WO2019177200A1 - Foxp3를 발현하는 수지상 세포의 암의 진단 또는 치료를 위한 용도 - Google Patents

Foxp3를 발현하는 수지상 세포의 암의 진단 또는 치료를 위한 용도 Download PDF

Info

Publication number
WO2019177200A1
WO2019177200A1 PCT/KR2018/005026 KR2018005026W WO2019177200A1 WO 2019177200 A1 WO2019177200 A1 WO 2019177200A1 KR 2018005026 W KR2018005026 W KR 2018005026W WO 2019177200 A1 WO2019177200 A1 WO 2019177200A1
Authority
WO
WIPO (PCT)
Prior art keywords
cancer
cells
regulatory
cells expressing
expressing
Prior art date
Application number
PCT/KR2018/005026
Other languages
English (en)
French (fr)
Inventor
배용수
정이들
강명호
Original Assignee
성균관대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 성균관대학교 산학협력단 filed Critical 성균관대학교 산학협력단
Priority to JP2019558751A priority Critical patent/JP2020518569A/ja
Priority to US16/608,817 priority patent/US20200181273A1/en
Priority to CN201880027892.0A priority patent/CN110573181A/zh
Priority to KR1020197034995A priority patent/KR20190140999A/ko
Publication of WO2019177200A1 publication Critical patent/WO2019177200A1/ko

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4615—Dendritic cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/462—Cellular immunotherapy characterized by the effect or the function of the cells
    • A61K39/4621—Cellular immunotherapy characterized by the effect or the function of the cells immunosuppressive or immunotolerising
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/462—Cellular immunotherapy characterized by the effect or the function of the cells
    • A61K39/4622—Antigen presenting cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464499—Undefined tumor antigens, e.g. tumor lysate or antigens targeted by cells isolated from tumor
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/642—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the peptide or protein in the drug conjugate being a cytokine, e.g. IL2, chemokine, growth factors or interferons being the inactive part of the conjugate
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0636—T lymphocytes
    • C12N5/0637—Immunosuppressive T lymphocytes, e.g. regulatory T cells or Treg
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5011—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing antineoplastic activity
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
    • G01N33/5047—Cells of the immune system
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6872—Intracellular protein regulatory factors and their receptors, e.g. including ion channels
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
    • A61K2239/48—Blood cells, e.g. leukemia or lymphoma
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2502/00—Coculture with; Conditioned medium produced by
    • C12N2502/11—Coculture with; Conditioned medium produced by blood or immune system cells
    • C12N2502/1114—T cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2502/00—Coculture with; Conditioned medium produced by
    • C12N2502/11—Coculture with; Conditioned medium produced by blood or immune system cells
    • C12N2502/1121—Dendritic cells
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
    • G01N2333/70517—CD8

Definitions

  • cancer treatment targets Use as one or more cancer treatment targets and / or as cancer diagnostic markers selected from the group consisting of dendritic cells expressing Foxp3 (Forkhead box P3) and regulatory T cells expressing cluster of differentiation 8 (CD8).
  • cancer diagnostic markers selected from the group consisting of dendritic cells expressing Foxp3 (Forkhead box P3) and regulatory T cells expressing cluster of differentiation 8 (CD8).
  • DCs Dendritic Cells
  • APCs antigen presenting cells
  • Foxp3 (Forkhead box P3) is a transcriptional regulator known to be involved in the development and function of regulatory T cells (Treg) (Hori, S .. Nomura, T. & Sakaguchi, S. Control of regulatory T cells development by the transcription factor Foxp 3. Science 299, 1057-1061.doi: 10.1126 / science.1079490 (2003)).
  • dendritic cells expressing Foxp3 in vivo eg, blood, tumor tissue, etc.
  • their use for prognostic monitoring after diagnosis and / or treatment of cancer and / or chemotherapy One example provides the use of dendritic cells expressing Foxp3 as cancer therapeutic targets and / or cancer diagnostic markers.
  • Another example provides a pharmaceutical composition for treating cancer comprising an inhibitor of Foxp3 expressing dendritic cells as an active ingredient.
  • the pharmaceutical composition for treating cancer may be for administration to cancer patients in which dendritic cells expressing Foxi) 3 in tumor tissue or blood are detected. 2019/177200 1 »(: 1 ⁇ 1 ⁇ 2018/005026
  • Another example expresses? (Example) 3 .
  • the use for the treatment of cancer may be for application to cancer patients in which dendritic cells expressing 1 ⁇ 0X93 in tumor tissue or blood have been detected.
  • Another example includes administering to a cancer patient a pharmaceutically effective amount of an inhibitor of dendritic cells expressing 1 ⁇ 2 3.
  • the cancer patient may be a cancer patient in which dendritic cells expressing [ ⁇ 3 are detected in tumor tissue or blood.
  • Another example includes an inhibitor of dendritic cells expressing 1 ⁇ 0X93 as an active ingredient.
  • a pharmaceutical composition for inhibiting expressing regulatory I cells (3) 8 + ⁇ ⁇ ).
  • Another example is that of an inhibitor of dendritic cells expressing 1 ⁇ 0X03.
  • Provided for use in inhibiting expressing regulatory cells Another example provides a method for inhibiting regulated I cells expressing 008, comprising administering an inhibitor of dendritic cells expressing (1) 3 to a patient in need of regulatory 1 " cell inhibition expressing 008.
  • the patient is a cancer patient, such as tumor tissue or blood
  • the dendritic cells expressing may be cancer patients detected.
  • Another example is Expressing regulatory I cells ( ⁇ 8 + Provides use as a cancer treatment target.
  • Another example provides a pharmaceutical composition for treating cancer, comprising an inhibitor of the regulatory I cells expressing 008 as an active ingredient.
  • the pharmaceutical composition for treating cancer is in tumor tissue or blood It may be for administration to a cancer patient in which regulatory I cells expressing are detected.
  • Another example is Provided for use in the treatment of cancer of inhibitors of expressing regulatory cells.
  • Use for the treatment of cancer is used in tumor tissue or blood It can be 'intended to apply to the regulation of the expression I detect cancer cells.
  • a method of treating cancer comprising administering to a cancer patient a pharmaceutically effective amount of an inhibitor of regulatory I cells to express.
  • the cancer patient has detected regulatory I cells expressed in tumor tissue or blood. 2019/177200 1 »(: 1 ⁇ 1 ⁇ 2018/005026
  • Another example is a dendritic cell expressing Foxp3 as a candidate compound. Regulation I expressing 008. Or if the level of dendritic cells expressing Ez. 3 and / or regulatory I cells expressing E. 3 after contact with all of them is reduced, determining the candidate compound as an anticancer agent candidate. to provide.
  • Another example provides a composition for diagnosing cancer or for confirming cancer prognosis comprising a detectable agent for dendritic cells expressing?
  • Another example includes detecting dendritic cells expressing 13 ⁇ 4-3 in a biological sample isolated from a patient.
  • the cancer diagnosis method In the biological sample after the detecting step When expressing dendritic cells (if present). Determining the patient as a cancer patient. Or it may further comprise the step of confirming the progression of the cancer according to the level of dendritic cells expressing Leejae3.
  • dendritic cells expressing ( «? 3 Provides a method for producing controlled expressing 008 comprises incubated with the cells for expression of I I cells ([08 + I).
  • the apoptotic cells expressing 3 008 + generated by coculture with expressing I cells Provided for use in the prevention and / or treatment of immune suppression and / or autoimmune disease or denial of ear.
  • the (3) + 8 may be one produced by the production method of the above-described (3) 8 +.
  • Other examples are provided for the prevention and / or treatment of immunosuppressant or an autoimmune disease or graft rejection comprising as an effective ingredient yongreul (3) 8 + prepared by the above method the composition.
  • Another example is an immunosuppressive method or autoimmune disease comprising administering to a subject in need thereof a VII 8 + urine prepared by the above method for immune suppression or autoimmune disease or transplant rejection or Provided are methods for preventing and / or treating transplant rejection.
  • One example provides the use of dendritic cells expressing 13 ⁇ 4 3 as a cancer therapeutic target.
  • Another example provides a pharmaceutical composition for treating cancer comprising an inhibitor of dendritic cells expressing 0-3 as an active ingredient. remind The expressing dendritic cells may be present in tumor tissue or blood of a cancer patient.
  • the pharmaceutical composition for treating cancer is in tumor tissue or blood It may be for administration to a cancer patient in which the expressing dendritic cells are detected.
  • Another example provides a use for use in the treatment of cancer of inhibitors of dendritic cells expressing E03.
  • Use for the treatment of cancer is used in tumor tissue or blood
  • the expressing dendritic cells may be for application to detected cancer patients.
  • a pharmaceutically effective amount of an inhibitor of dendritic cells expressing 13 ⁇ 4 1) 3 is administered to a cancer patient, or dendritic cells expressing? ( ⁇ 3) from the patient (eg, the patient's blood and / or tumor tissue, etc.). It provides a method of treating cancer, comprising the step of removing.
  • the cancer patient may be treated with a tumor, a tissue, or blood.
  • the dendritic cells expressing may be cancer patients detected.
  • Another example is Including an inhibitor of dendritic cells to express as an active ingredient Expressing regulatory I cells ⁇ 08 + 1> 6). Another example provides a use for the inhibition of regulatory I cell expressing [08] of an inhibitor of dendritic cells expressing ⁇ 0X9,3. Another example is an inhibitor of dendritic cells expressing Example 3. Or to a patient in need of expressing regulatory I cell inhibition.
  • the patient eg, the patient's blood 2019/177200 1 »(: 1 ⁇ 1 ⁇ 2018/005026
  • the expressing regulatory 1 cell may be one that is induced in the blood of a cancer patient by dendritic cells expressing Foxp3.
  • the patient is a cancer patient, such as. In cancer patients or tumor tissues or blood with dendritic cells expressing 0 ⁇ 03 in tumor tissues or blood By expressing dendritic cells
  • the regulating I cells expressing may be induced.
  • Regulatory I cells expressing 0 8 + are provided as cancer therapeutic targets.
  • Another example is It provides a pharmaceutical composition for treating cancer comprising an inhibitor of the regulatory I cells expressing as an active ingredient.
  • the pharmaceutical composition for treating cancer may be for administration to cancer patients in which regulatory I cells expressing 008 in tumor tissue or blood are detected.
  • Another example is Provided for use in the treatment of cancer of inhibitors of expressing regulatory I cells.
  • Use for the treatment of cancer is used in tumor tissue or blood Expressing regulatory I cells may be for application to detected cancer patients.
  • a pharmaceutically effective amount of an inhibitor of regulatory I cells expressing is administered to or from a cancer patient (e.g., the patient's blood and / or tumor tissue, etc.) Removing regulatory I cells that express.
  • a cancer patient e.g., the patient's blood and / or tumor tissue, etc.
  • Removing regulatory I cells that express Provides a method for treating cancer.
  • the cancer patient may be a cancer patient in which regulatory I cells expressing 0 8 in tumor tissue or blood are detected.
  • Another example is a dendritic cell expressing 3 of a candidate compound. 008 Regulatory I cells expressing, or dendritic cells expressing ⁇ ⁇ 0X1) 3 after contact with both Reduced levels of regulatory I cells expressing. Determining the candidate compound as an anticancer drug candidate.
  • An anticancer drug screening method is provided. Salvation. The said screening method is a dendritic cell which expresses (1) a candidate compound Example 3). Regulatory I cells expressing 008. All of these, or biological samples comprising them (eg. blood. Blood cells. Tumor tissue, etc.); And (2) (example) dendritic cells expressing 3 2019/177200 1 »(: 1 ⁇ 1 ⁇ 2018/005026
  • the anticancer drug screening method after step (2). Dendritic cells and / or expressing? 3 measured in step (2) Dendritic cells expressing (Example) 3 levels of regulatory I cells expressing candidate compounds prior to treatment. Comparing to the level of regulatory I cells expressing (step (3)).
  • the anti-cancer agent screening method after the step (2) or step (3), the dendritic cells expressing (?
  • the method may further include the step of determining the candidate compound as an anticancer drug candidate (step (4)). Each step of the screening method may be performed in vitro (111 0). Also. Dendritic cells expressing these 3 and / or The expressing regulatory I cell can be a cell isolated from a living body.
  • Another example provides a cancer diagnostic composition comprising a detectable agent for dendritic cells expressing? 3.
  • Another example is in a biological sample isolated from a patient. It provides a method for diagnosing or prognosticing cancer or providing information for diagnosing or prognosticing cancer, the method comprising detecting dendritic cells expressing.
  • the method of diagnosing or confirming the prognosis of the cancer may include determining whether the patient is a cancer patient or detecting a dendritic cell expressing 3 ⁇ 4 03 in the biological sample (if present) after the detecting step.
  • the dendritic cell level changes expressing 0X93 may further comprise the step of confirming the progress of the cancer.
  • the cancer diagnostic method may include determining whether the patient is a cancer patient or detecting a dendritic cell expressing 3 ⁇ 4 03 in the biological sample (if present) after the detecting step.
  • the dendritic cell level changes expressing 0X93 may further comprise the step of confirming the progress of the cancer.
  • a biological sample is blood isolated from a mammal, such as a human, that requires a preliminary confirmation of a presumption of the prognosis after the occurrence of cancer. Blood cells and the like. In one example.
  • the method of diagnosing cancer after determining the cancer patient.
  • Dendritic cell inhibitors expressing (E) 3 in patients determined to be cancer patients, and The method may further comprise administering at least one pharmaceutically effective amount selected from the group consisting of expressing regulatory I cell inhibitors. 2019/177200 1 »(: 1 ⁇ 1 ⁇ 2018/005026
  • a biological sample is blood isolated from a cancer patient who wants to monitor (monitor) the prognosis (progression) of cancer.
  • Blood cells may be one or more selected from the group consisting of.
  • Tumor tissue may be one or more selected from the group consisting of.
  • Dendritic cell levels expressed in biological samples isolated from cancer patients were immediately instantiated at two or more different time points, at any one time point. When the expressing dendritic cell level is higher than the level measured at the previous time point, it can be confirmed that the cancer patients are getting worse or the cancer progresses faster, and the dendritic cell level expressing? '3 measured at any one time point.
  • the cancer prognosis method is. (1) measuring a dendritic cell level expressing a 3 'standing in a biological sample isolated from a cancer patient in the at least two different time, and (2) a dendritic cell level, i.e., expressing a set Foxp3 at any point in time If it is higher than the level measured at this previous point, the dendritic cell level expressing 3 when the cancer patient is deteriorating or progressing in the cancer patient or is measured at any point is higher than the level immediately determined at the previous point. If low, the cancer patient may include the step of confirming that the cancer is being alleviated or the cancer progression is slowing.
  • the method of confirming the cancer prognosis may be anti-cancer treatment (eg Chemotherapy efficacy monitoring (prognosis monitoring after chemotherapy) in cancer patients during chemotherapy). Therefore.
  • compositions for anticancer therapeutic efficacy confirmation (monitoring) comprising a detectable agent for expressing dendritic cells.
  • Another example provides a method for identifying chemotherapy efficacy (monitoring) or providing information on chemotherapy efficacy (monitoring) comprising detecting dendritic cells expressing 13 ⁇ 4 93 in a biological sample isolated from a patient.
  • the patient may be a patient undergoing chemotherapy.
  • the chemotherapy may be a combination of chemotherapy or chemotherapy. Gene therapy biological therapy. All conventional chemotherapy consisting of physical therapy such as radiation therapy, surgical surgery, etc. 2019/177200 1 »(: 1 ⁇ 1 ⁇ 2018/005026
  • the biological sample is blood isolated from a cancer patient for whom anticancer therapeutic efficacy is desired.
  • Blood cells Tumor tissue may be one or more selected from the group consisting of.
  • the anti-cancer treatment efficacy confirmation method By measuring dendritic cell levels expressing (? 3) in isolated biological samples from cancer patients treated with chemotherapy. Increased than before the chemotherapy. The chemotherapy can be found to have no anticancer effect in the cancer patient. If the chemo decreased than before receiving the chemotherapy, it may be confirmed that the chemotherapy has an anticancer effect in the cancer patient.
  • the anticancer treatment may comprise the step of confirming that it is effective in the cancer patient.
  • the term "after chemotherapy" as the time for instantaneous dendritic cell levels expressing ⁇ 133 is a period of time from immediately after chemotherapy to 2 months (eg. Immediately after chemotherapy for 8 weeks. Immediately after chemotherapy for 7 weeks. Immediately after chemotherapy for 6 weeks. Immediately after chemotherapy for 5 weeks.
  • step (3) (4) Dendritic cell levels expressed after chemotherapy (example) are higher than those measured before chemotherapy (the anticancer treatment was found to be ineffective in the cancer patient) If it is). Discontinue chemo or apply other chemo to the cancer patient. If dendritic cell levels expressing 0 ash3 measured after chemotherapy are below those measured prior to chemotherapy (if the chemotherapy is found to be effective in the cancer patient :), the chemotherapy is maintained or enhanced It may further comprise the step.
  • the anticancer effect is cancer cell death 2019/177200 1 11012018/005026
  • Cancer tissue disappears or decreases in size. Remove or alleviate symptoms of cancer, such as suppressing cancer metastasis have.
  • a method for producing a regulatory I cell (I8 + 1> 6 sugar) expressing 008 comprising culturing the expressing I cells together.
  • the culturing step includes (I) 3 dendritic cells and I cells expressing. 1: 0.1 to 10, 1: 0.1 to 8, 1: 0.1 to 6, 1: 0.1 to 4, 1: 0.1 to 2. 1: 0.1 to 1. 1: 0.3 to 10, 1: 0.3 8. 1: 0.3 to 6, 1: 0.3 to 4, 1: 0.3 to 2, 1: 0.3 to 1. 1: 0.5 to 10. 1: 0.5 to 8, 1: 0.5 to 6.
  • Dendritic cells expressing 1: 1 to 6, 1: 1 to 4, or 1: 1 to 2 The number of I cells expressing) can be carried out by culturing together.
  • dendritic cells expressing the above ( ⁇ 3).
  • Co-culturing expressing I cells provides regulatory I cells expressing 008 produced.
  • Regulatory I cells expressing [08 are described above. It may be prepared by the method for producing regulatory I cells to express.
  • Another example is (generated by coculture of dendritic cells expressing «? 3 and I cells expressing 008).
  • Another example is prepared by the manufacturing method Immunosuppressive methods or methods of preventing and / or treating autoimmune diseases or rejection of transplantation, comprising administering expressing regulatory I cells to an individual in need of prevention and / or treatment of immune suppression or autoimmune disease or rejection of transplantation.
  • the autoimmune disease is rheumatism. Lupus disease. It may be selected from autoimmune hepatitis, autoimmune hemolytic disease, and the like. Below. The present invention is explained in more detail.
  • Foxp3 (also called Forkhead box P3, also called scur f in) is a protein involved in immune system responses. It functions as a major regulator of regulatory pathways of development and function of regulatory T cells. Foxp3 is a primate such as humans and monkeys. Rat. It may be derived from a mammal including a rodent such as a mouse. For example, human Foxp3 (eg, GenBank Access i on No. NP_001107849. 1 (gene (mRNA): NM_001114377. 1), NP_054728.2 (gene (mRNA):
  • Foxp3 is not intended to be one that comprises an amino acid sequence (MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPP SQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPHFMHQLSTVDAHAQTPVLQVRPLDNPAMISLPPPSA ATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPRSGTPRKDSNLLAAPQGSYPLLANGVCKWPGCEK VFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPSVASMD KSSCCIVATSTQGSVLPAWSAPREAPDGGLFAVRRHLWGSHGNSSFPEFFHNMDYFKYHNMRPPFTYATL I RffA LEAPERQRTLNE I I I YHWFTRiMFAYFRNHPATWKNA RHNLS within KCF VRVE ⁇ KGAVWT VDEFEFR
  • Dendritic cells are immune cells that make up the mammalian immune system. It functions as an antigen transducing cell.
  • Dendritic cells may be derived from mammals including humans, primates such as monkeys, rodents such as rats and mice. In one example. Mammal. for example. It may be derived (isolated) from blood (or blood cells) of a human (eg cancer patient).
  • Inhibitors of dendritic cells expressing Foxp3 may be administered (eg, in the patient's body). Blood and / or tumor tissue in vivo in cancer patients), biological samples isolated from the patient (eg. Isolated blood and / or tumor tissue)) may be selected from all agents capable of lowering, killing or eliminating dendritic cells expressing RwqC. for example.
  • the nanocarrier means a particle having a nano size (for example, l-1000 nm) capable of encapsulating or delivering the inhibitor, and the material may be a protein or a lipid. And other biocompatible or biodegradable polymers, and may be at least one selected from the group consisting of, and are not limited in shape.
  • CD8 (cluster of differentiation 8) is a transmembrane glycoprotein that acts as a co-receptor for T cell receptor (TCR). Binds to a major histocompatibility complex (MHC) molecule and is specific for a class I MHC protein.
  • CD8 may be derived from mammals including primates such as humans, monkeys, and rodents such as rats and mice.
  • human CD8 e.g. GenBaiik Accession No. NP_001139345.1 (gene (mRNA): NM_001145873.1) .NP_001759.3 (gene (mRNA): NM_001768.6) .NP_741969.1 (gene (mRNA): NMJL71827. 3), NP_001171571.1 (gene (mRNA ) : L001178100.1), NP_004922.1 (gene (mRNA): NM_004931.4) .NP_742099.1
  • NP_742100.1 gene (mRNA): NM—172102.3
  • NP_757362.1 gene (mRNA): NM_172213.3
  • T cells are a type of lymphocyte that govern antigen specific adaptive immunity.
  • Regulatory T cell is a group of T cells that regulate the immune system. It is known to maintain tolerance to autoantigens and to suppress autoimmune diseases.
  • 8+ T cells and (3) 8+ regulatory T cells are primates such as humans and monkeys. Rat. And may be derived from mammals, including rodents, such as mice. Mammal. for example. It may be derived (isolated) from the blood of a human (eg cancer patient).
  • Inhibitors of regulatory T cells expressing CD8 may be administered (in the patient's body).
  • At least one selected from the group consisting of inhibitors At least one selected from the group consisting of inhibitors. Or at least one selected from the group consisting of nanocarriers including the inhibitor, but is not limited thereto.
  • the nanocarrier may be nano-sized (eg, encapsulated or delivered). 1-1000ä) particles. Its material is protein. Lipid, and other biocompatible or biodegradable polymers may be one or more selected from the group consisting of, and the shape is not limited.
  • a patient is a primate, such as a human, monkey, or the like. Mammals, including rodents such as mice, rats, and the like, or cells or tissues isolated from the mammals (eg. blood. Blood cells. Tumor tissue).
  • the patient is a cancer patient or a cell or tissue (eg, isolated from a cancer patient). blood. Blood cells. Tumor tissue). for example.
  • the patient is in tumor tissue or blood Dendritic cells to express, regulatory I cells expressing 1) 8. Or both may be detected cancer patients.
  • a biological sample used for cancer diagnosis is a cell isolated from a patient (a mammal selected from humans, primates such as monkeys, rodents such as mice and rats). group. Body fluids (eg blood. Blood cells, tumor tissues, etc.), and the like.
  • Cancers to which the treatment and / or diagnosis of the present invention are applicable may be selected from all solid and hematological cancers.
  • the cancer may be squamous cell carcinoma, lung cancer (eg small cell lung cancer, non-small cell lung cancer. Lung adenocarcinoma. Squamous cell carcinoma of lung), peritoneal cancer, skin cancer, rectal cancer, anal muscle cancer, esophageal cancer, small intestine cancer. Endocrine adenocarcinoma, parathyroid cancer.
  • Adrenal cancer soft tissue sarcoma.
  • Urethral cancer chronic or acute leukemia. Lymphoma, Liver Cancer. Stomach cancer. Pancreatic cancer. Cervical cancer. Ovarian Cancer. Bladder cancer. Breast cancer. Colon cancer. Colorectal cancer. Endometrial cancer. Uterine cancer. Salivary gland cancer. Prostate cancer, vulvar cancer, thyroid cancer. Head and neck cancer, brain cancer. Osteosarcoma. But may be one or more selected from the group consisting of. It is not limited to this. In one example. The cancer is colon cancer. Stomach cancer. Lung cancer. Pancreatic cancer. Solid cancers such as breast cancer. And / or lymphoma. Blood cancer, such as leukemia. The cancer may be primary or metastatic cancer.
  • Cancer treatment herein is not only an effect of inhibiting the growth of cancer cells or killing (eliminating) cancer cells. Cancer cell migration (111 1-8) 11, It also includes the effects of inhibiting invas ions, metastases is, etc., thereby aggravating cancer.
  • the detectable preparation of dendritic cells expressing Foxp3 may be selected from all compounds (e.g., small molecule compounds, antibodies, etc.) capable of specifically binding to dendritic cells expressing Foxp3. for example.
  • Small molecule compounds that specifically bind to Foxp3 in dendritic cells one or more selected from antibodies and small molecule compounds, antibodies, or these (antibodies and / or small molecule compounds) that specifically bind to surface proteins of dendritic cells expressing Foxp3 It may be a combination of one or more selected from nanocarriers including). .
  • the detectable agent of regulatory T cells expressing CD8 may be selected from all compounds capable of specifically binding to regulatory T cells expressing CD8 (eg, small molecule compounds. Antibodies, nanocarriers, etc.). For example, small molecule compounds that specifically bind to surface proteins of CD8 regulatory T cells. May be one or more combinations selected from among antibodies. .
  • the detectable agent of regulatory T cells expressing CD8 may be labeled with a conventional labeling substance detectable by conventional methods (eg, enzymatic reactions, fluorescence and / or radiation detection, etc.).
  • the labeling substance may be a fluorescent substance (eg, a fluorescent chemical dye, a fluorescent protein, etc.).
  • Luminescent material It may be one or more selected from the group consisting of radioisotopes. It is not limited to this.
  • detection of dendritic cells expressing Foxp3 and / or detection of regulatory T cells expressing CD8 is performed by flow cytometry (F1 V cytometry). F luorescence-act ivated ce l sor t ing. Immunochromatography
  • Dendritic cells expressing Foxp3 in a tumor or tumor environment (such as the blood of a cancer patient) and / or the use thereof as a cancer diagnostic marker and / or cancer treatment target of ⁇ 8 + Tregs are provided, which are used to diagnose cancer, Therapeutic and anticancer drugs research. It can be usefully applied to various fields such as prognosis monitoring after chemotherapy.
  • 1 is a graph showing the ratio (% of fxDC / CDllc + DC) of Foxp3 expressing dendritic cells (fxDC) in the blood of a tumor mouse model during tumor growth (Paired one-way ANOVA without multiple comparison correction).
  • FIG. 2B is a graph showing the distribution of fxDC in the blood of various mouse tumor models (EL4; lymphoma. B16; me 1 anoma, LLC; Lewis lung carcinoma. 266-6; pancreatic cancer. CT-26; colon cancer, 4T_1; breast cancer,
  • RENCA renal cancer
  • 77 5 to 7 mice per tumor mode 1, unpaired one-way ANOVA without multiple-comparisons correction).
  • Figure 3 is a result showing the distribution of FxDCs in the blood of dendritic cell-specific Foxp3 removal mice (CDllc-Cre x Foxp3 fl / fl : Foxp3 cK0 mice) and f loxed 1 it ter mates.
  • FIG. 6 is a graph showing tumor volume changes of various solid cancers in WT mice and Foxp3 cK0 mice.
  • Figure 9 shows the results of CTLA4 cytotoxic T-1 ymphocy te ⁇ as soc iated protein 4) expression levels in CD8 + T cells in tumor tissues of ffT mice and Foxp3 cK0 mice.
  • CTLA4 + (3) 8 + T cells CD8 + T cells in tumor tissues of wild type mice and Foxp3 cK0 mice (unpaired one-tai led test. ? ⁇ 0.01 and ⁇ ; ⁇ 0.001).
  • FIG. 11 is a graph showing CTL activity targeting tumor cells (EL4) of CTLA4 + + 8 + T cells and CTLA4 (3) 8 + T cells isolated from EL4 tumors (unpaired one-tailed i to test).
  • Figure 12 shows the results of Foxp3 + CD8 + Tregs distribution after co-culture of fxDC and CD8 + T cells (unpaired one-tailed f ⁇ test).
  • Figure 13 confirms the CD4 / 8 Treg inducibility of fxDC and foxp3 removed a.
  • Pre-act i vat ed T cells of Foxp3 GFP mice were co-cul tured with splenic DCs (spDC), blood DCs (bDC) and fxDC-depleted (DT-treatecl) bDCs (bDC / DT) of TB Foxp3 DTR mice ( p3 / F for b-DCs), and examined the population of Foxp3 + CD4 + and CD8 + T cells.
  • £ 3. unpaired two-way AN0VA with multiple comparisons.
  • 14 is a graph showing the ratio of fxDC and (3) 8 + Tregs cells in the blood of TB ' mice.
  • FIG. 15 shows the results of CD4 + / VIII + Treg distribution in wild-type and Foxp3 cK0 mouse tumor tissues (unpaired two-way AN0M with multiple comparisons).
  • Figure 17 shows the results of IFN-ga_a + T cell levels after co-culture of T cells and CD8 + / CD4 + Treg cells (unpaired one-way ANOVA with mu 11 ip 1 e- compar i sons correct ion. * P ⁇ 0.05. /) ⁇ 0.01).
  • FIG. 18 shows the results of CTLA4 expressing T cell levels after co-culture of CD8 + Tregs with ⁇ 8 + T cells (unpaired one-tai led i-test. * JJ ⁇ 0.05
  • 19 is the wild-type (3) 8 + T cells to the DT- treated tu-CD8 + T- cells or PBS- treated tu- ⁇ 8 + T- cells and the ball was measured ⁇ CTLA4 + 8 + T cell levels after culture result (, F3. Unpaired one-tai led i—test).
  • C57BL6_Foxp3 GFP Foxp3-GFP reporter mouse expressing Foxp3-green fluorescent protein (GFP) fusion protein in Foxp3 + cells
  • C57BL6-Foxp3 * dephtheria toxin receptor (dephtheria toxin) in place of Foxp3-encoding exon under the control of the Foxp3 promoter receptor
  • C57BL6-Foxp3 DTR_GFP C57BL6-Foxp3 DTR mice were produced by backcrossing with C57BL6_Foxp3 GFP mice for 3 generations).
  • C57BL6-Foxp3-f loxed Foxp3 fl / fl ).
  • CDllc-Foxp3 cK0 C57BL6-Foxp3 cK0 mice made by crossing CDllc-cre and Foxp3 fl / fl mice).
  • mice C57BL6-0T-1, Foxp3 GFP , Foxp.3 DTR . Ragl _ / . And CDllc-cre mice were purchased from the Jackson Laboratory (Bar Harbor, Sacramento. CA). Foxp8-f loxed (C57BL6-Foxp3 fl / fl ) mice were provided at "A. Rudensky. Memorial Sloan Kettering Cancer Center. NY". 2019/177200 1 »(: 1/10 ⁇ 018/005026
  • mice were maintained in SPF (specific pathogen-free) animal care facilities (Sungkyunkwan University) according to ⁇ Inst itute ⁇ niversi ty Animal Care and Use guidelines '' and transferred to a separate animal care chamber for this experiment. Co-housing was used. DTR mice were treated with diphtheria toxin; as reported previously (Kim, J. et al. Cutting edge: depletion of Foxp3 + cel Is leads to induction of autoimmunity by specific ablation of regulatory T cel Is in genet ical ly targeted mice.J Immunol 183, 7631-7634. Do i: 10.4049 / ji niniuno 1.0804308 (2009) "and" Penaloza-MacMaster, P. et al.
  • CDllc + MHC + dendritic cells were isolated from blood or tumors of the DT treated mice. It was used for the following test.
  • EL4 C57BL / 6 mouse-derived lymphoma.
  • EG7 OVA-expressing EL4.
  • CC malignant tumor patients (glioblastoma (GBM, stages 3 and 4), colon cancer; CC.
  • Stage 2 ((X2). 3 (CC3)) according to a protocol approved by And human peripheral blood mononuclear cells (hPBMCs) from 4 (CC4)) and gastric cancer (GC.
  • Stage 2 (GC2), 3 (GC3) and 4 (GC4)) and healthy donors.
  • Wild type Ut mice mice (C57BL6. BALB / c) and genetically modified mice [C57BL6-Foxp3 GFP .
  • C57BL6_Foxp3 DTR mice
  • C57BL6-Foxp3 cK0 (Foxp3 il / fl x(3)lieere)]
  • EL4 / EG7 B16 / F10. LLC.
  • CT-26 Mouse tumor models were prepared by injecting 4T-1 and RENCA cells in amounts of 5 ⁇ 10 s cells.
  • TILs dendritic cells
  • PBMCs PBMCs of Foxp3 GFP mice. Because tumor size of Foxp3 cK0 mice was small, TILs isolated from 5-10 TB Foxp3 cK0 mice were pooled (indicated by p5 / E or plO / min) for a single test after normalization. MDSCs (myeloid derived suppressor cells) subsets
  • CD4 + Tregs, CD8 + Tregs, CTU4 + / CTLA4-T—cells and CCR2 + / CCR2 ⁇ cells were isolated from blood or tumor tissue of Foxp3 GFP mice using BD FACSAria TM II. All in vitro and adoptive transfer (AT) tests were performed after normalization of isolated cells.
  • FITC-labeled anti-mouse antibody [Ly6g (1A8). CDllc (N418). IA / IE (M5 / 114.15.2), CD3 (17A2) and B220 (RA3-6B2)] were obtained from Thermo Fisher-eBioscience (Waltham, MA. USA).
  • Anti-mouse CD 14 (Sal4-2) antibodies were obtained from Bio legend (San Diego. CA. USA).
  • Phycoerythr in (PE) -labeled anti-mouse Foxp3 Antibody 150D. Bio legend).
  • Anti-mouse zbtb46 antibody (U4-1374, BD biosciences. San Jose. CA, USA).
  • PE-labeled anti-mouse antibody [Ly6c (HK1.4). CDllc (N418). CD317 (BST2. 927). ki-67 (SolA15) and CD25 (PC61.5)] were obtained from Thermo Fisher-eBioscience. PerCP_Cy5.5- labeled anti-mouse antibody [CDllb. Gr-1 (RB6-8C5). CD44 (IM7), Foxp3 (FJK-16s), IA / IE, CDllc and CD25 (PC61.5)]. PE_Cy7-labeled anti-mouse antibody [CD4 (GK1.5). CD8a (53-6.7). F4 / 80 (BM8). CD16 / (3) 32 (93).
  • Foxp3 FJK-16s and CDllc (N418)].
  • APC_labeled anti-mouse antibody [CD3 (17A2), VII 14 (SA14-2). CD19 (1D3 / CD19). Foxp3 (FJK-16s).
  • CCR2 475301).
  • CTLA4 U10-4B9 and CD44 (IM7)] and Pacific blue-labeled anti-mouse antibody [CD4
  • CD3 (17A2) and CD62L (MEL-14)] were obtained from Thermo Fisher-eBioscience. All samples were also stained with isotype control antibodies. After washing, cells were analyzed by FACSCanto II (BD Biosciences. San Jose. CA, USA) and FACS DIVA software. Antibodies against Foxp3, IFN-gamma (XMG1.2), perforin and Granzyme B were obtained from Thermo Fisher-eBioscience. Intracellular staining was performed according to the manufacturer's protocol.
  • Mouse PBMCs and TILs tumor infiltrated leukocytes were isolated from tumors and blood of TB mice. Isolated cells were stained in cell staining buffer using appropriate antibodies. According to the detection channel of flow cytometry, the antibody panel was optimized and constructed for each gating strategy. Compensat ions were performed using single-stained U1 traComp eBeads (Affymetrix) or cells. For all channels. Positive and negative cells
  • FxDC gating was performed as follows: FVD + (Live cells). CD45 + , Lineage (CD3 / CD19 / CD14; T-cel Is. B-cells and Monocytes) — negat ive. CDllc + MHC 11 + and Foxp3 + . All phenotypic panels of fxDCs were carried out through the gating strategy as described above: FVD: Fixable Viability Dye.
  • T cells were isolated and purified from the spleen of TB Fopx3 GFP mice.
  • Spleens of TB Fopx3 GFP mouse mice are homogenized in RPMI medium, passed through 70 nylon cell strainer (BD Falcon), and then ACK lysis buffer
  • T cells were isolated by treatment with (Lonza). The isolated T cells were purified using mouse (3) 4 and CD8 T-cel 1 Isolation Kit II (Mi lyiyi Biotech), 5. 6-car boxyf 1 uor esce in succinimidyi ester (CFSE) of ImM at 37 ° C. Molecular Probes) (at 1 mM for 10 min). Cell Trace Violet (CTV.
  • CFSE succinimidyi ester
  • CTV Cell Trace Violet
  • CFSE7CTV-labeled T cells were incubated with anti-CD3 / CD28 antibody (alpha-CD3 10 ⁇ g / nil. Alpha-CD28 4 / ig / ml) for 1 day, and then 5xl0 5 T cells with fxDCs or other DC subsets. Together co-cultured for 3 days at a ratio of 1: 5 (DC: T). Cell proliferation was measured by flow cytometry (see Reference Example 4).
  • Spleen 0T-1 T cells were prepared from 0T-1 mice when co-cultured with 0T-1 (ovalbuniin-speci ic. CD8 + T cells) T cells. Labeled as above. Without additional stimulation.
  • CFVII-labeled 5xl0 5 naive 0T_1 T-cells were isolated from Foxp3 DTR tumor mice and DT-treated (fxDC-depleted) bDCs. Or PBS-treated (fxDC-containing) bDC. Or sp-
  • M-MDSCs (lxlO 6 cel Is) isolated from the spleen or blood of TB FoxpSGFP mice using the MDSC Isolation Kit (Mi 1 tenyi Biotec, Bergisch Gladbach. Germany) or the control (tumor-free mice without tumors) TB mice were delivered via the tail vein (Adoptive transfer; AT). 3 days after AT. FxDC was analyzed in the recipient mice (recipient).
  • mice To perform AT of CD8 + T cells, spleens of tumor-free mice or 0T-1 mice, or blood from TB Foxp3 fl / fl and Foxp3 cko mice using the CD8 + T-cell isolation kit (Mi 1 tenyi Biotec) Or after separating the cells from the tumor tissue.
  • the isolated cells were labeled with CTV (lOuM) or DiD (lOuM) for 15 minutes at 37 ° C., and the labeled cells (lxlO 6 ) were delivered to mice by the method described above (AT).
  • FIG. 1 shows the results of monitoring fxDC populations in the blood of Foxp3 GFP mice during tumor growth.
  • Healthy donors heal thy donors; HD
  • cancer patients glioblastoma (GBM, stages 3 and 4), colorectal cancer; CC. Stage 2 (CC2), 3 CC3) and 4 (CC4)
  • gastric cancer GC, stage 2 (GC2), 3 (GC3) and 4 (GC4)
  • fxDC is, first, dendritic cell specific in removing, mouse Foxp3 expression
  • Tumor cells were administered to make tumor mice, and then fxDC in blood was measured (see Reference Examples 4 and 5). The obtained results are shown in Fig. 3.
  • Figure 3 the Foxp3 cK0 mouse CDllc-Cre x Foxp3 fl / fi.
  • fxDC is removed from the blood of Foxp3 cKQ mice.
  • Foxp.3 cK0 mice were injected with EL4 lymphoma tumor cel l (5xl0 5 cel I s), and tumor growth was monitored at intervals of 3 days after 7 days.
  • 4 is a graph showing tumor volume change. On the right is a graph showing tumor weight at 23 days after tumor transplantation. As shown in FIG. 4.
  • tumor size increased magnetically, whereas tumors grew slightly up to 17 days in Foxp3 cK0 mice without fxDC (see fxDC removal, see results in FIG. 3). You can see it disappears completely.
  • Foxp3 cK mice without fxDC were found to have increased the proportion of CD8 + T cells in the tumor to about 35.6%, which was greater than that of wild type mice (Foxp3 fl / fl ) (about 16.3%). Measuring the ratio of CD8 + T cells expressing IFN-gamnia (FN-ga_a + ⁇ 8 + T cells; cytotoxic (3) 8 + T cells) among (3) 8+ T cells in Foxp3 cKQ mouse tumor tissues without fxDC 7 is shown.
  • CTLA4 cytotoxi c T-lymphocyte-assocated protein
  • CTLA4 expression 8 + T cells in Donor T cells (DiD + CD8 + T cells) in tumor tissues after 3 days of adopt ive t ransfer (AT) (see Reference Example 8) through caudal vein in cK0 mice, respectively.
  • CTLA4 + (3) 8 + T cells was measured, and the results are shown in FIG. As shown in FIG. 10. In mice without fxDC, CTLA4 expression was significantly reduced in Donor ⁇ 8 + T cells.
  • CT To determine whether CTLA4 expression in 8 + T cells modulates the CTL response (cytotoxicity to tumor cells), which is the key to anticancer immunity.
  • CTL response cytotoxicity to tumor cells
  • EL4 tumor cells
  • fxDC induced by the tumor and the tumor environment may be Induces CD8 + Tregs (see Example 5 below) and inhibits the activity of CTLs in which these cells flock to remove tumors and is involved in the continued growth of tumors.
  • Deletion of fxDC shows that CTLA4 expression, which inhibits CTL activity, is reduced and tumor-specific CTL activity is not inhibited, thereby inducing effective anti-cancer immunity and thus significantly inhibiting tumor growth. So in tumor patients
  • fxDC The removal of fxDC is expected to induce effective anticancer immunity, resulting in superior cancer growth inhibitory effect and / or cancer treatment effect.
  • Example 4 Preparation of CD8 + Tregs by Co-Culture of fxDC and CD8 + T Cells
  • Wild-type normal mice were sc injected with EL4 tumor cells in an amount of 5 ⁇ 10 s cells. After 14 days, after separating PBMCs from the blood of the mice. Fill 1 ml of Ficol 1-Paque (GE healthcare. Cat. # 17-5442-02) into a 15 ml conical tube (Hyundai micro, Cat. # H20050), and do not mix the same amount of blood or buddy coat into the F i co 11 -Paque tube. Overlay it. Acceleration force of multipurpose centrifuge (Gyrozen, Cat. # 1580MGR) was set to 1.
  • Deceleration force was set to 0 and concentration gradient centrifugation was performed at 2500 rpm for 30 minutes. After centrifugation. The uppermost plasma and intermediate monocyte layer were separated, and CDllc + dendritic cells were separated from the isolated monocytes using ⁇ llc-Microbeads.
  • the cells were separated into single cells using a cell strainer, and all RBCs were removed from the isolated single cells using RBC lysis buffer.
  • Be 8 + T cells were isolated using microbeads.
  • the isolated ⁇ 8 + T cells were divided into 2.5 ⁇ 10 5 cells in a 96 well plate coated with VCD28.
  • Example 5 After dispensing dendritic cells isolated from blood prior to 96 well pi ate containing ⁇ 8 + T cells and co-cultured with CD8 + T cells for 3 days, (3) 8 + T cells were collected to perform Example 5 and below.
  • Example 6 Used for separation and analysis.
  • Example 6 Inhibition of T Cell Proliferation and Tumor Proliferation Promoting Effect of CD8 + Tregs
  • CD8 + Tregs induced by fxDC Spleen ⁇ 8 + T-cells after stimulation with anti-CD3 / 28 antibody.
  • ⁇ 8 + T cell proliferation and IFN-gamma + cells were measured (see Reference Examples 5 and 6).
  • Figure 16 shows the results of measuring the proliferation of CD4 + Tregs (tu-CD4 + Tregs) and CD8 + Tregs (tu_CD8 + Tregs) cells, T-treated with anti-CD3 / 28 antibody (pre-act ivated) Co-culture of cells with CD8 (3) 4 + Treg cells showed that ⁇ 8 + Treg inhibited T cell proliferation to a higher level than CD4 + Treg cells.
  • FIG. 17 shows the results of IFN-g ma + T cell levels in co-culture of anti-CD3 / 28 antibody pre-acted T cells and CD8 + / CD4 + Treg cells.
  • Levels of CTLs expressing IFN-gamma (_ 8 + IFN-ga_a + T cells) during co-culture of anti-CD3 / 28 antibody-treated T cells with CD8 ⁇ 4 + Treg cells Shows a decrease.
  • CTLA4 + (3) 8 + T cell levels in TB mice can be seen to be significantly reduced compared to wild type TB mice.
  • Wild type (3) 8 + T cells were labeled with DiD. After stimulation with anti-CD3 / 28 antibody.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Cell Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Mycology (AREA)
  • Urology & Nephrology (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Toxicology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Oncology (AREA)

Abstract

Foxp3(Forkhead box P3)를 발현하는 수지상 세포 및 CD8( cluster of differentiation 8)을 발현하는 조절 T 세포로 이루어진 군에서 선택된 1종 이상의 암치료 표적으로서의 용도 및 /또는 암진단 마커로서의 용도가 제공된다.

Description

【명세서】
【발명의 명칭】
Foxp3를 발현하는 수지상 세포의 암의 진단 또는 치료를 위한 용도 【기술분야】
Foxp3(Forkhead box P3)를 발현하는 수지상 세포 및 CD8(cluster of differentiation 8)을 발현하는 조절 T 세포로 이루어진 군에서 선택된 1종 이상의 암치료 표적으로서의 용도 및/또는 암진단 마커로서의 용도가 제공된다.
【배경기술】
수지상 세포 (Dendritic Cell. DC)는 포유 동물의 면역계에서 선천적 면역과 적응 면역 사이에 중요한 연결고리를 제공하는 항원제시세포 (APC)이다.
Foxp3 (Forkhead box P3)은 조절 T세포 (regulatory T cells； Treg)의 발달과 기능에 관여하는 것으로 알려진 전사조절인자이다 (Hori , S.. Nomura, T. & Sakaguchi , S. Control of regulatory T cell development by the transcription factor Foxp3. Science 299, 1057-1061. doi： 10.1126/science.1079490 (2003)).
그러나, 수지상 세포와 같은 T 세포 이외의 면역 세포에서의 Foxp3 발현 및 이의 의약적 유용성에 대하여 아직 알려진 바가 없다.
【발명의 상세한 설명】
【기술적 과제】
본 명세서에서는 암환자의 생체 내 (in vivo 예컨대. 혈액, 종양 조직 등)에서 Foxp3를 발현하는 수지상 세포를 확인하고， 이의 암의 진단 및/또는 치료 및/또는 항암치료 후 예후 모니터링을 위한 용도를 제공한다 일 예는 Foxp3를 발현하는 수지상 세포의 암 치료 타겟 및/또는 암 진단 마커로서의 용도를 제공한다.
다른 예는 Foxp3를 발현하는 수지상 세포의 저해제를 유효성분으로 포함하는 암 치료용 약학 조성물을 제공한다. 상기 암 치료용 약학 조성물은 종양 조직 또는 혈액에서 Foxi)3를 발현하는 수지상 세포가 검출된 암환자에게 투여하기 위한 것이 수 있다. 2019/177200 1»（：1^1{2018/005026
다른 예는 ?（예）3를 발현하.는 수지상 세포의 저해제의 암 치료에 사용하기 위한 용도를 제공한다. 상기 암 치료에 사용하기 위한 용도는 종양 조직 또는 혈액에서 1^0X93를 발현하는 수지상 세포가 검출된 암 환자에게 적용하기 위한 것일 수 있다.
다른 예는 [½ 3를 발현하는 수지상 세포의 저해제의 약학적 유효량을 암 환자에게 투여하는 단계를 포함하는. 암 치료 방법을 제공한다. 상기 암 환자는 종양 조직 또는 혈액에서 〔 ?3를 발현하는 수지상 세포가 검출된 암 환자일 수 있다.
다른 예는 1^0X93를 발현하는 수지상 세포의 저해제를 유효성분으로 포함하는
Figure imgf000003_0001
발현하는 조절 I 세포 （⑶ 8+ 打근요） 저해용 약학 조성물을 제공한다. 다른 예는 1^0X03를 발현하는 수지상 세포의 저해제의
Figure imgf000003_0002
발현하는 조절 세포 저해에 사용하기 위한 용도를 제공한다. 다른 예는 （ 1）3를 발현하는 수지상 세포의 저해제를 008을 발현하는 조절 1" 세포 저해를 필요로 하는 환자에게 투여하는 단계를 포함하는, 008을 발현하는 조절 I 세포 저해 방법을 제공한다. 상기 환자는 암환자. 예컨대, 종양 조직 또는 혈액에서
Figure imgf000003_0003
발현하는 수지상 세포가 검출된 암 환자일 수 있다.
다른 예는
Figure imgf000003_0004
발현하는 조절 I 세포 （抑 8+
Figure imgf000003_0005
암 치료 타겟으로서의 용도를 제공한다.
다른 예는 008을 발현하는 조절 I 세포의 저해제를 유효성분으로 포함하는 암 치료용 약학 조성물을 제공한다. 상기 암 치료용 약학 조성물은 종양 조직 또는 혈액에서
Figure imgf000003_0006
발현하는 조절 I 세포가 검출된 암 환자에게 투여하기 위한 것이 수 있다.
다른 예는
Figure imgf000003_0007
발현하는 조절 세포의 저해제의 암 치료에 사용하기 위한 용도를 제공한다. 상기 암 치료에 사용하기 위한 용도는 종양 조직 또는 혈액에서
Figure imgf000003_0008
발현하는 조절 I 세포가 검출된 암 환자에게 적용하기 위한'것일 수 있다.
다른
Figure imgf000003_0009
발현하는 조절 I 세포의 저해제의 약학적 유효량을 암 환자에게 투여하는 단계를 포함하는, 암 치료 방법을 제공한다. 상기 암 환자는 종양 조직 또는 혈액에서 발현하는 조절 I 세포가 검출된 2019/177200 1»（：1^1{2018/005026
암환자일 수 있다.
다른 예는 후보 화합물을 Foxp3를 발현하는 수지상 세포. 008을 발현하는 조절 I 세. 또는 이들 모두와 접촉시킨 후 이\?3를 발현하는 수지상 세포 및/또는 을 발현하는 조절 I 세포의 수준이 감소한 경우, 상기 후보 화합물을 항암제 후보 물질로 결정하는 단계를 포함하는, 항암제 스크리닝 방법을 제공한다.
다른 예는 ?（예）3를 발현하는 수지상 세포의 검출가능한 제제를 포함하는 암 진단 또는 암 예후 확인용 조성물을 제공한다. 다른 예는 환자로부터 분리된 생물학적 시료에서 1¾ ?3를 발현하는 수지상 세포를 검출하는 단계를 포함하는. 암 진단 또는 암 예후 확인 방법 또는 암 진단 또는 암 예후 확인에 정보를 제공하는 방법을 제공한다. 상기 암 진단 방법은. 상기 검출하는 단계 이후에 상기 생물학적 시료에서
Figure imgf000004_0001
발현하는 수지상 세포가 검출되는 경우 （존재하는 경우）. 상기 환자를 암 환자로 결정하는 단계. 또는 이재3를 발현하는 수지상 세포 수준 변화에 따라서 암의 진행 정도를 확인하는 단계를 추가로 포함할수 있다.
다른 예는 （«?3를 발현하는 수지상 세포와
Figure imgf000004_0002
발현하는 I 세포를 함께 배양하는 단계를 포함하는 008를 발현하는 조절 I 세포 （〔08+ 요）의 제조 방법을 제공한다.
다른 예는的\?3를 발현하는 수자상 세포와
Figure imgf000004_0003
발현하는 I 세포를 공배양하여 생성된 008+
Figure imgf000004_0004
면역 억제 및/또는 자가면역질환 또는 이삭거부의 예방및/또는 치료에 사용하기 위한 용도를 제공한다. 상기⑶ 8+ 는 앞서 설명한⑶ 8+ 의 제조 방법에 의하여 제조된 것일 수 있다. 다른 예는 상기 제조 방법에 의하여 제조된 ⑶ 8+ 용를 유효성분으로 포함하는 면역 억제제 또는 자가면역질환 또는 이식거부의 예방 및/또는 치료용 조성물을 제공한다. 다른 예는 상기 제조 방법에 의하여 제조된 抑 8+ 요를 면역 억제 또는 자가면역질환 또는 이식거부의 예방 및/또는 치료를 필요로 하는 개체에 투여하는 단계를 포함하는 면역 억제 방법 또는 자가면역질환또는 이식거부의 예방 및/또는 치료 방법을 제공한다.
【기술적 해결방법】
본 명세서는 종양 및 종양 환경에서 0¾）3를 발현하는 수지상 세포가 2019/177200
유도되고, 이로 인하여 종양 내
Figure imgf000005_0001
유도되며 , 이들 세포의 유도에 의하여 종양을 제거하기 위해 몰려드는 1의 활성이 억제되어 종양이 지속적으호 성장하게 되고. （«?3를 발현하는 수지상 세포를 제거할 경우 （：孔 활성을 억제하는 1쇼4 발현이 감소하여 종양특이적 （：孔 활성이 억제되지 않아서 효과적인 항암면역을 유도하고 종양성장을 현저하게 저해할 수 있음을 확인하여. 的 ?3를 발현하는 수지상 세포의 암 진단 및/또는 치료에 있어서의 용도와 的 ?3를 발현하는 수지상 세포를 제거함으로써 암을 치료하는 기술을 제안한다.
이에. 일 예는 1¾ 3를 발현하는 수지상 세포의 암 치료 타겟으로서의 용도를 제공한다.
다른 예는 0 ?3를 발현하는 수지상 세포의 저해제를 유효성분으로 포함하는 암 치료용 약학 조성물을 제공한다. 상기
Figure imgf000005_0002
발현하는 수지상 세포는 암 환자의 종양 조직 또는 혈액에 존재하는 것일 수 있으며. 상기 암 치료용 약학 조성물은 종양 조직 또는 혈액에서
Figure imgf000005_0003
발현하는 수지상 세포가 검출된 암 환자에게 투여하기 위한 것이 수 있다.
， 다른 예는 에03를 발현하는 수지상 세포의 저해제의 암 치료에 사용하기 위한 용도를 제공한다. 상기 암 치료에 사용하기 위한 용도는 종양 조직 또는 혈액에서
Figure imgf000005_0004
발현하는 수지상 세포가 검출된 암 환자에게 적용하기 위한 것일 수 있다.
다른 예는 1¾ 1）3를 발현하는 수지상 세포의 저해제의 약학적 유효량을 암 환자에게 투여하거나, 상기 환자（예컨대， 환자의 혈액 및/또는 종양조직 등）로부터 ?（ ?3를 발현하는 수지상 세포를 제거하는 단계를 포함하는, 암 치료 방법을 제공한다. 상기 암 환자는 종.양 조직 또는 혈액에서
Figure imgf000005_0005
발현하는 수지상 세포가 검출된 암 환자일 수 있다.
다른 예는
Figure imgf000005_0006
발현하는 수지상 세포의 저해제를 유효성분으로 포함하는
Figure imgf000005_0007
발현하는 조절 I 세포 ᄄ08+ 1>6용） 저해용 약학 조성물을 제공한다. 다른 예는 {^0X9,3를 발현하는 수지상 세포의 저해제의 〔08을 발현하는 조절 I 세포 저해에 사용하기 위한 용도를 제공한다. 다른 예는 예3를 발현하는 수지상 세포의 저해제를
Figure imgf000005_0008
발현하는 조절 I 세포 저해를 필요로 하는 환자에게 투여하거나. 상기 환자（예컨대, 환자의 혈액 2019/177200 1»（：1^1{2018/005026
및/또는 종양조직 등）로부터 （«1）3룰 발현하는 수지상 세포를 제거하는 단계를 포함하는.
Figure imgf000006_0001
저해 방법을 제공한다. 상기
Figure imgf000006_0002
발현하는 조절 1 세포는 Foxp3를 발현하는 수지상 세포에 의하여 암 환자의 혈액내에서 유도되는 것일 수 있다. 상기 환자는 암환자, 예컨대. 종양 조직 또는 혈액에서 0\03를 발현하는 수지상 세포가 검줄된 암 환자 또는 종양 조직 또는 혈액에서
Figure imgf000006_0004
발현하는 수지상 세포에 의하여
Figure imgf000006_0003
발현하는조절 I세포가 유도된 환자일 수 있다.
다른 예는
Figure imgf000006_0005
발현하는 조절 I 세포 0 8+ ）의 암 치료 타겟으로서의 용도를 제공한다.
다른 예는
Figure imgf000006_0006
발현하는 조절 I 세포의 저해제를 유효성분으로 포함하는 암 치료용 약학 조성물을 제공한다. 상기 암 치료용 약학 조성물은 종양 조직 또는 혈액에서 008을 발현하는 조절 I 세포가 검출된 암환자에게 투여하기 위한 것일 수 있다.
다른 예는
Figure imgf000006_0007
발현하는 조절 I 세포의 저해제의 암 치료에 사용하기 위한 용도를 제공한다. 상기 암 치료에 사용하기 위한 용도는 종양 조직 또는 혈액에서
Figure imgf000006_0008
발현하는 조절 I 세포가 검출된 암 환자에게 적용하기 위한 것일 수 있다.
다른
Figure imgf000006_0009
발현하는 조절 I 세포의 저해제의 약학적 유효량을 암 환자에게 투여하거나 상기 환자（예컨대, 환자의 혈액 및/또는 종양조직 등）로부터
Figure imgf000006_0010
발현하는 조절 I 세포를 제거하는 단계를 포함하는. 암 치료 방법을 제공한다. 상기 암 환자는 종양 조직 또는 혈액에서 0 8을 발현하는 조절 I세포가 검출된 암환자일 수 있다.
다른 예는 후보 화합물을 ?切 3를 발현하는 수지상 세포. 008
Figure imgf000006_0011
발현하는 조절 I 세포, 또는 이들 모두와 접촉시킨 후 {^0X1）3를 발현하는 수지상 세포
Figure imgf000006_0012
발현하는 조절 I 세포의 수준이 감소한 경우. 상기 후보 화합물을 항암제 후보 물질로 결정하는 단계를 포함하는. 항암제 스크리닝 방법을 제공한다. 구제적으로. 상기 스크리닝 방법은, （1） 후보 화합물을 예）3를 발현하는 수지상 세포. 008을 발현하는 조절 I 세포. 이들 모두, 또는 이들을 포함하는 생물학적 시료 （예컨대. 혈액. 혈구. 종양 조직 등）와 접촉시키는 단계; 및 （2） （예）3를 발현하는 수지상 세포 2019/177200 1»（：1^1{2018/005026
및/또는
Figure imgf000007_0001
발현하는 조절 I 세포의 수준을 측정하는 단계를 포함할 수 있다. 상기 항암제 스크리닝 방법은, 상기 단계 (2) 이후에 . 단계 (2)에서 측정된 的\?3를 발현하는 수지상 세포 및/또는
Figure imgf000007_0002
발현하는 조절 I 세포의 수준을 후보 화합물 처리 전의 (예)3를 발현하는 수지상 세포
Figure imgf000007_0003
발현하는 조절 I 세포의 수준과 비교하는 단계 (단계 (3) )를 추가로 포함할 수 있다. 또한 상기 ·항암제 스크리닝 방법은 , 상기 단계 (2) 또는 단계 (3) 이후에, 단계 (2)에서 측정된 ( ?3를 발현하는 수지상 세포 및/또는
Figure imgf000007_0004
발현하는 조절 I 세포의 수준이 후보 화합물 처리 전의 («93를 발현하는 수지상 세포 및/또는
Figure imgf000007_0005
발현하는 조절 I 세포의 수준보다 감소한 경우， 상기 후보 화합물을 항암제 후보 물질로 결정하는 단계 (단계 (4) )를 추가로 포함할 수 있다. 상기 스크리닝 방법의 각 단계는 생체 외 ( 111 0)에서 진행되는 것일 수 있다. 또한. 상기 이 3를 발현하는 수지상 세포 및/또는
Figure imgf000007_0006
발현하는 조절 I 세포는 생체로부터 분리된 세포일 수 있다.
다른 예는 ?3를 발현하는 수지상 세포의 검출가능한 제제를 포함하는 암 진단용 조성물을 제공한다. 다른 예는 환자로부터 분리된 생물학적 시료에서
Figure imgf000007_0007
발현하는 수지상 세포를 검출하는 단계를 포함하는, 암의 진단 또는 예후 확인 방법 또는 암의 진단 또는 예후 확인에 정보를 제공하는 방법을 제공한다. 상기 암의 진단 또는 예후 확인 방법은, 상기 검출하는 단계 이후에 상기 생물학적 시료에서 ¾ 03를 발현하는 수지상 세포가 검출되는 경우 (존재하는 경우) , 상기 환자를 암 환자로 결정하는 단계, 또는 1^0X93를 발현하는 수지상 세포 수준 변화에 따라서 암의 진행 정도를 확인 하는 단계를 추가로 포함할 수 있다. 상기 암 진단 방법에 있어서. 생물학적 시료는 암의 발생 후 예후를 추정의 추정 확인을 필요로 하는 인간 등의 포유 동물로부터 분리된 혈액. 혈구 등을 포함하는 것일 수 있다. 일 예에서. 상기 암 진단 방법은, 상기 암 환자로 결정하는 단계 이후에. 상기 암환자로 결정된 환자에게 (에)3를 발현하는 수지상 세포 저해제 및
Figure imgf000007_0008
발현하는 조절 I 세포 저해제로 이루어진 군에서 선택된 1종 이상의 약학적 유효량을 투여하는 단계를 추가로 포함할 수 있다. 2019/177200 1»（：1^1{2018/005026
상기 암의 예후 확인 방법에 있어서. 생물학적 시료는 암의 예후 （진행 상태）를 확인 （모니터링）하고자 하는 암 환자로부터 분리된 혈액. 혈구. 종양 조직 등으로 이루어진 군에서 선택된 1종 이상일 수 있다. 상기 암의 예후 확인 방법에서. 암 환자에서 분리된 생물학적 시료에서의 발현하는 수지상 세포 수준을 서로 다른 2 이상의 시점에서 즉정하여, 어느 한 시점에서
Figure imgf000008_0001
발현하는 수지상 세포 수준이 이전 시점에서 측정된 수준보다 높은 경우, 상기 암 환자에서 암이 악화되거나 암 진행이 빨라지고 있는 것으로 확인할 수 있으며, 어느 한 시점에서 측정한 ?이' 3를 발현하는 수지상 세포 수준이 이전 시점에서 ' 측정된 수준보다 낮은 경우， 상기 암 환자에서 암이 완화되거나 암 진행이 느려지고 있는 것으로 확인할 수 있다. 상기 암 예후 확인 방법은. （1） 암 환자에서 분리된 생물학적 시료에’서의 이 3를 발현하는 수지상 세포 수준을 서로 다른 2 이상의 시점에서 측정하는 단계, 및 （2） 어느 한 시점에서 즉정한 Foxp3를 발현하는 수지상 세포 수준이 이전 시점에서 측정된 수준보다 높은 경우, 상기 암 환자에서 암이 악화되거나 암 진행이 빨라지고 있는 것으로 확인하거나, 어느 한 시점에서 측정한 때3를 발현하는 수지상 세포 수준이 이전 시점에서 즉정된 수준보다 낮은 경우, 상기 암 환자에서 암이 완화되거나 암 진행이 느려지고 있는 것으로 확인하는 단계를 포함하는 것일 수 있다.
상기 암 예후의 확인 방법은 항암 치료 （예컨대. 항암제 투여） 중인 암 환자에서의 항암 치료 효능 모니터링（항암치료 후 예후 모니터링）에 적용될 수 있다. 이에. 본 발명의 다른
Figure imgf000008_0002
발현하는 수지상 세포의 검출 가능한 제제를 포함하는 항암 치료 효능 확인（모니터링）용 조성물을 제공한다. 다른 예는 환자로부터 분리된 생물학적 시료에서 1¾ 93를 발현하는 수지상 세포를 검출하는 단계를 포함하는, 항암 치료 효능 확인（모니터링） 방법 또는 항암 치료 효능 확인（모니터링）에 정보를 제공하는 방법을 제공한다. 상기 항암 치료 효능 확인（모니터링） 방법에 있어서 . 상기 환자는 항암 치료를 받은 환자일 수 있고. 상기 항암 치료는 항암제 투여와 같은 화학적 요법 . 유전자 치료 생물학적 요법 . 방사선 치료 등의 물리학적 요법, 외과적 수술 등으로 이루어진 모든 통상적인 항암 2019/177200 1»（：1^1{2018/005026
치료 중에서 선택된 하나 또는 두 가지 이상의 복합 요법일 수 있으며, 생물학적 시료는 항암 치료 효능을 확인하고자 하는 암 환자로부터 분리된 혈액. 혈구. 종양 조직 등으로 이루어진 군에서 선택된 1종 이상일 수 있다. 상기 항암 치료 효능 확인 방법에서. 항암 치료받은 암 환자에서 분리된 생물학적 시료에서의 （ ?3를 발현하는 수지상 세포 수준을 측정하여. 상기 항암 치료를 받기 전보다 증가한 경우. 상기 항암 치료가 상기 암 환자에서 항암 효과가 없는 것으로 확인할 수 있으며. 상기 항암 치료를 받기 전보다 감소한 경우, 상기 항암 치료가 상기 암 환자에서 항암 효과가 있는 것으로 확인할 수 있다. 상기 항암 치료 효능 확인 방법은. （1） 암 환자에서 분리된 생물학적 시료에서의 的 ?3를 발현하는 수지상 세포 수준을 상기 암 환자에 항암 치료를 하기 전과 후에 측정하는 단계 . 및 （2） 항암 치료 후에 측정한 1¾ ?3를 발현하는 수지상 세포 수준이 항암 치료 전에 측정된 수준보다 높은 경우, 상기 항암 치료가 상기 암 환자에서 효과가 없는 것으로 확인하거나. 항암 치료 후에 측정한
Figure imgf000009_0001
발현하는 수지상 세포 수준이 항암 치료 전에 측정된 수준보다 낮은 경우, 상기 항암 치료가 상기 암 환자에서 효과가 있는 것으로 확인하는 단계를 포함하는 것일 수 있다. 상기 ?이\133를 발현하는 수지상 세포 수준을 즉정하는 시기로서의 "항암 치료 후"는 항암 치료 직후부터 2개월까지의 기간 （예컨대. 항암치료 직후 내지 8주일 . 항암치료 직후 내지 7주일. 항암치료 직후 내지 6주일 . 항암치료 직후 내지 5주일. 항암치료 직후 내지 4주일. 항암치료 직후 내지 3주일. 항암치료 직후 내지 2주일. 또는 항암치료 직후 내지 1주일） 중에서 하나 이상 선택된 임의의 시점일 수 있다. 상기 항암 치료 효능 확인 방법은. 상기 단계 （3） 이후에, （4） 항암 치료 후에 측정한 （예）3룰 발현하는 수지상 세포 수준이 항암 치료 전에 측정된 수준보다 높은 경우 （상기 항암 치료가 상기 암 환자에서 효과가 없는 것으로 확인되는 경우）. 상기 암 환자에 항암 치료를 중단하거나 다른 항암 치료를 적용하거나. 항암 치료 후에 측정한 0재3를 발현하는 수지상 세포 수준이 항암 치료 전에 측정된 수준보다 낮은 경우 （상기 항암 치료가 상기 암 환자에서 효과가 있는 것으로 확인되는 경우:）, 상기 항암 치료를 유지하거나 강화하는 단계를 추가로 포함할 수 있다. 상기 항암 효과는 암 세포 사멸 2019/177200 1 11012018/005026
또는 증식 억제. 암 조직 소멸 또는 크기 감소. 암 전이 억제 등의 암의 증상을 제거 또는 완화（호전）시키는
Figure imgf000010_0001
있다.
다른 예는 ?이\?3를 발현하는 수지상
Figure imgf000010_0002
발현하는 I세포를 함께 배양하는.단계를 포함하는 008을 발현하는 조절 I세포 （⑶ 8+ 1>6당）의 제조 방법을 제공한다. 상기 배양하는 단계는 （에）3를 발현하는 수지상 세포와 발현하는 I세포를. 세포 수 기준으로, 1:0.1 내지 10, 1:0.1 내지 8, 1:0.1 내지 6, 1:0.1 내지 4, 1:0.1 내지 2. 1:0.1 내지 1. 1:0.3 내지 10, 1:0.3 내지 8. 1:0.3 내지 6, 1:0.3 내지 4, 1:0.3 내지 2, 1:0.3 내지 1. 1:0.5 내지 10. 1:0.5 내지 8, 1:0.5 내지 6. 1:0.5 내지 4, 1:0.5 내지 2, 1:0.5 내지 1, 1:0.8 내지 10， 1:0.8 내지 8, 1:0.8 내지 6. 1:0.8 내지 4, 1:0.8 내지 2. 1:0.8 내지 1, 1:1 내지 10. 1:1 내지 8. 1:1 내지 6， 1:1 내지 4, 또는 1:1 내지 2（的지）3를 발현하는 수지상 세포의
Figure imgf000010_0003
발현하는 I세포의 수）의 비율로 함께 배양하여 수행될 수 있다.
다른 예는 상기 （^3를 발현하는 수지상 세포와
Figure imgf000010_0004
발현하는 I 세포를 공배양하여 생성된 008을 발현하는 조절 I 세포를 제공한다. 상기 〔08을 발현하는 조절 I 세포는 앞서 설명한
Figure imgf000010_0005
발현하는 조절I 세포의 제조 방법에 의하여 제조된 것일 수 있다.
다른 예는 （«?3를 발현하는 수지상 세포와 008을 발현하는 I세포를 공배양하여 생성된
Figure imgf000010_0006
발현하는 조절 I 세포의 면역 억제 및/또는 자가면역질환 또는 이식거부의 예방 및/또는 치료에 사용하기 위한 용도를 제공한다. 상기
Figure imgf000010_0007
발현하는 조절 I 세포는 앞서 설명한
Figure imgf000010_0008
발현하는 조절 T 세포의 제조 방법에 의하여 제조된 것일 수 있다. 다른 예는 상기 제조 방법에 의하여 제조된
Figure imgf000010_0009
발현하는 조절 세포를 유효성분으로 포함하는 면역 억제제 또는 자가면역질환 또는 이식거부의 예방 및/또는 치료용 조성물을 제공한다. 다른 예는 상기 제조 방법에 의하여 제조된
Figure imgf000010_0010
발현하는 조절 I세포를 면역 억제 또는 자가면역질환 또는 이식거부의 예방 및/또는 치료를 필요로 하는 개체에 투여하는 단계를 포함하는 면역 억제 방법 또는 자가면역질환 또는 이식거부의 예방 및/또는 치료 방법을 제공한다. 상기 자가면역질환은 류마티즘. 루프스병. 자가면역성 간염 , 자가면역성 용혈성 질환 등에서 선택된 것일 수 있다. 이하. 본 발명을 보다 상세히 설명한다.
Foxp3 （Forkhead box P3 , scur f in라고도 불림）은 면역계 반응에 관여하는 단백질로서. 조절 T 세포의 발달 및 기능의 조절 경로의 주요 조절 인자로서 기능을 한다. Foxp3는 인간, 원숭이 등의 영장류. 래트. 마우스 등의 설치류를 포함하는 포유 동물에서 유래하는 것일 수 있으며. 예컨대, 인간 Foxp3 （예컨대, GenBank Access i on No . NP_001107849. 1 （유전자 （mRNA） : NM_001114377. 1）, NP_054728.2 （유전자 （mRNA） :
NM-014009.3） 등）. 마우스 Foxp3 （예컨대, GenBank Access i on No . NP_001186276. 1 （유전자 （mRNA）: NM_001199347. 1） . NP_001186277. 1 （유전자 （mRNA） : ■一 001199348. 1）, NP_473380. 1 （유전자 （mRNA）： NM_054039.2） 등）일 수 있다. 일 예에서. Foxp3는 서열번호 1의 아미노산 서열（ MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPP SQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPHFMHQLSTVDAHAQTPVLQVRPLDNPAMISLPPPSA ATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPRSGTPRKDSNLLAAPQGSYPLLANGVCKWPGCEK VFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPSVASMD KSSCCIVATSTQGSVLPAWSAPREAPDGGLFAVRRHLWGSHGNSSFPEFFHNMDYFKYHNMRPPFTYATL I RffA I LEAPERQRTLNE I YHWFTRiMFAYFRNHPATWKNA I RHNLS내 KCF VRVE況 KGAVWT VDEFEFRK KRSQRPNKCSNPCP）을 포함하는 것일 수 있으나, 이에 제한되는 것은 아니다. 수지상 세포 （dendr i t i c ce l l； DC）는 포유류의 면역계를 구성하는 면역 세포로. 항원전달세포로서 기능한다. 본 명세서에서. 수지상 세포는 인간, 원숭이 등의 영장류, 래트, 마우스 등의 설치류를 포함하는 포유 동물에서 유래하는 것일 수 있으며. 일 예에서. 포유 동물. 예컨대. 인간 （예컨대, 암 환자）의 혈액（또는 혈구）에서 유래（분리）된 것일 수 있다.
Foxp3를 발현하는 수지상 세포의 저해제는 투여 대상 （환자의 체내 （예컨대. 암 환자 생체 내 혈액 및/또는 종양 조직）, 환자로부터 분리된 생물학적 시료 （예컨대. 분리된 혈액 및/또는 종양 조직））에서 RwqC를 발현하는 수지상 세포의 수준을 낮추거나, 사멸시키거나, 제거할 수 있는 모든 제제들 중에서 선택될 수 있으며. 예컨대. R）xp3를 발현하는 수지상 세포에 특이적인 항체 . 세포독성 약물（cytotox i c drugs） , 항체-세포독성 약물 접합체 . 항체-자성입자 복합체 등으로 이루어진 군에서 선택된 1종 이상이 저해제. 또는 상기 저해제를 포함하는 나노전달체 (nano delivery system)등으로 이루어진 군에서 선택된 1종 이상일 수 있으나, 이에 제한되는 것은 아니다. 상기 나노전달체는 상기 저해제를 봉입 또는 전달할 수 있는 나노 크기 (예컨대, l-1000nm)의 입자를 의미하는 것으로, 그 재질은 단백질, 지질. 및 그 외의 생체적합성 또는 생분해성 고분자로 이루어진 군에서 선택된 1종 이상일 수 있고, 모양에는 제한이 없다.
CD8 (cluster of differentiation 8)은 T 세포 수용체 (T cell receptor； TCR)에 대하여 co-receptor 역할을 하는 막통과 당단백질로서. MHC (major histocompatibility complex) 분자에 결합하고, class I MHC 단백질에 특이적이다. CD8은 인간, 원숭이 등의 영장류， 래트, 마우스 등의 설치류를 포함하는 포유 동물에서 유래하는 것일 수 있으며. 예컨대, 인간 CD8 (예컨대 . GenBaiik Accession No. NP_001139345.1 (유전자 (mRNA) : NM_001145873.1). NP_001759.3 (유전자 (mRNA) : NM_001768.6) . NP_741969.1 (유전자 (mRNA) : NMJL71827.3), NP_001171571.1 (유전자 (mRNA) : ■L001178100.1), NP_004922.1 (유전자 (mRNA) : NM_004931.4) . NP_742099.1
(유전자 (mRNA): NM-172101.3). NP_742100.1 (유전자 (mRNA): NM—172102.3) . NP_757362.1 (유전자 (mRNA)： NM_172213.3) 등)일 수 있다.
T 세포는 항원특이적인 적응 면역을 주관하는 림프구의 일종이다. 조절 T 세포 (regulatory T cell； Treg)는 면역계를 조절하는 T 세포들 중 한 집단으로. 자가항원에 대한 관용을 유지하고 자가면역 질병을 억제하는 것으로 알려져 있다. 본 명세서에서 . ⑶ 8+ T 세포와 ⑶ 8+ 조절 T 세포는 인간, 원숭이 등의 영장류. 래트. 마우스 등의 설치류를 포함하는 포유 동물에서 유래하는 것일 수 있으며, 일 예에서. 포유 동물. 예컨대. 인간 (예컨대, 암환자)의 혈액에서 유래 (분리)된 것일 수 있다.
CD8을 발현하는 조절 T 세포의 저해제는 투여 대상 (환자의 체내
(예컨대. 암 환자 생체 내 혈액 및/또는 종양 조직). 환자로부터 분리된 생물학적 시료 (예컨대, 분리된 혈액 및/또는 종양 조직))에서 CD8을 발현하는 조절 T 세포의 수준을 낮추거나 제거할 수 있는 모든 제제들 중에서 선택될 수 있으며. 예컨대. CD8을 발현하는 조절 T 세포에 특이적인 항체 . 세포독성 약물. 항체-세포독성 약물 접합체 . 항체-자성입자 복합체 2019/177200 1»（：1^1{2018/005026
등으로 이루어진 군에서 선택된 1종 이상이 저해제 . 또는 상기 저해제를 포함하는 나노전달체 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나, 이에 제한되는 것은 아니다. 상기 나노전달체는 상기 저해제를 봉입 또는 전달할 수 있는 나노 크기 （예컨대. 1-1000ä）의 입자를 의미하는 것으로. 그 재질은 단백질. 지질， 및 그 외의 생체적합성 또는 생분해성 고분자로 이루어진 군에서 선택된 1종 이상일 수 있고, 모양에는 제한이 없다.
본 명세서에 사용된 바로서, 환자는 인간, 원숭이 등의 영장류. 마우스, 래트 등의 설치류 등을 포함하는 포유 동물, 또는 상기 포유 동물로부터 분리된 세포 또는 조직 （예컨대. 혈액. 혈구. 종양 조직）일 수 있다. 일 예에서, 상기 환자는 암 환자 또는 암 환자로부터 분리된 세포 또는 조직 （예컨대. 혈액. 혈구. 종양 조직）일 수 있다. 예컨대. 상기 환자는 종양 조직 또는 혈액에서
Figure imgf000013_0001
발현하는 수지상 세포,  1）8을 발현하는 조절 I세포. 또는 이들 모두가 검출된 암환자일 수 있다.
또한. 암 진단에 사용되는 생물 시료는 환자（인간, 원숭이 등의 영장류, 마우스, 래트 등의 설치류 등을 포함하는 포유 동물 중에서 선택）로부터 분리된 세포. 조직. 체액 （예컨대， 혈액. 혈구, 종양 조직 등） 등일 수 있다.
본 발명의 치료 및/또는 진단의 적용이 가능한 암은 모든 고형암 및 혈액암 중에서 선택될 수 있다. 예컨대 , 상기 암은 편평상피세포암, 폐암 （예컨대, 소세포폐암, 비소세포폐암. 폐선암. 폐의 편평상피암 등）, 복막암， 피부암， 직장암， 항문부근암, 식도암, 소장암. 내분비선암, 부갑상선암.
（ 부신암, 연조직 육종. 요도암, 만성 또는 급성 백혈병. 림프종, 간암. 위암. 췌장암. 경부암. 난소암. 방광암. 유방암. 결장암. 대장암. 자궁내막암. 자궁암. 침샘암. 전립선암, 음문암, 갑상선암. 두경부암, 뇌암. 골육종. 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나. 이에 제한되는 것은 아니다. 일 예에서. 상기 암은 대장암. 위암. 폐암. 췌장암. 유방암 등의 고형암. 및/또는 림프종. 백혈병 등의 혈액암일 수 있다. 상기 암은 원발성 암또는 전이성 암일 수 있다.
본 명세서에의 암 치료는 암세포의 성장을 억제 또는 암세포를 소멸（제거）시키는 효과뿐 아니라. 암세포의 이동（111 1- 八）11） , 침습 ( invas ion) , 전이 (metastas i s) 등을 억제하여 이로 인한 암의 악화를 억제하는 효과도 포함한다.
상기 Foxp3를 발현하는 수지상 세포의 검출 가능한 제제는 Foxp3를 발현하는 수지상 세포와 특이적으로 결합 가능한 모든 화합물 (예컨대. 소분자 화합물. 항체 등) 중에서 선택될 될 수 있으며. 예컨대. 수지상세포 내에서 Foxp3에 특이적으로 결합하는 소분자 화합물, 항체 중에서 선택된 1종 이상 및 Foxp3를 발현하는 수지상 세포의 표면 단백질에 특이적으로 결합하는 소분자 화합물, 항체, 또는 이들 (항체 및/또는 소분자 화합물)을 포함하는 나노전달체 중에서 선택된 1종 이상의 조합일 수 있다. .
상기 CD8을 발현하는 조절 T 세포의 검출 가능한 제제는 CD8을 발현하는 조절 T 세포와 특이적으로 결합 가능한 모든 화합물 (예컨대. 소분자 화합물. 항체, 나노전달체 등) 중에서 선택될 될 수 있으며. 예컨대, CD8 조절 T 세포의 표면 단백질에 특이적으로 결합하는 소분자 화합물. 항체 중에서 선택된 1종 이상의 조합일 수 있다. .
상기 Foxp3를 발현하는 수지상 세포의 검출 가능한 제제 및/또는
CD8을 발현하는 조절 T 세포의 검출 가능한 제제는 통상적인 방법 (예컨대 . 효소 반응. 형광 발광 및/또는 방사선 검출 등)으로 탐지 가능한 통상적인 표지 물질로 표지된 것일 수 있다. 예컨대. 상기 표지 물질은 형광 물질 (예컨대， 형광 화학 염료, 형광 단백질 등) . 발광물질. 방사성동위원소 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나. 이에 제한되는 것은 아니다. 일 예에서, Foxp3를 발현하는 수지상 세포의 검출 및/또는 CD8을 발현하는 조절 T 세포의 검출은 유세포 분석법 (F1이 V cytometry) . FACS ( f luorescence-act ivated ce l l sor t ing) . 면역크로마토그래피
( I mmunochr oma togr aphy ) , 면역조직화학염색 . 효소결합 면역톱착 분석 (enzyme l inked immunosorbent assay： ELISA) . 방사선 면역즉정법 (radioimmunoassay : RIA) , 효소 면역분석 ( enzyme immunoassay : EIA) , 형광면역분석 (Floresence immunoassay : FIA) . 발광면역분석 ( l uminescence immunoassay： LIA) , 웨스턴블라팅 (Western blot t ing) 등에서 선택된 방법을 사용하여 수행될 수 있으나, 이에 제한되는 것은 아니디- . 상기 항암제 스크리닝 방법에 있어서 . 후보 화합물은 각종 화합물 . 예컨대 . 소분바 화합물 (chemicals) . 단백질 , 폴리펩타이드. 올리고펩타이드, 폴리뉴클레오타이드 . 올리고뉴클레오타이드, 식물 또는 동물의 추출물 등으로 이루어진 군에서 선택된 것일 수ᅩ있다.
【발명의 효과】
종양 또는 종양 환경 (예컨대 암 환자의 혈액) 내의 Foxp3를 발현하는 수지상 세포 및/또는 이에 의하여 유도된 抑 8+ Treg의 암 진단 마커 및/또는 암치료 타겟으로서의 용도가 제공되며， 이는 암의 진단, 치료 및 항암제 연구. 항암치료 후 예후 모니터링 등의 다양한 분야에 유용하게 적용될 수 있다.
【도면의 간단한 설명】
도 1은 종양성장 중의 종양 마우스 모델의 혈액 내 Foxp3 발현 수지상 세포 (fxDC)의 비율 (% of fxDC/CDllc+DC)을 보여주는 그래프이다 (Paired one-way ANOVA without multiple comparison correction) .
도 2a는 정상인과 암환자의 혈액에서 fxDC 분포 (% of fxDC/b-DC)를 보여주는 그래프이다 (；7=30 human samples , unpaired one-way ANOVA without multiple— comparisons correction) .
도 2b는 여러 마우스 종양모델 혈액에서 fxDC의 분포를 보여주는 그래프이다 (EL4； lymphoma . B16； me 1 anoma , LLC； Lewis lung carcinoma. 266-6； pancreatic cancer . CT-26; colon cancer , 4T_1; breast cancer ,
RENCA； renal cancer) . 77= 5 to 7 mice per tumor mode 1 , unpaired one-way ANOVA without multiple-comparisons correction) .
도 3은 수지상 세포 특이적 Foxp3 제거 마우스 (CDllc-Cre x Foxp3fl/fl : 이하 Foxp3cK0 마우스) 및 f loxed 1 i t ter mates 이 의 혈액 내의 FxDCs 분포를 보여주는 결과이다.
도 4는 WT 마우스 (Foxp,3il/fl)와 Foxp3cKC)마우스에서 종양 부피 변화를 보여주는 그래프 (좌) 및 종양무게를 보여주는 그래프 (우)이다 (72=5 mice each, unpaired one-tailed t~test . )
도 5는 WT 마우스와 Foxp3cK0 마우스 종양조직 내 fxDC 확인결과를 보여준다 (公 =5. unpaired one-tai led 卜 test. :;::;::：:p<0.001) . 2019/177200 1»（：1/10公018/005026
도 6은 WT 마우스와 Foxp3cK0 마우스에서의 다양한 고형암의 종양 부피 변화를 보여주는 그래프이다.
도 7은 Foxp3cK0마우스의 종양조직 내 cytotoxic ⑶ 8+ T-세포의 비율을 나타낸 그래프이다 (/ 3. unpaired one-tai led i_test).
도 8은 Foxp3cKG마우스의 종양조직 내 CD8+ T-cell의 종양세포에 대한 세포독성을 CTL(Cytotoxic T Lymphocytes)의 활성으로 확인한 결과를 보여주는 그래프이다 (y?=3， unpaired one-tai led t~test ) .
도 9는 ffT 마우스와 Foxp3cK0 마우스의 종양조직 내 CD8+ T세포에서 CTLA4 cytotoxic T- 1 ymphocy t e~as soc i a t ed protein 4) 발현 수준을 보여주는 결과이다.
도 10은 야생형 마우스와 Foxp3cK0 마우스의 종양 조직에서의 CD8+ T 세포 중의 CTLA4 발현 ⑶ 8+ T 세포 (CTLA4+⑶ 8+ T세포)의 비율을 보여주는 그래프이다 (unpaired one-tai led test. /？ <0.01 and 。 ;<0.001).
도 11은 EL4 종양으로부터 분리된 CTLA4+ ⑶ 8+ T 세포와 CTLA4 ⑶ 8+ T 세포의 종양세포 (EL4)를 표적으로 하는 CTL 활성을 나타낸 그래프이다 (unpaired one-tailed i~test) .
도 12는 fxDC와 CD8+T세포의 공배양 후의 Foxp3+ CD8+ Treg 분포를 보여주는 결과이다 (unpaired one-tailed f~test) .
도 13은 fxDC와 foxp3가 제거된 DC의 CD4/8 Treg 유도능 확인 a. Pre-act i vat ed T cells of Foxp3GFP mice were co-cul tured with splenic DCs (spDC)， blood DCs (bDC) and fxDC-depleted (DT-treatecl) bDCs (bDC/DT) of TB Foxp3DTR mice (p3/F for b-DCs), and examined the population of Foxp3+ CD4+ and CD8+ T cells. £=3. unpaired two-way AN0VA with multiple comparisons.
도 14는 TB‘마우스의 혈액 내의 fxDC 및 ⑶ 8+ Tregs 세포 비율을 나타낸 그래프이다 、 21、 .
도 15는 야생형 마우스와 Foxp3cK0 마우스 종양조직 내 CD4+/⑶ 8+Treg 분포를 보여주는 결과이다 (unpaired two-way AN0M with multiple comparisons) .
도 16은 T 세포와 CD8+/CD4+ Treg 세포의 공배양 후의 T 세포 증식 정도를 보여준다.
도 17은 T 세포와 CD8+/CD4+ Treg 세포의 공배양 후의 IFN-ga_a+ T 세포 수준을 보여주는 결과이다 (unpaired one-way ANOVA with mu 11 i p 1 e- compar i sons correct ion. *p<0.05. /) <0.01).
도 18은 CD8+ Treg와 抑 8+ T 세포의 공배양 후의 CTLA4 발현 T 세포 수준을 보여주는 결과이다 (unpaired one-tai led i-test . *JJ<0.05
Figure imgf000017_0001
*t)<0.001).
도 19는 야생형 ⑶ 8+T 세포를 DT-처리 tu-CD8+T-세포 또는 PBS-처리 tu-抑 8+ T-세포와 공배양한 후의 CTLA4+ 抑 8+ T 세포 수준을 측정한 결과를 보여준다 (，F3. unpaired one-tai led i— test).
【발명의 실시를 위한 형태】
이하에서는 실시예를 들어 본 발명을 더욱 구체적으로 설명하고자 하나. 이는 예시적인 것에 불과할 뿐 본 발명의 범위를 제한하고자 함이 아니다. 아래 기재된 실시예들은 발명의 본질적인 요지를 벗어나지 않는 범위에서 변형될 수 있음은 당 업자들에게 있어 자명하다.
참고예
1. 마우스준비
7-10 주령의 야생형 C57BL6 및 BALB/c 마우스. 및 유전자 변형된 C57BL6-0T-1. C57BL6_Foxp3GFP [Foxp3+ 세포에서 Foxp3 -녹색형광 단백질 (GFP) 융합단백질을 발현하는 Foxp3-GFP 리포터 마우스], C57BL6-Foxp3· [Foxp3 프로모터의 조절 하에서 Foxp3 -암호화 엑손을 대신하여 디프테리아 독소 수용체 (dephtheria toxin receptor； DTR)를 발현하는 Foxp3_DTR 형질전환 (Tg) 마우스]. C57BL6-Foxp3DTR_GFP ( C57BL6-Foxp3DTR 마우스를 C57BL6_Foxp3GFP 마우스와 3세대 동안 역교배하여 제작함) . C57BL6-Foxp3-f loxed (Foxp3fl/fl) . CDllc-Foxp3cK0 (CDllc-cre 마우스와 Foxp3fl/fl 마우스를 교배하여 제작된 C57BL6-Foxp3cK0 마우스). C57EL6- Ragltn,U!om (RAGl ^). 및 CDllc-cre 마우스를 하기 시험에 사용하였다. C57BL6-0T-1, Foxp3GFP, Foxp.3DTR. Ragl_/ . 및 CDllc-cre 마우스는 Jackson Laboratory (Bar Harbor, Sacramento. CA)에서 구입 하였다. Foxp8-f loxed (C57BL6-Foxp3fl/fl) 마우스는 "A. Rudensky . Memorial Sloan Kettering Cancer Center . NY"에서 제공받았다. 2019/177200 1»(：1/10公018/005026
모든 마우스는 ’’ Inst itute八｝ niversi ty Animal Care and Use guidelines”에 따라서 SPF (specific pathogen- free) 동물보호시설 (성균관대학교)에서 유지 관리되었고 본 실험을 위해 별도의 animal care chamber에 옮겨 동일 조건에서 co-housing 하여 사용하였다. DTR 마우스에는 기존에 보고된 방법으로 디프테리아 독소 (diphtheria toxin； 를 처리하였다 (참조문헌: "Kim, J. et al . Cutting edge: depletion of Foxp3+ cel Is leads to induction of autoimmunity by specific ablation of regulatory T cel Is in genet ical ly targeted mice. J Immunol 183, 7631-7634. do i： 10.4049 / j i niniuno 1.0804308 (2009)" 및 "Penaloza-MacMaster , P. et al .
10 Interplay between regulatory T cells and PD-1 in modulating T cell exhaustion and viral control during chronic LCMV infection. The Journal of experimental medicine 211. 1905-1918. doi: 10.1084/jeni.20132577 (2014)M). 간략히 설명하면， 아를 PBS에 녹인 다음， 혈액 채취 전 연속 3일간 (day-3, day-2 및 day-1) Foxp3DTR 또는
15 Foxp3DTR_GFP 마우스에 적절한 용량 (50/ig/kg) 200/샀을 i.p. 주사한 후, 상기 DT 처리 마우스의 혈액 또는 종양으로부터 CDllc+MHC+ 수지상 세포 (DC)를 분리하고. 하기 시험에 사용하였다.
2. 마우스세포주 및 인간 primary cel Is의 준비
EL4 (C57BL/6 mouse-derived lymphoma) . EG7 (OVA-expressing EL4) .
20 B16/F10 (C57BL/6 mouse-derived skin melanoma) . 266-6 (C57BL/6 mouse- derived pancreatic acinar cell tumor). CT26 (BALB/c mouse-derived colon carcinoma) , 4T-1 (BALB/c mouse-derived mammary carcinoma) , ¾ RENCA (BALB/c mouse-derived renal adenocarcinoma) 세포들은 ATCC (American Type Culture Col lect ion)로부터 입수하였다. 삼성 의료원 IRB
25 (#SMC 2016-04-057)의 승인을 받은 프로토콜에 따라서 악성종양환자 (교모세포종 (GBM, stages 3 및 4)， 결장암 (colon cancer; CC. stage 2((X2). 3(CC3) 및 4(CC4)) 및 위암 (GC. stage 2(GC2). 3(GC3) 및 4(GC4))와 건강한 기증자로부터 사람 말초 혈액 단핵 세포 (Human peripheral blood mononuclear cells； hPBMCs)를 채취하였다.
B0 3. 마우스종양모델의 준비
야생형 Ut) 마우스 (C57BL6. BALB/c) 및 유전적 변형 마우스 [C57BL6-Foxp3GFP. C57BL6_Foxp3DTR， C57BL6-Foxp3cK0 (Foxp3il/flx⑶ lie- ere)]의 오른쪽 옆구리 부위에 EL4/EG7, B16/F10. LLC. 266-6. CT-26. 4T-1 및 RENCA 세포를 5x10s cells의 양으로 주입하여, 마우스 종양 모델을 준비하였다.
3. 일차면역세포 (primary immune eel Is)의 분리
Ficoll (GE Healthcare. Little Chal font . UK) 및 Per col 1 (Sigma Aldrich, Chemie GmbH , Taufkirchen. Germany) 밀도구배 원심분리에 의하여, TB 마우스의 혈액 및 종양 조직으로부터 마우스 PBMCs 및 종양 침윤 백혈구 (tumor infiltrated leukocytes； TILs)를 분리하였다. lineage+ (CD3+/CD14+/CD19+) 세포의 고갈 (d印 let ion) 후 , CDllc-microbeads
(Miltenyi Biotech)를 사용하여 Foxp3GFP 마우스의 TILs 또는 PBMCs로부터 수지상 세포를 분리하였다. Foxp3cK0 마우스의 종양 크기가 작아서 , 정상화 (normalization) 후 단일 시험용으로 5 내지 10 마리의 TB Foxp3cK0 마우스로부터 분리한 TILs를 풀링 (pooling)하였다 (p5/E 또는 plO/分로 표시). MDSCs( myeloid derived suppressor cells) subsets을 MDSC
Isolation Kit (Miltenyi Biotec)를 사용하여 TB Foxp3GFP 마우스 또는 대조군 Foxp3GFP 마우스의 혈액으로부터 분리하였다. Foxp3+ fxDCs, cDCs. CD4+ Treg, CD8+ Tregs, CTU4+/CTLA4 - T—세포 및 CCR2+/CCR2 - 세포는 BD FACSAriaTMII를 사용하여 Foxp3GFP 마우스의 혈액 또는 종양 조직으로부터 분리하였다. 모든 in vitro 시험 및 adoptive transfer (AT) 시험은 분리된 세포의 normalization 후 수행하였다.
4. 유세포분석법 (Flow cytometry)
표현형 분석을 위하여, 면역형광 염색법을 수행하였다. 세포들을
4°C에서 20분 동안 FACS buffer에서 적절한 항체로 염색하였다. FITC- 표지된 항-마우스 항체 [Ly6g (1A8). CDllc (N418). I-A/I-E (M5/114.15.2) , CD3 (17A2) 및 B220 (RA3-6B2)]는 Thermo Fisher-eBioscience (Waltham, MA. USA)로부터 입수하고. 항-마우스 CD 14 (Sal4-2) 항체는 Bio legend (San Diego. CA. USA)로부터 입수하였다. PE(Phycoerythr in)-표지된 항-마우스 Foxp3 항체 ( 150D . Bio legend) . 항-마우스 zbtb46 항체 (U4-1374, BD biosciences . San Jose. CA, USA) . 및 PE-표지된 항-마우스 항체 [Ly6c (HK1.4). CDllc (N418). CD317 (BST2. 927). ki-67 (SolA15) 및 CD25 (PC61.5)]를 Thermo Fisher-eBioscience로부터 입수하였다. PerCP_Cy5.5- 표지된 항-마우스 항체 [CDllb. Gr-1 (RB6-8C5). CD44 (IM7), Foxp3 (FJK- 16s), I-A/I-E, CDllc 및 CD25 (PC61.5)]. PE_Cy7 -표지된 항-마우스 항체 [CD4 (GK1.5). CD8a (53-6.7). F4/80 (BM8). CD16/⑶ 32 (93). Foxp3 (FJK- 16s) 및 CDllc (N418)]. APC_표지된 항-마우스 항체 [CD3 (17A2), ⑶ 14 (SA14-2). CD19 (1D3/CD19). Foxp3 (FJK-16s). CCR2 (475301). CTLA4 (UC10-4B9) and CD44 (IM7)] 및 Pacific blue-표지된 항-마우스 항체 [CD4
(GK1.5), CD8a (53-6.7). CD3 (17A2) 및 CD62L (MEL-14)]를 Thermo Fisher- eBioscience로부터 입수하였다. 모든 시료는 또한 이소형 대조 항체로 염색하였다. 세척 후, 세포들을 FACSCanto II (BD Biosciences . San Jose. CA, USA) 및 FACS DIVA software로 분석하였다. Foxp3, IFN-gamma (XMG1.2) , perforin 및 Granzyme B에 대한 항체들은 Thermo Fisher- eBioscience에서 입수하였으며 . 제조자 프로토콜에 따라서 세포 내 염색을 수행하였다..
5. Foxp3발현 수지상세포 (fxDCs)에 대한 FACS gating strategy
TB 마우스의 종양 및 혈액으로부터 마우스 PBMCs 및 TIL (tumor infiltrated leukocytes)을 분리하였다. 분리된 세포들은 적절한 항체를 사용하여 세포 염색 버퍼 내에서 염색하였다. 유세포 분석 (flow cytometry)의 검출 채널에 따라서 각각의 gating strategy에 맞게 항체 패널을 최적화하여 설계하고 구축하였다. single-stained U1 traComp eBeads (Affymetrix) 또는 세포를 사용하여 보정 (Compensat ion)을 수행하였다. 모든 채널에 대하여. 양성 세포 및 음성 세포들을
Fluorescence Minus One controls (FMOs) 및 Isotype controls 기준으로 게이팅하고, Foxp3+는 Foxp.3GFP 마우스의 경우 GFP 1 i t ter mate control를 사용하여 게이팅하고. wt TB 마우스의 경우 Foxp3+ 세포의 세포내 염색을 수행하였다. FxDC 게이팅은 다음과 같이 수행하였다: FVD+(Live cells). CD45+, Lineage (CD3/CD19/CD14； T-cel Is . B-cells and Monocytes)— negat ive. CDllc+ MHC 11+및 Foxp3+. fxDCs의 모든 표현형 패널은 상기한 바와 같은 the gating strategy를 통하여 수행되었다: FVD： Fixable Viability Dye.
6. DC/T-세포의 공배양 (co-culture)
TB Fopx3GFP 마우스의 비장으로부터 T 세포를 분리하고 정제하였다. TB Fopx3GFP 마우스 마우스의 비장을 RPMI 배지에서 균질화시키고 70 nylon cell strainer (BD Falcon)를 통과시킨 다음 ACK 용해 버퍼
(Lonza)로 처리하여 T세포를 분리하였다. 상기 분리된 T 세포를 마우스 ⑶ 4 and CD8 T-cel 1 Isolation Kit II (Mi ltenyi Biotech)를 사용하여 정제한 투, 37°C에서 ImM의 5. 6-car boxyf 1 uor esce i n succinimidyi ester (CFSE. Molecular Probes)(at 1 mM for 10 min) . Cell Trace Violet (CTV.
Invitrogen)(at 10 uM for 15 min) . 또는 4-chlorobenzenesul fonate salt (DiD. Thermo fisher) (at 5uM for 15min)로 표지하였다. CFSE7CTV-표지된 T 세포를 항 CD3/CD28 항체 (알파- CD3 10^g/nil . 알파- CD28 4/ig/ml)와 1 일간 인큐베이팅한 다음, 5xl05개의 T세포를 fxDCs 또는 다른 DC subsets과 함께 1:5 (DC:T)의 비율로 3일 간 공배양하였다. 세포 증식은 유세포 분석법 (참고예 4 참조)로 측정하였다. 0T-l(ovalbuniin-speci f ic . CD8+ T cells) T 세포와 함께 공배양한 경우， 비장 0T-1 T 세포는 0T-1 마우스로부터 준비하고. 상기한 바와 같이 표지하였다. 추가 자극 없이. CF況-표지된 5xl05 naive 0T_1 T-세포를 Foxp3DTR종양마우스로부터 분리하여 DT-처리한 (fxDC-고갈) bDCs. 또는 PBS-처리 (fxDC-함유) bDC. 또는 sp-
DCs와 함께 1:5 (DC：T) 비율로 공배양하였다.
7. CTL (Cytotoxic T Lymphocytes) 분석
종양 이식 후 21일째에 Foxp3fl/fl 또는 Foxp3cK0 TB 마우스의 종양 조직으로부터 분리한 抑 8+ T-세포를 CTV-표지된 표적 세포 (1 x 105 EL4 cells)와 함께 상이한 비율로 24시간 동안 공배양하였다. PI 염색 후, 상기 참고예 4을 참조하여 유세포 분석법을 수행하여 CTL 활성을 분석하였다. 21일째에 Foxpfl/fi 또는 Foxp3cK0 TB 마우스의 종양에서 분리된 tu-DCs을 splenic ⑶ 8+ T-세포와 1:5 (DC：T) 비율로 3일 동안 공배양하여 CTLs을 생성시킨 후. CTL 활성을 측정하였다. FACSAria™II를 사용하여 TB Foxp3GFP 마우스의 종양으로부터 CTLA4+ 또는 CTLA4 -⑶ 8+ T-세포를 분리하고 이들의 CTL 활성을 조사하였다.
8. Adoptive transfer (AT)시험
MDSC Isolation Kit (Mi 1 tenyi Biotec, Bergisch Gladbach. Germany)를 사용하여 TB FoxpSGFP 마우스의 비장 또는 혈액으로부터 분리한 M-MDSCs (lxlO6 cel Is)를 대조군 (종양을 이식받지 않은 tumor- free 마우스) 또는 TB 마우스에 꼬리 정맥을 통하여 전달하였다 (Adoptive transfer； AT). AT 3일 후. 상기 AT받은 마우스 (recipient)에서 fxDC를 분석하였다.
CD8+ T 세포의 AT를 수행하기 위하여, CD8+ T-cell isolation kit (Mi 1 tenyi Biotec)를 사용하여 tumor-free 마우스 또는 0T-1 마우스의 비장, 또는 TB Foxp3fl/fl 및 Foxp3cko 마우스의 혈액 또는 종양 조직으로부터 세포를 분리한 후. 상기 분리된 세포를 CTV (lOuM) 또는 DiD (lOuM)로 37°C에서 15 분간 표지하고, 표지된 세포 (lxlO6)를 앞서 설명한 방법으로 마우스에 전달 (AT)하였다.
통계분석
통계 분석은 GraphPad 5.0 software를 사용하여 수행하였으며,
P< 0.05 ( < 0.05， * < 0.01, */5 <0.001)인 경우 유의성이 있는 것으로 결정하였다. 모든 시험 결과는 적어도 3개 이상의 시료에 대하여 적어도 3번 이상의 독립적인 시험 (3幻으로부터 얻었다. 통계 데이터는 mean + s.e.m으로 나타내었다.
실시예 1. 종양환자혈액 내의 fxDC측정
EL4 lymphoma를 마우스에 주입하여 준비된 마우스 종양 모델 (참고예 2 참조)에서. 종양 세포 주입 후 7일차부터 3일 간격으로 안와채혈 (안구정맥채혈)하여 혈액 내 Foxp,3를 발현하는 수지상 세포 ( fxDC 또는 Foxp3+ DC로 표시)를 측정하여 (참고예 4 및 5 참조), 그 결과를 도 1에 나타내었다. 도 1은 종양 성장 동안의 Foxp3GFP 마우스의 혈액 내의 fxDC 개체군 (populations) 모니터링 결과를 보여주는 것으로. fxDC는 각 그룹의 마우스 (n=30 마리의 마우스: 3 그룹. 그룹당 10 마리의 마우스)의 안구정맥으로부터 채혈된 혈액에 대하여 각 시점에서 평가하였다. 도 1에 나타난 바와 같이. 종양 마우스 모델의 혈액 내의 fxDC가 종양 성장에 비례하여 그 비율이 증가함을 알수 있다. 또한. 건강한 공여자 (heal thy donors； HD) 및 암환자 (교모세포종 (GBM, stages 3 및 4) , 대장암 (Colorecta cancer； CC . stage 2(CC2) , 3 CC3) 및 4(CC4) ) 및 위암 (GC , stage 2(GC2) , 3(GC3) 및 4(GC4) ) (참고예 2 참조)의 혈액 내의 DC (b(blood)-DC) 중 fxDC를 측정하여 (참고예 4 및 5 참조) . 그 결과를 도 2a에 나타내었다. 도 2a에 나타난 바와 같이. 마우스 종양 모델에서와 동일하게, 인간 암 환자의 혈액에서도 암 진행 정도에 따라 fxDC 분포가 비례하여 증가함을 확인하였다.
또한 앞서 설명한 방법으로 다양한 종양 (EL4 ; 임파종양. LLC； 루어스폐암, 266-6； 췌장암， CT-26； 대장암， 4T-1； 유방암)이 이식된 5- 7마리의 종양마우스를 만들고, 혈액 내의 fxDC 분포를 조사하여 , 그 결과를 도 2b에 나타내었다. 도 2b에 나타난 바와 같이, 종양 마우스 혈액에서 fxDC가 다량 발견되었다.
실시예 2. fxDC저해에 의한종양성장저해 시험
fxDC가 종양성장에 주는 영향을 시험하기 위하여 , 우선, 수지상 세포 특이적으로 Foxp3 발현을 제거한 ·마우스 (CDllc-Cre x Foxp3f l /f i： 이하 Foxp3cK0 마우스)를 제작하여 (참고예 1 참조)， 여기에 종양세포를 투여하여 종양 마우스를 만든 다음 혈액 내의 fxDC를 측정하였다 (참고예 4 및 5 참조) . 상기 얻어진 결과를 도 ,3에 나타내었다. 도 3에서와 같이，
Foxp3cKQ마우스의 혈액에서 fxDC이 제거됨을 확인할 수 있다.
야생형 마우스 (Foxp3f l /i l ; Foxp3가 knock-out되지 않은 TB 마우스)와
Foxp.3cK0 마우스에 EL4 lymphoma tumor cel l (5xl05 cel I s)을 주입하고， 7일 후부터 3일 간격으로 종양성장을 모니터링한 결과를 도 4에 나타내었다. 도 4의 왼쪽은 종양 부피 변화를 보여주는 그래프이고. 오른쪽은 종양이식 후 23일째의 종양 무게를 보여주는 그래프이다. 도 4에 나타난 바와 같이. 야생형 마우스 (Foxp3f l /i l )에서는 종양 크기가 자속적으로 증가하는 반면, fxDC가 제거된 Foxp3cK0 마우스 ( fxDC 제거는 도 3의 결과 참조)에서 17일까지 종양이 소폭 성장하다가 30일 이후로는 완전히 사라지는 것을 확인할 수 있다. 이러한 결과는 수지상 세포 특이적으로 Foxp3를 제거하거나 fxDC를 제거함으로써, 종양 치료 효과를 나타낼 수 있음을 보여준다. 상기 도 4에서 종양성장이 억제된 것으로 확인된 Foxp3cK◦마우스의 종양 주입 후 17일째의 종양조직 내 fxDC 분포를 측정하여 (참고예 4 및 5 참조), 도 5에 나타내었다. 도 5에 나타난 바와 같이 . 실제 종양성장이 억제된 Foxp3cKG마우스에서 fxDC가 대부분 사라지는 것을 확인할수 있다. 또한. EL4 lymphoma 뿐만 아니라, 다양한 고형암 (266-6: pancreatic cancer . LLC： Lewis lung carcinoma. EG7: OVA expressing EL4 lymphoma)에 대하여 동일한 시험을 수행하여 종양 부피를 측정하여 도 6에 나타내었다. 도 6에 나타난 바와 같이 , EL4 lymphoma 뿐만 아니라, 다양한 고형암에서도, EL4 lymphoma의 경우와 유사하게. fxDC가 제거된 마우스에서의 종양 억제 효과가 야생형 마우스보다 현저하게 우수한 것으로 나타났다.
실시예 3. fxDC저해에 의한 CD8+ T세포증가및 종양세포에 대한 세포독성 중가시험
⑶ 8+ T (Tel) 세포는 실제 Anti-cancer immunity 중요한 역할을 하는 세포로, 직접적으로 종양세포의 사멸을 유도한다 (cytotoxic ⑶ 8+T- cell). fxDC가 제거된 Foxp3cK◦마우스에서 종양 내의 CD8+ T 세포의 비율이 약 35.6%로 야생형 마우스 (Foxp3fl/fl)에서의 CD8+ T 세포의 비율 (약 16.3%)보다 크게 증가된 것을 확인하였다. fxDC가 제거된 Foxp3cKQ마우스 종양 조직에서의 ⑶ 8+ T 세포 중에서 IFN-gamnia를 발현하는 CD8+ T 세포 (FN-ga_a+抑 8+ T 세포; cytotoxic ⑶ 8+ T-세포)의 비율을 측정하여 도 7에 나타내었다. 도 7에 나타난 바와 같이, 야생형 마우스 (Foxp3fl/fl)와 비교하여, fxDC가 제거된 Foxp3cK0 마우스에서 cytotoxic CD8+T-세포의 비율이 약 2.5배 증가되어 있음을 확인하였다. 이러한 결과는 fxDC에 의한 cytotoxic CD8+T-세포의 조절 효과 (fxDC게거에 의하여 cytotoxic CD8+T- 세포가 상향조절됨)를 제안한다.
종양조직 내 ⑶ 8+ T 세포가 직접적으로 종양의 증식 억제 (종양 세포의 사멸)를 유도하는지 확인하기 위하여. 야생형 마우스 (Foxp3fl/fl)와 fxDC가 제거된 Foxp3cK() 마우스의 종양조직 내 CD8+ T 세포를 분리한 후, 종양세포와 공배양 하여. 종양세포에 대한 세포독성효과를 측정하였다. 세포 독성은 CTL (Cytotoxic T Lymphocytes)의 활성시험 (참고예 7 참조)으로 측정하였다. 상기 얻어진 결과를 도 8에 나타내었다. 도 8에서와 같이. Foxp3cK0 마우스에 분리한 CD8 + T 세포가 야생형 마우스의 CD8+ T 세포보다 종양세포에 대한 세포 독성이 현저히 높은 것으로 나타났으며, 이러한 결과는 Foxp3의 제거（knock-out）에 의하여 CD8+ T 세포 생성이 유도되고. 이를 통하여 종양세포의 사멸률이 증가하여 종양 억제 효과가나타남을 보여준다.
fxDC 제거 마우스의 ⑶ 8+ T-세포에 의한 CTL 활성 （세포독성）이향상되는 기전을 확인하기 위하여, 다양한 세포표면 면역활성/억제 분자들의 발현을 조사하였다. 이 중에서. fxDC가 제거된 TB 마우스의 .종양 조직의 CD8+ T세포에서의 CTLA4 （cytotoxi c T- lymphocyte- assoc i ated prote in 4） 발현 수준을 야생형 마우스（TB）와 비교하여 도 9에 나타내었다. 도 9에 나타난 바와 같이, fxDC가 제거된 TB 마우스의 종양조직의 抑 8+ T세포에서 CTLA4 발현 수준 （약 8.92 «이 야생형 TB 마우스에서의 CTLA4 발현 수준 （약 79.5%）과 비교하여 크게 감소함을 확인하였다.
fxDC가 抑 8+ T 세포의 CTLA4 발현을 조절하는 기작을 확인하기 위하여, 정상 마우스（종양이 이식되지 않음）의 CD8+ T 세포（Donor T 세포: DiD stained）를 종양이 이식된 야생형 마우스와 Foxp8cK0 마우스에 각각 꼬리정맥을 통하여 adopt ive t ransfer （AT）（참고예 8 참조）한 후, 3일 후에, 종양조직 내 Donor T세포（DiD+ CD8+ T세포） 중에서 CTLA4 발현 抑 8+ T 세포 （CTLA4+⑶ 8+ T세포）를 측정하여 , 그 결과를 도 10에 나타내었다. 도 10에 나타난 바와 같이. fxDC가 제거된 마우스에서는 Donor 抑 8+ T 세포에서 CTLA4발현이 크게 감소됨을 확인할수 있다.
⑶ 8+ T 세포에서의 CTLA4 발현이 항암면역의 핵심이 되는 CTL 반응（종양세포에 대한 세포독성）을 조절하는지 확인하기 위하여. EL4 TB 마우스의 EL4 종양으로부터 CTLA4+ ⑶ 8+ T 색포와 CTLA4 CD8+ T 세포를 분리한 후. 종양세포（EL4）를 표적 세포로 하여 CTL 활성을 시험하여, 그 결과를 도 11에 나타내었다. 도 11에 나타난 바와 같이 . CTLA4를 발현하는 CTLA4+ 抑 8+ T 세포는 CTLA4를 발현하지 않는 CTLA4- 抑 8+ T 세포보다 CTL 활성이 현저히 감소함을 확인할 수 있다.
상기 결과들은 종양 및 종양 환경에 의해 유도되는 fxDC가 종양 내 CD8+ Treg을 유도하고 (하기 실시예 5 참조)， 이 세포가 종양을 제거하기 위해 몰려드는 CTL의 활성을 억제하여 종양의 지속적인 성장에 관여하며. fxDC를 제거할 경우 CTL 활성을 억제하는 CTLA4 발현이 감소하여 종양특이적 CTL 활성이 억제되지 않아서 효과적인 항암면역을 유도함으로써 종양성장을 현저하게 저해할 수 있음을 보여준다. 따라서 종양환자에서
- fxDC를 제거하면 효과적인 항암면역을 유도하여 우수한 암 성장 억제 효과 및/또는 암 치료 효과를 얻을 수 있을 것으로 기대된다.
상기 결과는 fxDC에 의해 유도되는 CD8+ Treg가 T 세포 증식을 억제하고 항암 면역을 주관하는 CTL 활성을 감소시킴을 보여주는 것으로, fxDC의 제거에 의하여 T 세포 면역 및/또는 항암 면역이 강화될 수 있음을 제안한다..
실시예 4. fxDC와 CD8+T세포와의 공배양에 의한 CD8+ Treg의 제조 야생형 정상 마우스에 EL4 종양세포를 5x10s cell의 양으로 s.c injection하였다. 14일 후, 상기 마우스의 혈액에서 PBMC를 분리한 후. Ficol 1-Paque (GE healthcare. Cat . #17-5442-02) 1ml을 15ml conical tube (Hyundai micro, Cat . #H20050)에 채우고, 동량의 혈액 또는 buddy coat를 F i co 11 -Paque tube에 섞이지 않게 overlay 시켰다. 다목적 원심분리기 (Gyrozen, Cat. #1580MGR)의 가속력을 1. 감속력 (DCC)을 0으로 설정하고 2500rpm로 30분간 농도구배 원심분리를 시행하였다. 원심 분리 후. 제일 위층의 혈장과 중간의 단핵구층을 분리하고, 분리된 단핵구로부터 抑 llc-Microbeads를사용하여 CDllc+수지상 세포를 분리하였다.
정상 마우스의 비장 (spleen)을 적출한후, cell strainer를 사용하여 단일세포로 분리하고, RBC lysis buffer를 사용하여 상기 분리된 단일세포로부터 모든 적혈구를 제거한 후. Microbeads를 사용하여 ⑶ 8+ T 세포를 분리하였다. 분리된 抑 8+ T세포를 ⑶； VCD28로 코팅된 96 Well plate에 2.5 x 105 cell씩 분주하였다.
상기 抑 8+ T세포가 포함된 96well pi ate에 앞서 혈액에서 분리된 수지상 세포를 분주하여 CD8+ T 세포와 3일동안 공배양한 후, ⑶ 8+ T세포를 수거하여 아래의 실시예 5 및 실시예 6분리 및 분석에 이용하였다.
상기와 같이 fxDC와 抑 8+ T 세포의 공배양에 의하여 抑 8+ Treg가 유도됨을 확인하기 위하여, Foxp3GFP TB 마우스로부터 분리하고 항- CD3/28 항체로 예비 활성화 (pre-act ivat ion)시킨 CTV-표지 ⑶ 8+ T 세포를 Foxp3GFP TB 마우스의 혈액에서 분리한 DC와 공배양하고. Foxp3+ CD8+ Treg 분포를 측정하였다. 상기 결과를 도 12에 나타내었으며. 상기 결과로부터 fxDC와 抑 8+ T세포의 공배양에 의하여 ⑶ 8+ Treg가유도됨을 확인할수 있다.
실시예 5. fxDC에 의한 CD8+ Treg유도시험
fxDC에 의하여 ⑶ 8+ Treg (CD8+ regulatory T cel l )이 유도되는지 여부를 시험하기 위하여. 비장 DC ( spDC) 또는 fxDC가 포함된 혈액 DC (bDC)와 fxDC가 제거된 혈액 DC (Foxp3_DTR마우스에 Diphther i a Toxin(DT)를 처리하면 표적 세포가 제거됨; fxDC-depleted (DT-treated) bDCs (bDC/DT) )와 항- CD3/28 항체로 미리 활성화 (pre-act ivat ion)시킨 T 세포를 공배양하여, 전체 T 세포에 대한 Foxp3+ CD4+· 및 ⑶ 8+ T 세포 비율을 측정하여 , 도 13에 나타내었다. 도 13에 나타난 바와 같이 . fxDC가 제거된 혈액 DC는抑 8+ Treg를 전혀 유도하지 못함을 확인할수 있다.
fxDC에 의해 유도되는 CD8+ Treg가 종양성장과 어떠한 연관성이 있는지 시험하기 위하여. EL4 세포를 27마리의 Foxp3GFP 마우스에 동시 접종하여 TB 마우스를 제작한 후. 하루에 한 마리씩 희생하여 분석하였다. 상기 TB 마우스의 혈액 내의 fxDC 및 CD8+ Treg을 측정하여 . 혈액 DC 중의 fxDC 비율 («을 x축으로 하고 혈액 내의 ⑶ 8+ Treg의 비율 (% of CD8+ Tregs/CD8+ T-ce l l )을 y축으로 하여， 도 14에 나타내었다. 도 14에 나타난 바와 같이， TB 마우스의 혈액에서 종양 성장에 따라 증가하는 fxDC와 비례하여 ⑶ 8+ Treg가증가함을 확인하였다.
fxDC가 제거된 마우스에서 종양이 성장하다가 일정 시간 후 사라지는. 결과 (도 4 참조)를 기초로, Foxp3cK0 TB 마우스와 야생형 TB 마우스의 종양 조직에서의 Foxp.3+ ⑶ 4+ 및 抑 8+ Treg의 분포를 측정하여 도 15에 나타내었다. 도 15에 나타난 바와 같이. fxDC가 제거된 마우스의 종양조직에서 ⑶ 8+ Treg가 야생형 마우스에 비해 크게 감소하는 반면, ⑶ 4+ Treg세포는 fxDC 존재 여부에 따른 영향을 받지 않음을 확인하였다.
실시예 6. CD8+ Treg의 T 세포 증식 억제 및 종양 증식 촉진 효과 시험 fxDC에 의해 유도되는 CD8+ Treg의 T 세포 면역 및 항암 면역에 미치는 효과를 시험하기 위하여. 비장 ⑶ 8+ T-세포를 항- CD3/28 항체로 자극한 후 . Foxp3GFP TB 마우스의 종양으로부터 분리한 종양- CD4+ Treg ( tir 抑 4+ Treg) 세포 및 종양- CD8+ Treg ( tuH：D8+ Treg) 세포와 함께 3일간 공배양한 후. ⑶ 8+ T 세포 증식 정도 및 IFN-gamma+ 세포를 측정하였다 (참고예 5 및 6 참조) .
도 16은 CD4+ Treg ( tu-CD4+ Treg) 세포 및 CD8+ Treg ( tu_CD8+ Treg) 세포의 증식을 측정한 결과를 보여주는 것으로, 항- CD3/28 항체가 처리된 (pre-act ivated) T 세포와 CD8 ⑶ 4+ Treg 세포의 공배양 시 抑 8+ Treg가 CD4+ Treg세포보다높은 수준으로 T세포 증식을 억제함을 보여준다.
도 17은 항- CD3/28 항체가 처리된 (pre-act ivated) T 세포와 CD8+/CD4+ Treg 세포의 공배양 시 IFN-g ma+ T 세포 수준을 보여주는 결과로. 항- CD3/28 항체가 처리된 (pre-act ivated) T 세포와 CD8 抑 4+ Treg 세포의 공배양 시 IFN-gamma를 발현하는 CTL (⑶ 8+ IFN-ga_a+ T 세포)의 수준이 크게 감소함을 보여준다.
앞선 실시예에서 확인된 바와 같이 , CTLA4+ ⑶ 8+ T 세포에서 CTL 활성이 사라진다 (도 10 참조) . 이에, ⑶ 8+ Treg가 CTLA4+ ⑶ 8+ T 세포를 직접적으로 유도하는지 여부를 시험하였다. 이를 위하여, in vi tro에서 kDC에 의해 유도된 CD8+ Treg를 정상 마우스의 ⑶ 8+ T세포와 공배양한 후, CTLA4+ 抑 8+ T 세포 수준을 측정하였다. 보다 구체적으로, 야생형 (정상) 마우스에서 분리된 ⑶ 8+ T-세포를 항- CD3/28 항체로 자극한 후, Foxp3f/f 및 Foxp3cK0 TB 마우스 종양으로부터 분리한 tu-DC와 함께 3일간 공배양한 후. tu-DC 유도 CD8+ T 세포를 정제하고, DiD-표지된 야생형 CD8+ '-세포와 함께 3일간 공배양한 후, CD8+ T-세포 내의 CTLA-4 발현을 측정하였다. 상기 얻어진 결과를 도 18에 나타내었다. 도 18에 나타난 바와 같이, Foxp3cK0
TB 마우스에서의 CTLA4+ ⑶ 8+ T 세포 수준이 야생형 TB 마우스와 비교하여 현저하게 감소함을 확인할 수 있다. 이러한 결과는 fxDC에 의해 유도된 ⑶ 8+ Treg가 직접적으로 CTLA4+⑶ 8+ T 세포를 유도함을 보여준다.
야생형 ⑶ 8+ T 세포를 DiD로 표지하고. 항- CD3/28 항체로 자극한 후. Foxp3DTR TB 마우스의 종양으로부터 분리된 DT-처리 tu-抑 8+ T-세포 (CD8 2019/177200 1»（：1^1{2018/005026
융 야근 또는 요 -처리 比 08+ ^세포와 함께 3일간 공배양한 후 1 4+ 008+ I세포 수준을 측정하여 도 19에 나타내었다. 도 19에 나타난 바와 같이 . 아처리에 의하여 008+竹6묘를 모두 제거한 경우， 01名4+ 008+ I 세포가 전혀 유도되지 않음을 확인하였다.
상기 결과들을 종합하면. ｛於에 의해 유도되는 ⑶ 8+ 요은 암세포를 직접 공격하는 1에서의 01 4 발현을 유도하여 （：孔 활성을 억제함을 확인할 수 있으며. 이러한 결과로부터, ⑶ 8+ 요을 제거함으로써 항암 면역을 강화시켜 보다 효과적인 암 치료가 가능할 수 있음을 시사하고, 항암제 개발에 있어서 ⑶ 8+
Figure imgf000029_0001
항암 차료 타겟으로서의 유용성을 제공한다.

Claims

2019/177200 1»（：1^1{2018/005026
【청구범위】
【청구항 11
（«?3를 발현하는 수지상 세포의 저해제를 포함하는. 암 치료용 약학 조성물.
【청구항 2】
제 1항에 있어서 . 상기 （«93를 발현하는 수지상 세포의 저해제는 항체, 세포독성
Figure imgf000030_0001
〔11~1退3）， 항체-세포독성 약물 접합체, 및 항체-자성입자로 이루어진 군에서 선택된 1종 이상이 저해제 , 또는 상기 저해제를 포함하는 나노전달체로 이루어진 군에서 선택된 1종 이상인. 암 치료용 약학 조성물.
【청구항 3】
제 1항 또는 제 2항에 있어서 . 상기 조성물은 종양 조직 또는 혈액에서 1^0X03를 발현하는 수지상 세포가 검출된 암 환자에게 투여하기 위한 것인. 암 치료용 약학 조성물.
【청구항 4】
¾ 1）3를 발현하는 수지상 세포의 저해제를 포함하는. 008을 발현하는 조절 I 세포 저해용 약학 조성물.
【청구항 5】
제 4항에 있어서. 상기 （«?3를 발현하는 수지상 세포의 저해제는 항체, 세포독성 약물（0가01：0）（比 〔 . 항체-세포독성 약물 접합체， 및 항체 -자성입자로 이루어진 군에서 선택된 1종 이상이 저해제 , 또는 상기 저해제를 포함하는 나노전달체인.
Figure imgf000030_0002
발현하는 조절 I 세포 저해용 약학 조성물.
【청구항 6]
제 4항 또는 제 5항에 있어서. 상기 조성물은 종양 조직 또는 혈액에서
17¥（1：）3를 발현하는 수지상 세포가 검출된 암 환자에게 투여하기 위한 것인. 발현하는 조절 I 세포 저해용 약학 조성물.
【청구항 7】
발현하는 조절 I 세포의 저해제를 유효성분으로 포함하는. 암 치료용 약학 조성물. 2019/177200
【청구항 8]
제 7항에 있어서. 상기 0 8을 발현하는 조절 I세포의 저해제는 항체. 세포독성 약물（예야0 （11-1^）. 항체-세포독성 약물 접합체. 및 항체- 자성입자로 이루어진 군에서 선택된 1종 이상이 저해제. 또는 상기 저해제를 포함하는 나노전달체인, 암 치료용 약학 조성물.
【청구항 9】
제 7항 또는 제 8항에 있어서 . 상기 조성물은 종양조직 또는 혈액에서 발현하는 조절 I세포가 검출된 암 환자에게 투여하기 위한 것인, 암 치료용 약학조성물.
【청구항 10】
1?0 1：）3를 발현하는 수지상 세포의 저해제를 암 치료를 필요로 하는 환자에게 투여하는 단계를 포함하는, 암 치료 방법.
【청구항 11】
제 10항에 있어서， 상기 1½ 3를 발현하는 수지상 세포의 저해제는 항체, 세포독성 약물（ 가아（«比 （1 _ 3）, 항체-세포독성 약물 접합체·, 및 항체-자성입자로 이루어진 군에서 선택된 1종 이상이 저해제, 또는 상기 저해제를 포함하는 나노전달체인 . 암 치료 방법.
【청구항 12】
제 10항에 있어서. 상기 환자는 종양 조직 또는 혈액에서 1^ 1）3를 발현하는 수지상 세포가 검출된 암 환자인, 암 치료 방법 .
【청구항 13】
Figure imgf000031_0001
발현하는 조절 I 세포의 저해를 필요로 하는 환자에게 투여하는 단계를 포함하는 . 008을 발현하는 조절 I세포 저해 방법 .
【청구항 14】
제 13항에 있어서, 상기 를 발현하는 수지상 세포의 저해제는 항체 . 세포독성
Figure imgf000031_0002
山- ） . 항체-세포독성 약물 접합체 . 및 항체-자성입자로 이루어진 군에서 선택된 1종 이상이 저해제 . 또는 상기 저해제를 포함하는 나노전달체인. 발현하는 조절 I세포 저해 방법.
【청구항 15】 2019/177200 1»（：1^1{2018/005026
제 13항에 있어서. 상기 환자는 종양 조직 또는 혈액에서
Figure imgf000032_0001
발현하는 수지상 세포가 검출된 암 환자인.
Figure imgf000032_0002
발현하는 조절 I 세포 저해 방법. :
【청구항 16】
발현하는 조절 I 세포의 저해제를 암 치료를 필요로 하는 환자에게 투여하는 단계를 포함하는. 암 치료 방법 .
【청구항 17】
제 16항에 있어서.
Figure imgf000032_0003
발현하는 조절 세포의 저해제는 항체, 세포독성 약물（ 가01：0）（比 011' 1^5） , 항체-세포독성 약물 접합체 , 및 항체- 자성입자로 이루어진 군에서 선택된 1종 이상이 저해제. 또는 상기 저해제를 포함하는 나노전달체인. 암 치료 방법.
【청구항 18】
제 16항에 있어서, 상기 환자는 종양 조직 또는 혈액에서 0084 발현하는 조절 세포가 검출된 암 환자에게 투여하기 위한 것인, 암 치료 방법 .
【청구항 19】
후보 화합물을
Figure imgf000032_0005
발현하는 수지상 세포.
Figure imgf000032_0004
발현하는 조절 I 세포. 또는 이들 모두와 접촉시키는 단계 ;
1^ ?3를 발현하는 수지상 세포,
Figure imgf000032_0006
발현하는 조절 I 세포, 또는 이들 모두와 수준을 측정하는 단계; 및
상기 측정된 （«?3를 발현하는 수지상 세포,
Figure imgf000032_0007
발현하는 조절 I 세포, · 또는 이들 모두의 수준을 상기 후보 화합물 처리 전과 비교하여 감소한 경우, 상기 후보 화합물을 항암제 후보 물질로 결정하는 단계
를 포함하는, 항암제 스크리닝 방법 .
【청구항 20】
^ 예）3를 발현하는 수지상 세포와
Figure imgf000032_0008
발현하는 I 세포를 함께 배양하는 단계를 포함하는.
Figure imgf000032_0009
제조 방법 .
【청구항 21】
환자로부터 분리된 생물학적 시료에서 . （패）3를 발현하는 수자상 세포. 발현하는 조절 I 세포. 또는 이들 모두를 검출하는 단계를 포함하는. 2019/177200 1»（：1^1{2018/005026
암 진단또는 암 예후 확인에 정보를 제공하는 방법 .
【청구항 22】
항암 치료를 받은 환자로부터 분리된 생물학적 시료에서 3를 발현하는 수지상 세포를 검줄하는 단계를 포함하는， 항암 치료 효능 모니터링에 정보를 제공하는 방법.
PCT/KR2018/005026 2017-04-28 2018-04-30 Foxp3를 발현하는 수지상 세포의 암의 진단 또는 치료를 위한 용도 WO2019177200A1 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2019558751A JP2020518569A (ja) 2017-04-28 2018-04-30 Ｆｏｘｐ３を発現する樹状細胞の癌の診断または治療のための用途
US16/608,817 US20200181273A1 (en) 2017-04-28 2018-04-30 Use of dendritic cells expressing foxp3 for diagnosis or treatment of cancer
CN201880027892.0A CN110573181A (zh) 2017-04-28 2018-04-30 表达foxp3的树突状细胞在癌症的诊断和治疗中的用途
KR1020197034995A KR20190140999A (ko) 2017-04-28 2018-04-30 Foxp3를 발현하는 수지상 세포의 암의 진단 또는 치료를 위한 용도

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762491320P 2017-04-28 2017-04-28
US62/491,320 2017-04-28

Publications (1)

Publication Number Publication Date
WO2019177200A1 true WO2019177200A1 (ko) 2019-09-19

Family

ID=67907240

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2018/005026 WO2019177200A1 (ko) 2017-04-28 2018-04-30 Foxp3를 발현하는 수지상 세포의 암의 진단 또는 치료를 위한 용도

Country Status (5)

Country Link
US (1) US20200181273A1 (ko)
JP (1) JP2020518569A (ko)
KR (1) KR20190140999A (ko)
CN (1) CN110573181A (ko)
WO (1) WO2019177200A1 (ko)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100291677A1 (en) * 2007-08-24 2010-11-18 Keio University Reducer of immunosuppression by tumor cell and antitumor agent using the same
WO2012112079A1 (en) * 2011-02-14 2012-08-23 Vitaspero, Inc. IMPROVING CELLULAR IMMUNOTHERAPEUTIC VACCINES EFFICACY WITH GENE SUPPRESSION IN DENDRITIC CELLS AND T-LYMPHOCYTES USING SiRNA
KR20150113906A (ko) * 2014-03-31 2015-10-08 연세대학교 산학협력단 ＧＭ－ＣＳＦ 유전자； 데코린 유전자；ＴＧＦ－β２ 발현을 억제하는 ｓｈＲＮＡ； 및 ＦｏｘＰ３ 발현을 억제하는 ｓｈＲＮＡ를 포함하는 항종양 조성물
KR20160026034A (ko) * 2014-08-29 2016-03-09 성균관대학교산학협력단 Foxp3 유전자가 넉 다운된 수지상 세포를 포함하는 암 예방 또는 치료용 약제학적 조성물

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100291677A1 (en) * 2007-08-24 2010-11-18 Keio University Reducer of immunosuppression by tumor cell and antitumor agent using the same
WO2012112079A1 (en) * 2011-02-14 2012-08-23 Vitaspero, Inc. IMPROVING CELLULAR IMMUNOTHERAPEUTIC VACCINES EFFICACY WITH GENE SUPPRESSION IN DENDRITIC CELLS AND T-LYMPHOCYTES USING SiRNA
KR20150113906A (ko) * 2014-03-31 2015-10-08 연세대학교 산학협력단 ＧＭ－ＣＳＦ 유전자； 데코린 유전자；ＴＧＦ－β２ 발현을 억제하는 ｓｈＲＮＡ； 및 ＦｏｘＰ３ 발현을 억제하는 ｓｈＲＮＡ를 포함하는 항종양 조성물
KR20160026034A (ko) * 2014-08-29 2016-03-09 성균관대학교산학협력단 Foxp3 유전자가 넉 다운된 수지상 세포를 포함하는 암 예방 또는 치료용 약제학적 조성물

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
FACCIABENE, A. ET AL.: "T-regulatory cells: key players in tumor immune escape and angiogenesis", CANCER RESEARCH, vol. 72, no. 9, 2012, pages 2162 - 2171, XP055044575, DOI: 10.1158/0008-5472.CAN-11-3687 *
ZHANG, S. ET AL.: "Analysis of CD 8+ Treg cells in patients with ovarian cancer: a possible mechanism for immune impairment", CELLULAR & MOLECULAR IMMUNOLOGY, vol. 12, no. 5, 2015, pages 580 - 591, XP055640516 *

Also Published As

Publication number Publication date
US20200181273A1 (en) 2020-06-11
CN110573181A (zh) 2019-12-13
JP2020518569A (ja) 2020-06-25
KR20190140999A (ko) 2019-12-20

Similar Documents

Publication Publication Date Title
Poggio et al. Suppression of exosomal PD-L1 induces systemic anti-tumor immunity and memory
Qian et al. TLR2 promotes glioma immune evasion by downregulating MHC class II molecules in microglia
Xiao et al. The kinase TBK1 functions in dendritic cells to regulate T cell homeostasis, autoimmunity, and antitumor immunity
Hogstad et al. RAF/MEK/extracellular signal–related kinase pathway suppresses dendritic cell migration and traps dendritic cells in Langerhans cell histiocytosis lesions
Oda et al. A Fas-4-1BB fusion protein converts a death to a pro-survival signal and enhances T cell therapy
Liu et al. Role of CD4+ CD25+ regulatory T cells in melatonin‐mediated inhibition of murine gastric cancer cell growth in vivo and in vitro
KR20170121178A (ko) 보편적인 살해 t-세포
Lau et al. Intravital imaging of adoptive T-cell morphology, mobility and trafficking following immune checkpoint inhibition in a mouse melanoma model
Ding et al. Cellular immunotherapy as maintenance therapy prolongs the survival of the patients with small cell lung cancer
Ahmed et al. Differential expression of mannose-6-phosphate receptor regulates T cell contraction
Rovira et al. Cyclosporine A Inhibits the T-bet–Dependent Antitumor Response of CD8+ T Cells
Li et al. Bcl6 preserves the suppressive function of regulatory T cells during tumorigenesis
Beck et al. Dynamics of circulating γδ T cell activity in an immunocompetent mouse model of high-grade glioma
Ureshino Treatment-free remission and immunity in chronic myeloid leukemia
Wells et al. Let-7 enhances murine anti-tumor CD8 T cell responses by promoting memory and antagonizing terminal differentiation
Takahashi et al. Surgical influence of pancreatectomy on the function and count of circulating dendritic cells in patients with pancreatic cancer
Brunell et al. Exhausted T cells hijacking the cancer-immunity cycle: Assets and liabilities
Larsen Cellular immune responses towards regulatory cells
US10815457B2 (en) Active CXCR4+ immune cells and methods for their production and use
Larmonier et al. Chaperone-rich tumor cell lysate-mediated activation of antigen-presenting cells resists regulatory T cell suppression
Wei et al. Combination therapy of HIFα inhibitors and Treg depletion strengthen the anti‐tumor immunity in mice
WO2019177200A1 (ko) Foxp3를 발현하는 수지상 세포의 암의 진단 또는 치료를 위한 용도
CN112513069A (zh) 具有对于验证的靶标的二次归巢激活的趋化因子反应性激活的自然杀伤细胞
Hatae et al. Enhancing CAR-T cell metabolism to overcome hypoxic conditions in the brain tumor microenvironment
Gao et al. BMSCs improve TNBS-induced colitis in rats by inducing Treg differentiation by expressing PD-L1

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 2019558751

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18910112

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 20197034995

Country of ref document: KR

Kind code of ref document: A

122 Ep: pct application non-entry in european phase

Ref document number: 18910112

Country of ref document: EP

Kind code of ref document: A1