the nucleic acid can be introduced into a host cell.
  • the introduction of a nucleic acid into a cell can be carried out by any method known in the art including, but not limited to, transfection, electroporation, microinjection, infection with a viral or bacteriophage vector containing the nucleic acid sequences, cell fusion, chromosome-mediated gene transfer, microcell- mediated gene transfer, spheroplast fusion, etc.
  • a host cell can include, e.g ., has been transformed with: (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
  • the host cell is eukaryotic, e.g. , a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g, Y0, NSO, Sp20 cell).
  • the methods of making a disclosed anti-FGF2l antibody can include culturing a host cell, in which a nucleic acid encoding the antibody has been introduced, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell and/or host cell culture medium. In certain embodiments, the antibody is recovered from the host cell through
  • nucleic acid encoding an antibody e.g, as described above, can be isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
  • nucleic acid may be readily isolated and sequenced using conventional procedures (e.g, by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
  • Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
  • prokaryotic or eukaryotic cells described herein.
  • antibodies can be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
  • Fc effector function are not needed.
  • eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been“humanized,” resulting in the production of an antibody with a partially or fully human glycosylation pattern.
  • Suitable host cells for the expression of glycosylated antibody can also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
  • Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
  • plant cell cultures can be utilized as host cells. See, e.g, US Patent Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIESTM technology for producing antibodies in transgenic plants).
  • vertebrate cells can also be used as hosts.
  • mammalian cell lines that are adapted to grow in suspension can be useful.
  • useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et ah, J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BEK); mouse sertoli cells (TM4 cells as described, e.g, in Mather, Biol. Reprod.
  • monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3 A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et ah, Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
  • Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR CHO cells (Urlaub et al., Proc. Natl. Acad. Sci.
  • techniques for making bispecific and/or multispecific antibodies include, but are not limited to, recombinant co-expression of two
  • bispecific antibodies can also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules
  • Bispecific and multispecific molecules of the present disclosure can also be made using chemical techniques (see, e.g., Kranz (1981) Proc. Natl. Acad. Sci. USA 78:5807),“polydoma” techniques (see, e.g, U.S. Patent 4,474,893) or recombinant DNA techniques.
  • Bispecific and multispecific molecules of the presently disclosed subject matter can also be prepared by conjugating the constituent binding specificities, e.g, a first epitope and a second epitope binding specificities, using methods known in the art and as described herein. For example, but not by way of limitation, each binding specificity of the bispecific and multispecific molecule can be generated separately and then conjugated to one another.
  • cross-linking agents include protein A, carbodiimide, N- succinimidyl-S-acetyl-thioacetate (SATA), N-succinimidyl-3-(2- pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N-maleimidomethyl) cyclohaxane-l-carboxylate (sulfo-SMCC) (see, e.g, Karpovsky (1984) J. Exp. Med. 160: 1686; Liu (1985) Proc. Natl.
  • SATA succinimidyl-S-acetyl-thioacetate
  • SPDP N-succinimidyl-3-(2- pyridyldithio)propionate
  • sulfo-SMCC sulfo-SMCC
  • binding specificities are antibodies (e.g. , two humanized antibodies), they can be conjugated via sulfhydryl bonding of the C-terminus hinge regions of the two heavy chains.
  • the hinge region can be modified to contain an odd number of sulfhydryl residues, e.g. , one, prior to conjugation.
  • both binding specificities of a bispecific antibody can be encoded in the same vector and expressed and assembled in the same host cell. This method is particularly useful where the bispecific and multispecific molecule is a MAb x MAb, MAb x Fab, Fab x F(ab’) 2 or ligand x Fab fusion protein.
  • a bispecific antibody of the present disclosure can be a single chain molecule, such as a single chain bispecific antibody, a single chain bispecific molecule comprising one single chain antibody and a binding determinant or a single chain bispecific molecule comprising two binding determinants. Bispecific and multispecific molecules can also be single chain molecules or can comprise at least two single chain molecules.
  • Engineered antibodies with three or more functional antigen binding sites are also included herein (see, e.g, US 2006/0025576A1).
  • an animal system can be used to produce an antibody of the present disclosure.
  • One animal system for preparing hybridomas is the murine system.
  • Hybridoma production in the mouse is a very well established procedure.
  • Immunization protocols and techniques for isolation of immunized splenocytes for fusion are known in the art. Fusion partners (e.g, murine myeloma cells) and fusion procedures are also known (see, e.g, Harlow and Lane (1988), Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor New York).
  • anti-FGF2l antibodies of the present disclosure provided herein can be identified, screened for or characterized for their physical/chemical properties and/or biological activities by various assays known in the art and provided herein.
  • an antibody of the present disclosure can be tested for its antigen binding activity by known methods, such enzyme-linked immunosorbent assay (ELISA), a radioimmunoassay (RIA) or a Western Blot Assay.
  • ELISA enzyme-linked immunosorbent assay
  • RIA radioimmunoassay
  • Western Blot Assay Each of these assays generally detects the presence of protein-antibody complexes of particular interest by employing a labeled reagent (e.g ., an antibody) specific for the complex of interest.
  • the FGF21 -antibody complexes can be detected using, e.g., an enzyme-linked antibody or antibody fragment which recognizes and specifically binds to the antibody-FGF2l complexes.
  • the complexes can be detected using any of a variety of other immunoassays.
  • the antibody can be radioactively labeled and used in a radioimmunoassay (RIA) ⁇ see, for example , Weintraub, B.
  • the radioactive isotope can be detected by such means as the use of a Geiger counter or a scintillation counter or by autoradiography.
  • competition assays can be used to identify an antibody that competes with an anti-FGF2l antibody of the present disclosure, e.g, mAb4 or mAbl5, for binding to FGF21.
  • a competing antibody binds to the same epitope ⁇ e.g., a linear or a conformational epitope) that is bound by mAb4 or mAbl5.
  • epitope e.g., a linear or a conformational epitope
  • Detailed exemplary methods for mapping an epitope to which an antibody binds are provided in Morris (1996)“Epitope Mapping Protocols,” in Methods in Molecular Biology vol . 66 (Humana Press, Totowa, NJ).
  • immobilized FGF21 can be incubated in a solution comprising a first labeled antibody that binds to FGF21 ⁇ e.g, mAb4 or mAbl5) and a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to FGF21.
  • the second antibody may be present in a hybridoma supernatant.
  • immobilized FGF21 is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to FGF21, excess unbound antibody is removed, and the amount of label associated with immobilized FGF21 is measured.
  • the presently disclosed subject matter further provides immunoconjugates comprising an antibody conjugated to one or more cytotoxic agents, such as
  • chemotherapeutic agents or drugs growth inhibitory agents, toxins (e.g ., protein toxins, enzymatically active toxins of bacterial, fungal, plant or animal origin, or fragments thereof) or radioactive isotopes.
  • toxins e.g ., protein toxins, enzymatically active toxins of bacterial, fungal, plant or animal origin, or fragments thereof
  • radioactive isotopes e.g., an antibody or antigen-binding portion of the disclosed subject matter can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other binding molecules, such as another antibody, antibody fragment, peptide or binding mimetic.
  • an immunoconjugate is an antibody-drug conjugate (ADC) in which an antibody is conjugated to one or more drugs, including but not limited to a maytansinoid (see U.S. Patent Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235); an auristatin such as monomethylauristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Patent Nos. 5,635,483 and 5,780,588, and
  • ADC antibody-drug conjugate
  • drugs including but not limited to a maytansinoid (see U.S. Patent Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235); an auristatin such as monomethylauristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Patent Nos. 5,635,483 and 5,780,588, and
  • an immunoconjugate comprises an antibody as described herein conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAP II, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • an enzymatically active toxin or fragment thereof including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (
  • an immunoconjugate comprises an antibody as described herein conjugated to a radioactive atom to form a radioconjugate.
  • a variety of radioactive isotopes are available for the production of radioconjugates. Non-limiting examples include At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu.
  • the radioconjugate When used for detection, it can include a radioactive atom for scintigraphic studies, for example tc99m or 1123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine- 123 again, iodine-l3 l, indium-l l l, fluorine- 19, carbon- 13, nitrogen-l5, oxygen-l7, gadolinium, manganese or iron.
  • NMR nuclear magnetic resonance
  • Conjugates of an antibody and cytotoxic agent can be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane- l-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HC1), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (
  • a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238: 1098 (1987).
  • Carbon- l4-labeled 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See W094/11026.
  • the linker can be a“cleavable linker” facilitating release of a cytotoxic drug in the cell.
  • an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (Chari et al., Cancer Res. 52: 127-131 (1992); U.S. Patent No. 5,208,020) can be used.
  • the immunuoconjugates disclosed herein expressly contemplate, but are not limited to, such conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB,
  • SMCC SMPB
  • SMPH sulfo-EMCS
  • sulfo-GMBS sulfo-KMUS
  • sulfo-MBS sulfo- SIAB
  • sulfo-SMCC and sulfo-SMPB
  • SVSB succinimidyl-(4- vinylsulfone)benzoate
  • kits containing materials useful for performing the immunoassays disclosed herein further provides kits containing materials useful for performing the immunoassays disclosed herein.
  • the kit includes a container containing an anti-FGF2l antibody disclosed herein.
  • suitable containers include bottles, test tubes, vials and microtiter plates.
  • the containers can be formed from a variety of materials such as glass or plastic.
  • the kit further includes a package insert that provides instructions for using the anti-FGF2l antibody in the disclosed immunoassay methods.
  • the kit can include one or more containers containing one or more anti-FGF2l antibodies.
  • anti-FGF2l antibodies are disclosed in Tables 8-13 and 16-19 and Figure 41 A and B.
  • the kit can include at least one container that includes an anti-FGF2l capture antibody and at least one container that includes an anti-FGF2l detector antibody.
  • a kit for detecting total FGF21 protein in a sample includes a first container containing a capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, a second container containing a detector antibody that binds to an epitope present within amino acid residues 5-172 of FGF21 and a third container containing a detection agent.
  • a kit for detecting active FGF21 protein in a sample includes a first container containing a capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, a second container containing a detector antibody that binds to an epitope present within amino acid residues 173-182 of FGF21 and a third container containing a detection agent.
  • a kit for determining the ratio of active FGF21 protein to total FGF21 protein in a sample includes a first container containing a first capture antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, a second container containing a first detector antibody that binds to an epitope present within amino acid residues 5-172 of FGF21, a third container containing a second capture antibody that binds to an epitope present within amino acid residues 5- 172 of FGF21, a fourth container containing a second detector antibody that binds to an epitope present within amino acid residues 173-182 of FGF21 and a fifth container containing a detection agent.
  • the first and second capture antibodies are the same antibody and can be provided in a single container.
  • the first and second capture antibodies are different antibodies, and can be provided in separate containers.
  • the capture antibody and/or the detector antibody can be provided in a kit of the present disclosure at a concentration of about 0.1 pg/ml to about 5.0 pg/ml.
  • the detector antibody can be labeled, e.g ., with biotin.
  • the detection agent provided in a kit of the present disclosure can be avidin, streptavidin-HRP or streptavi di h-b-D-gal actopy ranose (SBG).
  • kit of the present disclosure can further include
  • kits can further include tetramethylbenzidine and hydrogen peroxide.
  • kit can further include resorufm b-D-galactopyranoside.
  • SBG can be provided in a kit at a concentration from about 100 pM to about 400 pM.
  • the capture antibody can be provided attached to solid support surface, such as, for example but not limited to, a plate or a bead, e.g. , a paramagnetic bead.
  • the kit can further include a solid support surface that can be coupled to the capture antibody.
  • the solid support can be paramagnetic beads and can be provided at a concentration from about 0.1 x 10 7 beads/ml to about 10.0 x 10 7 beads/ml.
  • the kit can include other materials desirable from a commercial and user standpoint, including other buffers, diluents and filters.
  • the kit can include materials for collecting and/or processing blood samples.
  • the presently disclosed subject matter provides for an immunoassay method for determining the amount of total FGF21 protein in a sample comprising:
  • the presently disclosed subject matter provides for an immunoassay method for determining the amount of active FGF21 protein in a sample comprising:
  • the presently disclosed subject matter provides for an immunoassay method for determining the ratio of active FGF21 protein to total FGF21 protein in a sample comprising:
  • step (c) comparing the amount of total FGF21 protein as determined by step (a) with the amount of active FGF21 protein as determined by step (b) to determine the ratio of active FGF21 protein to total FGF21 protein in the sample.
  • a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 26 and 27, and conservative substitutions thereof;
  • a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 34 and 35, and
  • a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 50, 51, 70 and 71, and conservative substitutions thereof.
  • a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 28 and 29, and conservative substitutions thereof;
  • a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 36 and 37, and
  • a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 34 and 35, and
  • a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 28 and 29, and conservative substitutions thereof;
  • a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 36 and 37, and
  • kits for detecting total FGF21 protein in a sample comprising:
  • kits for detecting active FGF21 protein in a sample comprising:
  • kits for determining the ratio of active FGF21 protein to total FGF21 protein in a sample comprising:
  • streptavidin-horseradish peroxidase conjugate and a combination thereof.
  • F6 The foregoing kit of F5 further comprising resorufm b-D-galactopyranoside, tetramethylbenzidine, hydrogen peroxide or combinations thereof.
  • F7 The foregoing kit of any one of D-F6, wherein one or more of the capture antibody, first capture antibody and second capture antibody binds to FGF21 with a Kd from about 10 10 M to 10 13 M.
  • F8 The foregoing kit of any one of D and F-F7, wherein one or more of the detector antibody and first detector antibody binds to FGF21 with a Kd from about 10 10 M to 10 13 M.
  • F 11 The foregoing kit of F5, wherein the streptavidin-P-D-galactopyranose conjugate has a concentration from about 100 pM to about 400 pM.
  • a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 26 and 27, and conservative substitutions thereof;
  • a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 50, 51, 70 and 71, and conservative substitutions thereof.
  • a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 28 and 29, and conservative substitutions thereof;
  • kit of F12 wherein one or more of the capture antibody, first capture antibody and second capture antibody comprises:
  • F19 The foregoing kit of F18, wherein one or more of the capture antibody, first capture antibody and second capture antibody comprises:
  • F20 The foregoing kit of F19, wherein one or more of the capture antibody, first capture antibody and second capture antibody comprises:
  • one or more of the detector antibody and first detector antibody comprises: (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 57, and conservative substitutions thereof; and
  • a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 26 and 27, and conservative substitutions thereof;
  • a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 34 and 35, and
  • a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 36 and 37, and
  • kits detects the amount of total or active FGF21 protein in the sample at an in-well sensitivity from about 0.2 pg/ml to about 0.5 pg/ml.
  • a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 26-29, and conservative substitutions thereof;
  • a heavy chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 30-33, and conservative substitutions thereof
  • a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 34-37, and conservative substitutions thereof;
  • the foregoing isolated antibody of G wherein the antibody, or antigen binding portion thereof, comprises:
  • the foregoing isolated antibody of G wherein the antibody, or antigen binding portion thereof, comprises:
  • the foregoing isolated antibody of G wherein the antibody, or antigen binding portion thereof, comprises:
  • G6 The foregoing isolated antibody of G2, wherein the antibody, or antigen binding portion thereof, comprises:
  • the foregoing isolated antibody of G3, wherein the antibody, or antigen binding portion thereof, comprises:
  • G8 The foregoing isolated antibody of G4, wherein the antibody, or antigen binding portion thereof, comprises:
  • the foregoing isolated antibody of G2, wherein the antibody, or antigen binding portion thereof, comprises:
  • Gl 1 The foregoing isolated antibody of G3, wherein the antibody, or antigen binding portion thereof, comprises:
  • the foregoing isolated antibody of G4, wherein the antibody, or antigen binding portion thereof, comprises:
  • the foregoing isolated antibody of G5, wherein the antibody, or antigen binding portion thereof, comprises:
  • the foregoing isolated antibody of G6, wherein the antibody, or antigen binding portion thereof, comprises:
  • the foregoing isolated antibody of G7, wherein the antibody, or antigen binding portion thereof, comprises:
  • G16 The foregoing isolated antibody of G8, wherein the antibody, or antigen binding portion thereof, comprises: (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 25, and conservative substitutions thereof; and
  • the foregoing isolated antibody of G9, wherein the antibody, or antigen binding portion thereof, comprises:
  • the foregoing isolated antibody of G10, wherein the antibody, or antigen binding portion thereof, comprises:
  • the foregoing isolated antibody of Gl 1, wherein the antibody, or antigen binding portion thereof, comprises:
  • G20 The foregoing isolated antibody of G12, wherein the antibody, or antigen binding portion thereof, comprises:
  • the presently disclosed subject matter provides for an isolated nucleic acid encoding the antibody, or antigen-binding portion thereof, of any one of G-G20.
  • the presently disclosed subject matter provides for a host cell comprising the nucleic acid of H. J. In certain non-limiting embodiments, the presently disclosed subject matter provides for a method of producing an antibody comprising culturing the host cell of I so that the antibody is produced.
  • J 1 The foregoing method of J, further comprising recovering the antibody from the host cell.
  • the presently disclosed subject matter provides for a composition comprising one or more antibodies, or antigen-binding portions thereof, of any one of G-G20.
  • Monoclonal antibodies were generated by immunizing SJL and Balb/c mice with recombinant human FGF21. 80 hybridoma supernatants were screened by ELISA ( Figure 1). 20 hybridomas were selected based on binding to intact human FGF21 (PUR 98271), intact cynomolgus FGF21 (PUR 98270) and cleaved human FGF21 (PUR 102247) generated by digesting intact human FGF21 by human FAP.
  • IgG obtained from the selected 20 hybridomas identified in Example 1 were further characterized by ELISA.
  • ELISA was performed as follows: 96 well MaxiSorp plate (439454, Nalge Nunc International; Rochester, NY) was coated with 1 pg/mL of anti-FGF2l mAbs or anti-FGF2l sheep pAbs (Cat. No. RD184108100, Biovendor, Asheville, NC) in coating buffer (50 mM sodium carbonate, pH 9.6) overnight at 4°C.
  • the plate was incubated with 0.5 pg/ml of the secondary antibody (R&D Systems, biotinylated goat anti-FGF2l pAb BAF2539) for 1-2 hr at room temperature. After washing with Washing buffer, the plate was incubated with High Sensitivity Streptavidin-HRP (PIERCE Cat. No. 21130) diluted 1 : 1,000 in assay buffer. After washing with the Washing buffer, the binding of anti-FGF2l to recombinant FGF21 was assessed by adding substrate 3, 3’, 5, 5’ tetramethyl benzidine (TMBE 1000, Moss; Pasadena, MD).
  • TMBE 1000 tetramethyl benzidine
  • Antibodies mAbl, mAb2, mAb3, mAb4, mAb8, mAb9, mAblO, mAbl 1, mAbl 3, mAbl 5 and mAbl 6 were biotinylated by using EZ-LinkTM NHS-PEG Solid-Phase Biotinylation Kit (PIERCE Cat. No. 21450) and sandwich ELISA was conducted in a pairwise combinatorial manner using intact FGF21 (Tables 3 and 4). Biotinylated goat anti-FGF2l pAb BAF2539 (R&D Systems) was used as a positive control.
  • Antibodies mAbl, 4, 8, 9, 10 and 11 were then tested in ELISA using intact human FGF21 (Cat. No. 2539-FG, R&D Systems) in a combinatorial manner.
  • the absorbance values were plotted as a function of antibody concentration and the data were fitted to a three parameter equation to calculate the half maximal effective concentration (EC 50 ) values for each antibody using Prism 6 (GraphPad Software, Inc., La Jolla, CA) (Table 6). As shown in Table 6, better potency was observed when antibodies mAb4 or 9 were used as the capture antibody and antibodies mAblO or 11 were used as the detector antibody for intact human FGF21.
  • Antibodies mAb4, 8, 9, 10, 11, 15 and 16 were then tested in ELISA using intact human FGF21 (Cat. No. 2539-FG, R&D systems) or the FAP-cleaved human FGF21 in a combinatorial manner.
  • the absorbance values were plotted as a function of antibody concentration and the data were fitted to a three parameter equation for each antibody using Prism 6 (GraphPad Software, Inc., La Jolla, CA). The most consistent result was observed when antibodies mAb4 or 9 were used as the capture antibody and antibody mAbl 1 or mAbl5 was used as the detector antibody ( Figure 2 and Table 7). Therefore, mAb8 and 16 were removed from further analysis.
  • Figure 2 shows that the antibodies bind equally to intact and FAP-cleaved FGF21 (cFGF2l), which is important to detect the concentration of total FGF21 (z.e., both intact and FAP-cleaved).
  • Antibodies mAb4, 9, 11 and 15 were further analyzed by BIACORE ® surface plasmon resonance to determine the K d .
  • mAb4 has a K d of 3.689 x 10 10
  • mAb9 has a K d of 8.895 x 10 10
  • mAbl 1 has a K d of 2.704 x 10 10
  • mAbl5 has a K d of 3.955 x 10 12 .
  • Epitope mapping was conducted by expressing FGF19, FGF21 or FGF19- FGF21 chimeric proteins as FLAG-tagged proteins in transiently transfected HEK293 culture supernatant and testing the binding of antibodies mAb4, 9, 11 and 15 by ELISA.
  • ELISA 96 well MaxiSorp plate (439454, Nalge Nunc International; Rochester, NY) was coated with a mixture of 15 m ⁇ culture supernatant containing secreted protein and 135 m ⁇ of lx coating buffer (50 mM sodium carbonate, pH 9.6) overnight at 4°C.
  • HPIPDSSPHVHY GW GDPIRLRHL YT SGPHGL S SCFLRIRADGVVDC ARGO S AHSL LEDCAVALRTVAIKGVHSVRYLCMGADGKMOGLLOYSEEDCAFEEEIRPDGYN
  • VYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSS DPLSMVGPSQGRSPSYAS SEQ ID NO: 16
  • antibodies mAb4, 9, 11 and 15 bind to the core FGF folds of human FGF21 and do not bind to the N-terminal or C-terminal flexible regions.
  • the ELISA assay was performed as follows: 96 well MaxiSorp plate (Cat.
  • the plate was incubated with 0.5 pg/ml of the secondary Ab (biotinylated anti-FGF2l C-terminal pAb 30661 or anti-FGF2l mAbl l or 15) in Magic buffer (IX PBS pH 7.4, 0.5% BSA, 0.05% Tween 20, 0.2% BgG, 0.25% CHAPS, 5mM EDTA, 0.35M NaCl, 10PPM Proclin) for 1-2 hr at room temperature. After washing with Washing buffer, plate was incubated with High Sensitivity Streptavidin-HRP (PIERCE #21130) diluted 1 : 1,000 in assay buffer.
  • the secondary Ab biotinylated anti-FGF2l C-terminal pAb 30661 or anti-FGF2l mAbl l or 15
  • Magic buffer IX PBS pH 7.4, 0.5% BSA, 0.05% Tween 20, 0.2% BgG, 0.25% CHAPS, 5mM EDTA, 0.35M
  • the total FGF21 ELISA assay had an in-well sensitivity of 5 pg/ml and the active FGF21 ELISA assay had an in-well sensitivity of 28 pg/ml.
  • the active FGF21 ELISA assay did not detect the cleaved form of FGF21 that is missing the last 10 C-terminal amino acids.
  • FGF21 ELISA assays using mAb4 as the capture antibody and mAbl5 at the detector antibody were performed. As shown in Figure 9, there was minimal serum interference on the assay. The specificity of the assay for human FGF21 was also tested. As shown in Figure 9, the assay for total FGF21 detected human FGF21 that was expressed in human-FGF2l knock-in mice as compared to control mice. Figure 10 also shows that the assay using the disclosed antibodies was specific for human FGF21 and did not detect mouse FGF21.
  • VL Light Chain Variable Region
  • VH Heavy Chain Variable Region
  • the FGF21 ELISA Assay described in Example 4 was further optimized to improve the sensitivity of the assay.
  • an assay using the Quanterix Simoa HD-l AnalyzerTM was adapted to use mAb4 as the capture antibody, and either biotinylated mAh 15 (to detect total FGF21) or biotinylated C-ter pAb (to detect active FGF21) as the detector antibodies.
  • a schematic of the assay is shown in Figure 15.
  • the Quanterix Simoa immunoassay starts with the capture and labeling of total FGF21 with an enzyme conjugate (streptavidin b-galactosidase (SBG)), using a 2-step assay protocol ( Figure 16).
  • SBG enzyme conjugate
  • Figure 16 Total FGF21 captured with magnetic beads conjugated to mAb4 and biotinylated detection antibody (either mAbl5-Biotin for total FGF21 or C-ter pAb-Biotin for active FGF21) are added together to form a captured analyte sandwich in the first step, then SBG is added for detection in the second step. Between each step, the beads are washed. During each wash cycle, the instrument uses a magnet to pellet beads before automated aspiration of the supernatant. After the final wash cycle, the capture beads are
  • the capture beads After capture and labeling of FGF21, the capture beads are loaded into an array containing 216,000 40-fL wells that have been sized to hold no more than one bead per well (4.25 pm width, 3.25 pm depth). The bead suspension is pulled through the entry channel and over the array. Beads are allowed to settle into the wells via gravity for approximately 90 seconds. An aliquot of oil is dispensed in the array entry channel and pulled over the array, trapping the beads and RGP substrate in the microwells as well as removing excess beads from the surface. If a FGF21 molecule has been captured and labeled, the SBG hydrolyzes RGP substrate into the fluorescent product resorufm. The fluorescent product builds up within the sealed microwells, enabling detection of single molecules.
  • the multiplex capture beads were prepared using a two-step ED AC coupling protocol (Simoa Homebrew 2.0 Multiplex Bead Coating Protocol USER-213-11). Beads are coupled with 0.5 mg/mL mAb4 and 0.25 mg/mL EDAC. The coupling reaction occurs between the antibody primary amino groups and the carboxyl groups on the beads.
  • Quanterix Simoa assay was performed in 96-well NuncTM 96-Well Polypropylene MicroWellTM Plates (V-bottom, Thermo Scientific Nunc 249944, Rochester, NY).
  • recombinant intact human FGF21 (iFGF2l) and cleaved human FGF21 (cFGF2l) were serially diluted in Simoa buffer (PBS pH 7.4, 2% BSA (Fraction B, Protease-Free), 0.1% Tween, 5 mM EDTA) from 0.200-500 pg/mL ( Figure 17) or Magic Buffer (BA010) ( Figure 19-25, 28-32 and 33-37).
  • test samples were diluted at 1 :5-1 :20 in Simoa buffer or Magic Buffer.
  • the assay plate, along with the required recommended reagents were loaded into the Simoa HD-l Analyzer.
  • 32 pL of capture beads conjugated to mAb 4 32 pL of detector antibodies at 1 pg/mL (mAb 15-Biotin or C-ter pAb-Biotin) and 110 pL of SBG were used.
  • the assay was performed in duplicate. The manufacturer’s default Homebrew Assay was selected as the program for the automated procedures. Additional information regarding the assay protocol is provided in Figure 18.
  • the total (T) FGF21 Quanterix Simoa-based assay detected intact (Wild Type (WT)) FGF21 with an in-well sensitivity (based on 2 x mean AEB of blank wells) of 0.3 pg/ml and the cleaved (CL) form of FGF21, which does not have the last 10 C-terminal amino acids, with an in-well sensitivity of 0.6 pg/ml.
  • the active (A) FGF21 QSA detected intact FGF21 with an in-well sensitivity of 1.8 pg/ml.
  • a significant improvement in assay sensitivity was observed in both total FGF21 and active FGF21 QSAs as compared to traditional ELISA.
  • Figure 20 shows a representative of the standard curve performance for the total and active FGF21 assays. Good standard curve performance was observed.
  • the FGF21 QSAs described in Example 6 was further optimized to improve the sensitivity of the assay.
  • the active FGF21 assay had an in-well sensitivity of 1.2 pg/ml when the high bead concentration was used as compared to the in-well sensitivity of 0.6 pg/ml, which was observed with the low bead concentration.
  • Three different paramagnetic bead lots were also analyzed. As shown in Figure 23, similar binding curves and assay sensitivity were observed with the current and new lots of capture paramagnetic beads.
  • Optimized assay parameters are shown in Table 14. Table 14. Optimized Assay Parameters.
  • the total FGF21 assay was further analyzed to determine if a hook effect is observed.
  • a hook effect is typically observed when a high amount of analyte is present in a sample and the observed value is falsely lower.
  • the assays were performed as follows: for the total assay, capture using performed by mAb4 conjugated paramagnetic beads at a concentration of 0.59 x 10 7 beads/ml and detection was performed using 0.8 pg/mL of biotinylated mAh 15; for the active assay, capture was performed using mAb4 conjugated paramagnetic beads at a concentration of 0.59 x 10 7 beads/ml and detection was performed using 2.2 pg/mL biotinylated Sheep anti-FGF2l C-term pAb.
  • the total and active FGF21 QSAs were used to analyze samples obtained and freshly prepared from a healthy human donor.
  • the assays were performed as described in Example 6. As shown in Figure 26, the assay was able to detect low levels of active FGF21 in the serum sample of the healthy donor. Additional experiments were performed in donors that were hypertensive or were not on any medications and were compared with the use of MS-SAFE, a protease inhibitor cocktail (Figure 27).
  • the linearity of dilution was analyzed for the total and active FGF21 assays.
  • a linearity of dilution was acceptable within ⁇ 30% change from minimum required dilution (MRD) (1 :20 dilution) for the total FGF21 and at 1 :40 dilution in the active FGF21 assay ( Figure 30).
  • MRD minimum required dilution
  • Figure 30 A trend of a higher concentration at the initial MRD was observed.
  • the LLOQ was determined for the total and active FGF21 assays.
  • Preliminary LLOQ was determined to be 3.15 pg/ml and 10.94 pg/ml for the total FGF21 and active FGF21 assays, respectively, based on acceptable recovery within ⁇ 30% of the mean calculated concentration at the highest dilution factor (Figure 31).
  • the specificity of the assays was analyzed further. As shown in Figure 32, specificity was demonstrated by greater than 90% inhibition of AEB values of all six type 2 diabetic plasma sample in the presence of 10 pg/mL of mAb4 in the total FGF21 and active FGF21 assays.
  • HAMA affected both the total and active assay; whereas, HASA affected only the active assay.
  • the presence of 10 pg/ml of anti mouse IgG or anti-sheep IgG in the assay diluent did not affect the standard curve of the total and active assays, respectively.
  • Antibodies mAb4, mAb9, mAbl 1 and mAh 15 were grafted onto human IgGl frameworks with a K149C mutation to generate mouse/human chimeric anti-FGF2l antibodies that have the mouse VH and VL regions and the human constant region with the K149C mutation.
  • Amino acid sequences for the chimeric antibodies are provided below in Tables 16-19 and Figures 41 A and 41B. Table 16

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Endocrinology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Pathology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2019/025726 2018-04-04 2019-04-04 Methods for detecting and quantifying fgf21 Ceased WO2019195514A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
MX2020010387A MX2020010387A (es) 2018-04-04 2019-04-04 Metodos para detectar y cuantificar fgf21.
BR112020019756-4A BR112020019756A2 (pt) 2018-04-04 2019-04-04 métodos de imunoensaio para determinar a quantidade de proteína fgf21 total, para determinar a quantidade de proteína fgf21 ativa e para determinar a razão, imunoensaio, kits para detectar a proteína fgf21 total, para detectar a proteína fgf21 ativa e para determinar a razão, anticorpo anti-fgf21 isolado, anticorpo isolado, ácido nucleico isolado, célula hospedeira, método para produzir um anticorpo e composição
AU2019247778A AU2019247778A1 (en) 2018-04-04 2019-04-04 Methods for detecting and quantifying FGF21
CN201980022872.9A CN112005119A (zh) 2018-04-04 2019-04-04 检测和定量fgf21的方法
JP2020554225A JP2021520492A (ja) 2018-04-04 2019-04-04 Fgf21を検出及び定量化する方法
KR1020207031566A KR20200140852A (ko) 2018-04-04 2019-04-04 Fgf21을 검출하고 정량하기 위한 방법
EP19718949.1A EP3775930A1 (en) 2018-04-04 2019-04-04 Methods for detecting and quantifying fgf21
CA3092388A CA3092388A1 (en) 2018-04-04 2019-04-04 Methods for detecting and quantifying fgf21
IL277726A IL277726A (en) 2018-04-04 2020-10-01 Methods for detection and quantification of FGF21
US17/063,640 US20210025890A1 (en) 2018-04-04 2020-10-05 Methods for detecting and quantifying fgf21

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862652701P 2018-04-04 2018-04-04
US62/652,701 2018-04-04

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/063,640 Continuation US20210025890A1 (en) 2018-04-04 2020-10-05 Methods for detecting and quantifying fgf21

Publications (1)

Publication Number Publication Date
WO2019195514A1 true WO2019195514A1 (en) 2019-10-10

Family

ID=66248681

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/025726 Ceased WO2019195514A1 (en) 2018-04-04 2019-04-04 Methods for detecting and quantifying fgf21

Country Status (12)

Country Link
US (1) US20210025890A1 (https=)
EP (1) EP3775930A1 (https=)
JP (1) JP2021520492A (https=)
KR (1) KR20200140852A (https=)
CN (1) CN112005119A (https=)
AU (1) AU2019247778A1 (https=)
BR (1) BR112020019756A2 (https=)
CA (1) CA3092388A1 (https=)
IL (1) IL277726A (https=)
MX (1) MX2020010387A (https=)
TW (1) TW202011029A (https=)
WO (1) WO2019195514A1 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110954693A (zh) * 2019-11-29 2020-04-03 郑州大学 一种肿瘤标志物Cyfra21-1的Simoa试剂盒及其应用
CN112255415A (zh) * 2020-09-10 2021-01-22 温州医科大学 食蟹猴血清中fgf-21浓度的检测方法
WO2021092140A1 (en) * 2019-11-06 2021-05-14 Ngm Biopharmaceuticals, Inc. Methods of reducing lactate in liver disease patients using variants and fusions of fgf19/fgf21 polypeptides
US11065302B2 (en) 2011-07-01 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising fusion variants of FGF19 polypeptides
US11066454B2 (en) 2012-11-28 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
US11103554B2 (en) 2012-12-27 2021-08-31 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for reducing bile acid synthesis in a subject having cirrhosis
US11370841B2 (en) 2016-08-26 2022-06-28 Ngm Biopharmaceuticals, Inc. Methods of treating fibroblast growth factor 19-mediated cancers and tumors

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113030469B (zh) * 2021-03-18 2024-04-09 贵州省分析测试研究院 一种新型冠状病毒检测方法
CN114685654A (zh) * 2021-04-13 2022-07-01 广东东阳光药业有限公司 一种抗fgf21羧基末端的抗体及其应用
CN118294677A (zh) * 2024-04-12 2024-07-05 杭州戴格生物技术有限公司 一种检测成纤维细胞生长因子21的方法

Citations (98)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4474893A (en) 1981-07-01 1984-10-02 The University of Texas System Cancer Center Recombinant monoclonal antibodies
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4881175A (en) 1986-09-02 1989-11-14 Genex Corporation Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
EP0425235A2 (en) 1989-10-25 1991-05-02 Immunogen Inc Cytotoxic agents comprising maytansinoids and their therapeutic use
US5013653A (en) 1987-03-20 1991-05-07 Creative Biomolecules, Inc. Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
US5258498A (en) 1987-05-21 1993-11-02 Creative Biomolecules, Inc. Polypeptide linkers for production of biosynthetic proteins
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5476786A (en) 1987-05-21 1995-12-19 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
WO1997030087A1 (en) 1996-02-16 1997-08-21 Glaxo Group Limited Preparation of glycosylated antibodies
US5712374A (en) 1995-06-07 1998-01-27 American Cyanamid Company Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates
US5714586A (en) 1995-06-07 1998-02-03 American Cyanamid Company Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5739116A (en) 1994-06-03 1998-04-14 American Cyanamid Company Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5770701A (en) 1987-10-30 1998-06-23 American Cyanamid Company Process for preparing targeted forms of methyltrithio antitumor agents
US5770710A (en) 1987-10-30 1998-06-23 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
WO1998058964A1 (en) 1997-06-24 1998-12-30 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO2001029246A1 (fr) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Procede de production d'un polypeptide
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
US6630579B2 (en) 1999-12-29 2003-10-07 Immunogen Inc. Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
WO2005035586A1 (ja) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. 融合蛋白質組成物
WO2005035778A1 (ja) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
US20050123546A1 (en) 2003-11-05 2005-06-09 Glycart Biotechnology Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
WO2005053742A1 (ja) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. 抗体組成物を含有する医薬
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US20060025576A1 (en) 2000-04-11 2006-02-02 Genentech, Inc. Multivalent antibodies and uses therefor
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US7041870B2 (en) 2000-11-30 2006-05-09 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US20070061900A1 (en) 2000-10-31 2007-03-15 Murphy Andrew J Methods of modifying eukaryotic cells
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
WO2008077546A1 (en) 2006-12-22 2008-07-03 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
US7498298B2 (en) 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
EP2163626A1 (en) * 1999-11-18 2010-03-17 Novartis Vaccines and Diagnostics, Inc. Human FGF-21 gene and gene expression products
US20100184665A1 (en) 2007-04-06 2010-07-22 Masashi Suzuki Method for activating receptor by cofactor and method for utilizing ligand activity
US20150218276A1 (en) 2013-12-23 2015-08-06 Genentech, Inc. Antibodies and methods of use

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102352407B (zh) * 2011-10-17 2014-05-21 温州医学院 Fgf-21活性测定的方法
US20140206023A1 (en) * 2013-01-24 2014-07-24 Ping Gao Methods, Kits & Antibodies for Detecting Intact Fibroblast Growth Factor 21
US10132816B2 (en) * 2013-03-14 2018-11-20 Beth Israel Deaconess Medical Center, Inc. Measurement of FGF21 as a biomarker of fructose metabolism
CN104215774B (zh) * 2014-08-22 2016-03-09 黑龙江八一农垦大学 一种利用fgf21因子诊断奶牛隐性酮病的方法

Patent Citations (108)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4474893A (en) 1981-07-01 1984-10-02 The University of Texas System Cancer Center Recombinant monoclonal antibodies
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US5455030A (en) 1986-09-02 1995-10-03 Enzon Labs, Inc. Immunotheraphy using single chain polypeptide binding molecules
US4881175A (en) 1986-09-02 1989-11-14 Genex Corporation Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5013653A (en) 1987-03-20 1991-05-07 Creative Biomolecules, Inc. Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5482858A (en) 1987-05-21 1996-01-09 Creative Biomolecules, Inc. Polypeptide linkers for production of biosynthetic proteins
US5476786A (en) 1987-05-21 1995-12-19 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5258498A (en) 1987-05-21 1993-11-02 Creative Biomolecules, Inc. Polypeptide linkers for production of biosynthetic proteins
US5770701A (en) 1987-10-30 1998-06-23 American Cyanamid Company Process for preparing targeted forms of methyltrithio antitumor agents
US5770710A (en) 1987-10-30 1998-06-23 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
US5416064A (en) 1989-10-25 1995-05-16 Immunogen, Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
EP0425235A2 (en) 1989-10-25 1991-05-02 Immunogen Inc Cytotoxic agents comprising maytansinoids and their therapeutic use
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6417429B1 (en) 1989-10-27 2002-07-09 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5773001A (en) 1994-06-03 1998-06-30 American Cyanamid Company Conjugates of methyltrithio antitumor agents and intermediates for their synthesis
US5739116A (en) 1994-06-03 1998-04-14 American Cyanamid Company Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents
US5877296A (en) 1994-06-03 1999-03-02 American Cyanamid Company Process for preparing conjugates of methyltrithio antitumor agents
US5767285A (en) 1994-06-03 1998-06-16 American Cyanamid Company Linkers useful for the synthesis of conjugates of methyltrithio antitumor agents
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5712374A (en) 1995-06-07 1998-01-27 American Cyanamid Company Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates
US5714586A (en) 1995-06-07 1998-02-03 American Cyanamid Company Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates
WO1997030087A1 (en) 1996-02-16 1997-08-21 Glaxo Group Limited Preparation of glycosylated antibodies
WO1998058964A1 (en) 1997-06-24 1998-12-30 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US7332581B2 (en) 1999-01-15 2008-02-19 Genentech, Inc. Polypeptide variants with altered effector function
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
WO2001029246A1 (fr) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Procede de production d'un polypeptide
EP2163626A1 (en) * 1999-11-18 2010-03-17 Novartis Vaccines and Diagnostics, Inc. Human FGF-21 gene and gene expression products
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US6630579B2 (en) 1999-12-29 2003-10-07 Immunogen Inc. Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use
US20060025576A1 (en) 2000-04-11 2006-02-02 Genentech, Inc. Multivalent antibodies and uses therefor
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
US20070061900A1 (en) 2000-10-31 2007-03-15 Murphy Andrew J Methods of modifying eukaryotic cells
US7041870B2 (en) 2000-11-30 2006-05-09 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
US20040110704A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells of which genome is modified
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
WO2005035586A1 (ja) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. 融合蛋白質組成物
WO2005035778A1 (ja) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法
US20050123546A1 (en) 2003-11-05 2005-06-09 Glycart Biotechnology Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
US7498298B2 (en) 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2005053742A1 (ja) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. 抗体組成物を含有する医薬
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
WO2008077546A1 (en) 2006-12-22 2008-07-03 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
US20100184665A1 (en) 2007-04-06 2010-07-22 Masashi Suzuki Method for activating receptor by cofactor and method for utilizing ligand activity
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
US20150218276A1 (en) 2013-12-23 2015-08-06 Genentech, Inc. Antibodies and methods of use

Non-Patent Citations (117)

* Cited by examiner, † Cited by third party
Title
"The Cambridge Dictionary of Science and Technology", 1988
"The Glossary of Genetics", 1991, SPRINGER VERLAG
ALMAGRO; FRANSSON, FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633
ANONYMOUS: "FGF21 fibroblast growth factor 21", XP002791798, Retrieved from the Internet <URL:https://www.lsbio.com/targets/fgf21/g193379?fq=FilterReactConf%3a%22Human%22&prefix=a> [retrieved on 20190604] *
BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684
BOERNER ET AL., J. IMMUNOL., vol. 147, 1991, pages 86
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81
BRENNAN, SCIENCE, vol. 229, 1985, pages 81 - 83
BRODEUR ET AL.: "Monoclonal Antibody Production Techniques and Applications", 1987, MARCEL DEKKER, INC., pages: 51 - 63
BRUGGEMANN, M. ET AL., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361
CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285
CHARI ET AL., CANCER RES., vol. 52, 1992, pages 127 - 131
CHARLTON: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 245 - 254
CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOWDHURY, METHODS MOL. BIOL., vol. 207, 2008, pages 179 - 196
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLARKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLYNES ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656
CRAGG, M.S. ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052
CRAGG, M.S.; M.J. GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743
CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085
DALL' ACQUA ET AL., METHODS, vol. 36, 2005, pages 43 - 60
DUBOWCHIK ET AL., BIOORG. & MED. CHEM. LETTERS, vol. 12, 2002, pages 1529 - 1532
DUNCAN; WINTER, NATURE, vol. 322, 1988, pages 738 - 40
DUNSHEE ET AL., J. BIOL. CHEM., vol. 291, no. 11, 2016, pages 5986 - 96
FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472
FLATMAN ET AL., J. CHROMATOGR. B, vol. 848, 2007, pages 79 - 87
GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163
GERNGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414
GLENNIE, J. IMMUNOL., vol. 139, 1987, pages 2367 - 2375
GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59
GRIFFITHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734
GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368
GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587
HALE; MARHAM: "The Harper Collins Dictionary of Biology", 1991
HARLOW; LANE: "Antibodies", COLD SPRING HARBOR PRESS, COLD SPRING HARBOR
HARLOW; LANE: "Antibodies, A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY
HELLSTROM, I ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502
HELLSTROM, I. ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063
HINMAN ET AL., CANCER RES., vol. 53, 1993, pages 3336 - 3342
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HOOGENBOOM ET AL.: "Methods in Molecular Biology", vol. 178, 2001, HUMAN PRESS, pages: 1 - 37
HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1992, pages 381 - 388
HUDSON ET AL., NAT. MED., vol. 9, 2003, pages 129 - 134
IDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184
JEFFREY ET AL., BIOORGANIC & MED. CHEM. LETTERS, vol. 16, 2006, pages 358 - 362
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", vol. 1-3, 1991, NIH PUBLICATION, pages: 91 - 3242
KAM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 102, 2005, pages 11600 - 11605
KANDA, Y. ET AL., BIOTECHNOL. BIOENG., vol. 94, no. 4, 2006, pages 680 - 688
KARPOVSKY, J. EXP. MED., vol. 160, 1984, pages 1686
KASHMIRI ET AL., METHODS, vol. 36, 2005, pages 25 - 34
KHARITONENKOV ET AL., J. CLIN. INVEST., vol. 115, no. 6, 2005, pages 1627 - 35
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249
KINDT ET AL.: "Kuby Immunology", 2007, W.H. FREEMAN AND CO., pages: 91
KING ET AL., J. MED. CHEM., vol. 45, 2002, pages 4336 - 4343
KLIMKA ET AL., BR. J. CANCER, vol. 83, 2000, pages 252 - 260
KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553
KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001
KRANZ, PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 5807
KRATZ ET AL., CURRENT MED. CHEM., vol. 13, 2006, pages 477 - 523
LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132
LEE ET AL., J. MOL. BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093
LI ET AL., DIABETES RES. CLIN. PRACT., vol. 93, no. 1, 2011, pages 10 - 16
LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215
LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 3557 - 3562
LIU, PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 8648
LODE ET AL., CANCER RES., vol. 58, 1998, pages 2925 - 2928
LONBERG, CURR. OPIN. IMMUNOL., vol. 20, 2008, pages 450 - 459
LONBERG, NAT. BIOTECH., vol. 23, 2005, pages 1117 - 1125
MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745
MARKS ET AL., J. MOL. BIOL., vol. 222, 1992, pages 581 - 597
MARKS; BRADBURY: "Methods in Molecular Biology", vol. 248, 2003, HUMAN PRESS, pages: 161 - 175
MATHER ET AL., ANNALS N.Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68
MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251
MCCAFFERTY ET AL., NATURE, vol. 348, pages 552 - 554
MILSTEIN; CUELLO, NATURE, vol. 305, 1983, pages 537
MORRIS: "Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS, article "Epitope Mapping Protocols"
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
NAGY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 829 - 834
NI, XIANDAI MIANYIXUE, vol. 26, no. 4, 2006, pages 265 - 268
OGAWA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 104, no. 18, 2007, pages 7432 - 37
OKAZAKI ET AL., J. MOL. BIOL., vol. 336, 2004, pages 1239 - 1249
OSBOURN ET AL., METHODS, vol. 36, 2005, pages 61 - 68
PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498
PAULUS, BEHRINGINS. MITT., 1985, pages 118 - 132
PETKOVA, S.B. ET AL., INT'L. IMMUNOL., vol. 18, no. 12, 2006, pages 1759 - 1769
PLUCKTHUN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315
PORTOLANO ET AL., J. IMMUNOL., vol. 150, 1993, pages 880 - 887
PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599
PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623
QUEEN ET AL., PROC. NAT7ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033
RAVETCH; KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329
RIPKA ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 249, 1986, pages 533 - 545
ROSOK ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618
SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604
SIDHU ET AL., J. MOL. BIOL., vol. 338, no. 2, 2004, pages 299 - 310
SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296
SINGLETON ET AL.: "Dictionary of Microbiology and Molecular Biology", 1994
TARA S UMBERGER ET AL: "Novel sandwich immunoassays for the measurement of total and active FGF21", BIOANALYSIS, vol. 6, no. 24, 1 December 2014 (2014-12-01), London, UK, pages 3283 - 3293, XP055593858, ISSN: 1757-6180, DOI: 10.4155/bio.14.241 *
TORGOV ET AL., BIOCONJ. CHEM., vol. 16, 2005, pages 717 - 721
TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655
TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60
URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216
VAN DIJK; VAN DE WINKEL, CURR. OPIN. PHARMACOL., vol. 5, 2001, pages 368 - 74
VITETTA ET AL., SCIENCE, vol. 238, 1987, pages 1098
VOLLMERS; BRANDLEIN, HISTOLOGY AND HISTOPATHOLOGY, vol. 20, no. 3, 2005, pages 927 - 937
VOLLMERS; BRANDLEIN, METHODS AND FINDINGS IN EXPERIMENTAL AND CLINICAL PHARMACOLOGY, vol. 27, no. 3, 2005, pages 185 - 91
WINTER ET AL., ANN. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455
WRIGHT ET AL., TIBTECH, vol. 15, 1997, pages 26 - 32
YAMANE-OHNUKI ET AL., BIOTECH. BIOENG., vol. 87, 2004, pages 614
YAZAKI; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268
YIE ET AL., FEBS LETTERS, vol. 583, 2009, pages 19 - 24
ZHANG ET AL., DIABETES, vol. 57, no. 5, 2008, pages 1246 - 1253

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11065302B2 (en) 2011-07-01 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising fusion variants of FGF19 polypeptides
US11066454B2 (en) 2012-11-28 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
US11103554B2 (en) 2012-12-27 2021-08-31 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for reducing bile acid synthesis in a subject having cirrhosis
US11370841B2 (en) 2016-08-26 2022-06-28 Ngm Biopharmaceuticals, Inc. Methods of treating fibroblast growth factor 19-mediated cancers and tumors
WO2021092140A1 (en) * 2019-11-06 2021-05-14 Ngm Biopharmaceuticals, Inc. Methods of reducing lactate in liver disease patients using variants and fusions of fgf19/fgf21 polypeptides
CN110954693A (zh) * 2019-11-29 2020-04-03 郑州大学 一种肿瘤标志物Cyfra21-1的Simoa试剂盒及其应用
CN112255415A (zh) * 2020-09-10 2021-01-22 温州医科大学 食蟹猴血清中fgf-21浓度的检测方法

Also Published As

Publication number Publication date
CN112005119A (zh) 2020-11-27
AU2019247778A1 (en) 2020-11-19
EP3775930A1 (en) 2021-02-17
BR112020019756A2 (pt) 2021-01-26
IL277726A (en) 2020-11-30
MX2020010387A (es) 2020-10-22
TW202011029A (zh) 2020-03-16
CA3092388A1 (en) 2019-10-10
JP2021520492A (ja) 2021-08-19
KR20200140852A (ko) 2020-12-16
US20210025890A1 (en) 2021-01-28

Similar Documents

Publication Publication Date Title
US20210025890A1 (en) Methods for detecting and quantifying fgf21
US11002738B2 (en) Anti-GPNMB antibodies and diagnostic uses thereof
US10975157B2 (en) Anti-OX40 antibodies and diagnostic uses thereof
US8993249B2 (en) Anti-neuropilin antibodies and methods of use
US12419201B2 (en) Materials and methods for performing histochemical assays for human pro-epiregulin and amphiregulin
US20190376973A1 (en) Anti- indoleamine 2,3-dioxygenase 1 antibodies and diagnostic uses thereof
HK40035613A (en) Methods for detecting and quantifying fgf21
HK1180347A (en) Anti-neuropilin antibodies and methods of use

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19718949

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3092388

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020554225

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020019756

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20207031566

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019718949

Country of ref document: EP

Effective date: 20201104

ENP Entry into the national phase

Ref document number: 2019247778

Country of ref document: AU

Date of ref document: 20190404

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112020019756

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20200928