WO2019099838A1 - Combination therapies - Google Patents
Combination therapies Download PDFInfo
- Publication number
- WO2019099838A1 WO2019099838A1 PCT/US2018/061534 US2018061534W WO2019099838A1 WO 2019099838 A1 WO2019099838 A1 WO 2019099838A1 US 2018061534 W US2018061534 W US 2018061534W WO 2019099838 A1 WO2019099838 A1 WO 2019099838A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- inhibitor
- combination
- cancer
- chosen
- csf
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/16—Amides, e.g. hydroxamic acids
- A61K31/18—Sulfonamides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/4427—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
- A61K31/4439—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39541—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
Definitions
- T cells The ability of T cells to mediate an immune response against an antigen requires two distinct signaling interactions (Viglietta et al. (2007) Neurotherapeutics 4:666-675; Korman et al. (2007) Adv. Immunol.90:297-339).
- APC antigen-presenting cells
- TCR T cell receptor
- the immune system is tightly controlled by a network of costimulatory and co-inhibitory ligands and receptors. These molecules provide the second signal for T cell activation and provide a balanced network of positive and negative signals to maximize immune responses against infection, while limiting immunity to self (Wang et al. (2011) J. Exp. Med.208(3):577-92; Lepenies et al. (2008) Endocrine, Metabolic & Immune Disorders--Drug Targets 8:279-288).
- costimulatory signals include the binding between the B7.1 (CD80) and B7.2 (CD86) ligands of the APC and the CD28 and CTLA-4 receptors of the CD4 + T-lymphocyte (Sharpe et al. (2002) Nature Rev.
- B7 Superfamily a group of related B7 molecules, also known as the “B7 Superfamily” (Coyle et al. (2001) Nature Immunol.2(3):203-209; Sharpe et al. (2002) Nature Rev. Immunol.2:116-126; Collins et al. (2005) Genome Biol.6:223.1-223.7; Korman et al. (2007) Adv.
- B7 Superfamily Several members of the B7 Superfamily are known, including B7.1 (CD80), B7.2 (CD86), the inducible co-stimulator ligand (ICOS-L), the programmed death-1 ligand (PD-L1; B7-H1), the programmed death-2 ligand (PD-L2; B7-DC), B7-H3, B7-H4 and B7-H6 (Collins et al. (2005) Genome Biol.6:223.1-223.7).
- the Programmed Death 1 (PD-1) protein is an inhibitory member of the extended CD28/CTLA-4 family of T cell regulators (Okazaki et al. (2002) Curr Opin Immunol 14: 391779-82; Bennett et al. (2003) J. Immunol.170:711-8).
- Two ligands for PD-1 have been identified, PD-L1 (B7-H1) and PD-L2 (B7-DC), that have been shown to downregulate T cell activation upon binding to PD-1 (Freeman et al. (2000) J. Exp. Med.192:1027-34; Carter et al. (2002) Eur. J. Immunol.32:634-43).
- PD-L1 is abundant in a variety of human cancers (Dong et al. (2002) Nat. Med.8:787-9).
- PD-1 is known as an immunoinhibitory protein that negatively regulates TCR signals (Ishida, Y. et al. (1992) EMBO J.11:3887-3895; Blank, C. et al. (Epub 2006 Dec.29) Immunol. Immunother.
- the interaction between PD-1 and PD-L1 can act as an immune checkpoint, which can lead to, e.g., a decrease in tumor infiltrating lymphocytes, a decrease in T-cell receptor mediated proliferation, and/or immune evasion by cancerous cells (Dong et al. (2003) J. Mol. Med.81:281-7; Blank et al. (2005) Cancer Immunol. Immunother.54:307-314; Konishi et al. (2004) Clin. Cancer Res.10:5094- 100).
- Immune suppression can be reversed by inhibiting the local interaction of PD-1 with PD-L1 or PD- L2; the effect is additive when the interaction of PD-1 with PD-L2 is blocked as well (Iwai et al. (2002) Proc. Nat'l. Acad. Sci. USA 99:12293-7; Brown et al. (2003) J. Immunol.170:1257-66).
- GITR Glucocorticoid-induced TNFR-related protein
- TNFRSF Tumor Necrosis Factor Superfamily
- GITR expression is detected constitutively on murine and human CD4+CD25+ regulatory T cells which can be further increased upon activation.
- effector CD4+CD25- T cells and CD8+CD25- T cells express low to undetectable levels of GITR, which is rapidly upregulated following T cell receptor activation.
- Expression of GITR has also been detected on activated NK cells, dendritic cells, and macrophages.
- Signal transduction pathway downstream of GITR has been shown to involve MAPK and the canonical NF ⁇ B pathways.
- TRAF family members have been implicated as signaling intermediates downstream of GITR (Nocentini et al. (2005) Eur. J. Immunol.35:1016-1022).
- GITR GITR-induced tumor-specific immunity
- An agonistic monoclonal antibody against mouse GITR effectively induced tumor-specific immunity and eradicated established tumors in a mouse syngeneic tumor model (Ko et al. (2005) J. Exp. Med.202:885-891).
- combination therapies e.g., a combination comprising two or more (e.g., two, three, four, five, six, or more) therapeutic agents disclosed herein.
- the therapeutic agents can be chosen from one or more of: an inhibitor of an inhibitory molecule (e.g., an inhibitor of a checkpoint inhibitor), an activator of a costimulatory molecule, a chemotherapeutic agent, a targeted anti-cancer therapy, an oncolytic drug, a cytotoxic agent, or any of the therapeutic agents disclosed herein.
- the therapeutic agent can be chosen from: a PD-1 inhibitor, a LAG-3 inhibitor, a TIM-3 inhibitor, a GITR agonist, a SERD, a CDK4/6 inhibitor, a CXCR2 inhibitor, a CSF-1/1R binding agent, a c-MET inhibitor, a TGF- ⁇ inhibitor, an A2aR antagonist, an IDO inhibitor, a STING agonist, a Galectin inhibitor, a MEK inhibitor, an IL-15/IL-15RA complex, an IL-1 ⁇ inhibitor, an MDM2 inhibitor, or any combination thereof.
- the combinations described herein can provide a beneficial effect, e.g., in the treatment of a cancer, such as an enhanced anti-cancer effect, reduced toxicity, and/or reduced side effects.
- a first therapeutic agent e.g., any of the therapeutic agents disclosed herein
- a second therapeutic agent e.g., the one or more additional therapeutic agents, or all
- compositions and methods for treating proliferative disorders, including cancer, using the aforesaid combination therapies are disclosed.
- the disclosure features a method of treating (e.g., inhibiting, reducing, ameliorating, or preventing) a disorder, e.g., a hyperproliferative condition or disorder (e.g., a cancer) in a subject.
- the method includes administering to the subject a combination comprising three or more (e.g., four, five, six, seven, eight, or more) therapeutic agents disclosed herein.
- the therapeutic agent is chosen from: a PD-1 inhibitor, a LAG-3 inhibitor, a TIM-3 inhibitor, a GITR agonist, a SERD, a CDK4/6 inhibitor, a CXCR2 inhibitor, a CSF-1/1R binding agent, a c-MET inhibitor, a TGF- ⁇ inhibitor, an A2aR antagonist, an IDO inhibitor, a STING agonist, a Galectin inhibitor, a MEK inhibitor, an IL-15/IL-15RA complex, an IL-1 ⁇ inhibitor, an MDM2 inhibitor, or any combination thereof.
- the cancer is chosen from a breast cancer (e.g., a triple negative breast cancer), a pancreatic cancer, a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC)), a skin cancer, a gastric cancer, a gastroesophageal cancer, or an ER+ cancer.
- the skin cancer is a melanoma (e.g., a refractory melanoma).
- the ER+ cancer is an ER+ breast cancer.
- the combination comprises:
- a PD-1 inhibitor (i) a PD-1 inhibitor, a SERD, and a CDK4/6 inhibitor, e.g., to treat an ER+ cancer or a breast cancer;
- a PD-1 inhibitor (ii) a PD-1 inhibitor, a CXCR2 inhibitor, a CSF-1/1R binding agent, and optionally, one or more (e.g., two or all) of a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a pancreatic cancer or a colorectal cancer;
- a PD-1 inhibitor (iii) a PD-1 inhibitor, a CXCR2 inhibitor, and one or more (e.g., two or all) of a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a pancreatic cancer or a colorectal cancer;
- a PD-1 inhibitor (iv) a PD-1 inhibitor, a GITR agonist, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor, e.g., to treat a pancreatic cancer, a colorectal cancer, or a melanoma;
- a PD-1 inhibitor (v) a PD-1 inhibitor, a LAG-3 inhibitor, a GITR agonist, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor, e.g., to treat a pancreatic cancer, a colorectal cancer, or a melanoma;
- a PD-1 inhibitor an A2aR antagonist, and one or both of a TGF- ⁇ inhibitor or a CSF-1/1R binding agent, e.g., to treat a pancreatic cancer, a colorectal cancer, or a melanoma;
- a PD-1 inhibitor e.g., a PD-1 inhibitor, a c-MET inhibitor, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor, e.g., to treat a pancreatic cancer, a colorectal cancer, a gastric cancer, or a melanoma;
- a PD-1 inhibitor (viii) a PD-1 inhibitor, an IDO inhibitor, and one or more (e.g., two, three, four, or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, a CSF-1/1R binding agent, a c-MET inhibitor, or a GITR agonist, e.g., to treat a pancreatic cancer, a colorectal cancer, a gastric cancer, or a melanoma;
- a PD-1 inhibitor (ix) a PD-1 inhibitor, a LAG-3 inhibitor, and one or more (e.g., two three, four, five, six or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, an IL-1 ⁇ inhibitor, a MEK inhibitor, a GITR agonist or a CSF-1/1R binding agent, e.g., to treat a breast cancer, e.g., a triple negative breast cancer (TNBC);
- TNBC triple negative breast cancer
- a PD-1 inhibitor a CSF-1/1R binding agent, and one or more of (e.g., two, three, or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, or an IL-1 ⁇ inhibitor, e.g., to treat a breast cancer (e.g., a TNBC);
- a PD-1 inhibitor e.g., an A2aR antagonist, and one or more (e.g., two three, four, five, or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, an IL-1 ⁇ inhibitor, an IL-15/IL-15RA complex, or a CSF-1/1R binding agent, e.g., to treat a breast cancer (e.g., a TNBC), a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a breast cancer e.g., a TNBC
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- MSS CRC microsatellite stable colorectal cancer
- a PD-1 inhibitor e.g., an IL-1 ⁇ inhibitor, and one or more of (e.g., two, three, four or more) of a TGF- ⁇ inhibitor, an IL-15/IL-15RA complex, a c-MET inhibitor, a CSF-1/1R binding agent, or a TIM-3 inhibitor, e.g., to treat a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- a PD-1 inhibitor e.g., a MEK inhibitor, and one or more of (e.g., two, three, four or more) of a TGF- ⁇ inhibitor, an IL-15/IL-15RA complex, a c-MET inhibitor, a CSF-1/1R binding agent, or a TIM-3 inhibitor, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- an IL-1 ⁇ inhibitor an A2aR antagonist, and one or both of an IL-15/IL-15Ra complex or a TGF- ⁇ inhibitor, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- xv an IL-15/IL-15Ra complex, and a TGF- ⁇ inhibitor, and one or more of (e.g., two, three, or more of) an IL-1 ⁇ inhibitor, a CSF-1/1R binding agent, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- a PD-1 inhibtior and a TIM-3 inhibitor, and one or more of (e.g., both), a STING agonist, or a CSF-1/1R binding agent, e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer;
- a PD-1 inhibitor a TIM-3 inhibitor and an A2aR antagonist, and one or more of (e.g., both) a CSF-1/1R binding agent or a TGF- ⁇ inhibitor, e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer;
- a Galectin inhibitor e.g., one or more of (e.g., both), a Galectin 1 inhibitor or a Galectin 3 inhibitor, and a PD-1 inhibitor, e.g., to treat a solid tumor or a hematological malignancy; or
- a PD-1 inhibitor and CXCR2 inhibitor e.g., to treat a solid tumor, e.g., a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC)), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)) or a breast cancer (e.g., a TNBC).
- a solid tumor e.g., a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC)
- a lung cancer e.g., a non-small cell lung cancer (NSCLC)
- NNBC non-small cell lung cancer
- the invention features a method of reducing an activity (e.g., growth, survival, or viability, or all), of a hyperproliferative (e.g., a cancer) cell.
- the method includes contacting the cell with a combination comprising three or more (e.g., four, five, six, seven, eight, or more) therapeutic agents disclosed herein.
- the therapeutic agent is chosen from: a PD-1 inhibitor, a LAG-3 inhibitor, a TIM-3 inhibitor, a GITR agonist, a SERD, a CDK4/6 inhibitor, a CXCR2 inhibitor, a CSF-1/1R binding agent, a c-MET inhibitor, a TGF- ⁇ inhibitor, an A2aR antagonist, an IDO inhibitor, a STING agonist, a Galectin inhibitor, a MEK inhibitor, an IL-15/IL-15RA complex, an IL-1 ⁇ inhibitor, an MDM2 inhibitor, or any combination thereof.
- the combination comprises:
- a PD-1 inhibitor (ii) a PD-1 inhibitor, a CXCR2 inhibitor, a CSF-1/1R binding agent, and optionally, one or more (e.g., two or all) of a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist;
- a PD-1 inhibitor (iii) a PD-1 inhibitor, a CXCR2 inhibitor, and one or more (e.g., two or all) of a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist;
- a PD-1 inhibitor (iv) a PD-1 inhibitor, a GITR agonist, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor;
- a PD-1 inhibitor (v) a PD-1 inhibitor, a LAG-3 inhibitor, a GITR agonist, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor;
- a PD-1 inhibitor (vi) a PD-1 inhibitor, an A2aR antagonist, and one or both of a TGF- ⁇ inhibitor or a CSF-1/1R binding agent;
- a PD-1 inhibitor (vii) a PD-1 inhibitor, a c-MET inhibitor, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor;
- a PD-1 inhibitor (viii) a PD-1 inhibitor, an IDO inhibitor, and one or more (e.g., two, three, four, or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, a CSF-1/1R binding agent, a c-MET inhibitor, or a GITR agonist;
- a PD-1 inhibitor (ix) a PD-1 inhibitor, a LAG-3 inhibitor, and one or more (e.g., two three, four, five, six or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, an IL-1 ⁇ inhibitor, a MEK inhibitor, a GITR agonist or a CSF-1/1R binding agent, e.g., to treat a breast cancer, e.g., a triple negative breast cancer (TNBC);
- TNBC triple negative breast cancer
- a PD-1 inhibitor a CSF-1/1R binding agent, and one or more of (e.g., two, three, or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, or an IL-1 ⁇ inhibitor, e.g., to treat a breast cancer (e.g., a TNBC);
- a PD-1 inhibitor e.g., an A2aR antagonist, and one or more (e.g., two three, four, five, or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, an IL-1 ⁇ inhibitor, an IL-15/IL-15RA complex, or a CSF-1/1R binding agent, e.g., to treat a breast cancer (e.g., a TNBC), a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a breast cancer e.g., a TNBC
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- MSS CRC microsatellite stable colorectal cancer
- a PD-1 inhibitor, an IL-1 ⁇ inhibitor, and one or more of (e.g., two, three, four or more) of a TGF- ⁇ inhibitor, an IL-15/IL-15RA complex, a c-MET inhibitor, a CSF-1/1R binding agent, or a TIM-3 inhibitor e.g., to treat a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- a PD-1 inhibitor, a MEK inhibitor and one or more of (e.g., two, three, four or more) of a a TGF- ⁇ inhibitor, an IL-15/IL-15RA complex, a c-MET inhibitor, a CSF-1/1R binding
- an IL-1 ⁇ inhibitor an A2aR antagonist, and one or both of an IL-15/IL-15Ra complex or a TGF- ⁇ inhibitor, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- xv an IL-15/IL-15Ra complex, and a TGF- ⁇ inhibitor, and one or more of (e.g., two, three, or more) of an IL-1 ⁇ inhibitor, a CSF-1/1R binding agent, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- a PD-1 inhibtior and a TIM-3 inhibitor, and one or more of (e.g., both), a STING agonist, or a CSF-1/1R binding agent, e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer;
- a PD-1 inhibitor a TIM-3 inhibitor and an A2aR antagonist, and one or more of (e.g., both) a CSF-1/1R binding agent or a TGF- ⁇ inhibitor, e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer;
- a Galectin inhibitor e.g., one or more of (e.g., both), a Galectin 1 inhibitor or a Galectin 3 inhibitor, and a PD-1 inhibitor, e.g., to treat a solid tumor or a hematological malignancy; or
- a PD-1 inhibitor and CXCR2 inhibitor e.g., to treat a solid tumor, e.g., a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC)), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)) or a breast cancer (e.g., a TNBC).
- a solid tumor e.g., a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC)
- a lung cancer e.g., a non-small cell lung cancer (NSCLC)
- NNBC breast cancer
- the method can be performed in a subject, e.g., as part of a therapeutic protocol.
- the cell can be a cancer cell, e.g., a cell from a cancer described herein, e.g., a breast cancer, a pancreatic cancer, a colorectal cancer (CRC), a skin cancer, a gastric cancer, a gastroesophageal cancer, or an ER+ cancer.
- the skin cancer is a melanoma (e.g., a refractory melanoma).
- the ER+ cancer is an ER+ breast cancer.
- the breast cancer is a TNBC.
- the CRC is a MSS CRC.
- a combination described herein is administered to a subject having a cancer, e.g., a cancer described herein.
- the cancer has a high mutational burden, e.g., as disclosed in Alexandrov L.B. et al., (2013) Nature 500, 415–421 and Chalmers Z.R., et al., (2017) Genome Medicine 9:34.
- the cancer is a breast cancer, a pancreatic cancer, a colorectal cancer (CRC), a skin cancer, a gastric cancer, a gastroesophageal cancer, or an ER+ cancer.
- the skin cancer is a melanoma (e.g., a refractory melanoma).
- the ER+ cancer is an ER+ breast cancer.
- the breast cancer is a TNBC.
- the CRC is a MSS CRC.
- the method further includes determining one or more biomarkers (e.g., one or more biomarkers disclosed herein) in the subject.
- the biomarker is determined in vivo, e.g., non-invasively.
- the biomarker is determined in a sample (e.g., a tumor biopsy) acquired from the subject.
- a combination of the therapeutic agents disclosed herein is administered to the subject.
- the invention features a composition (e.g., one or more compositions or dosage forms), that includes a combination comprising three or more (e.g., four, five, six, seven, eight, or more) therapeutic agents disclosed herein.
- the therapeutic agent is chosen from: a PD-1 inhibitor, a LAG-3 inhibitor, a TIM-3 inhibitor, a GITR agonist, a SERD, a CDK4/6 inhibitor, a CXCR2 inhibitor, a CSF-1/1R binding agent, a c-MET inhibitor, a TGF- ⁇ inhibitor, an A2aR antagonist, an IDO inhibitor, a STING agonist, a Galectin inhibitor, a MEK inhibitor, an IL-15/IL-15RA complex, an IL-1 ⁇ inhibitor, an MDM2 inhibitor, or any combination thereof.
- the combination comprises:
- a PD-1 inhibitor (ii) a PD-1 inhibitor, a CXCR2 inhibitor, a CSF-1/1R binding agent, and optionally, one or more (e.g., two or all) of a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist;
- a PD-1 inhibitor (iii) a PD-1 inhibitor, a CXCR2 inhibitor, and one or more (e.g., two or all) of a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist;
- a PD-1 inhibitor (iv) a PD-1 inhibitor, a GITR agonist, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor;
- a PD-1 inhibitor (v) a PD-1 inhibitor, a LAG-3 inhibitor, a GITR agonist, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor;
- a PD-1 inhibitor (vi) a PD-1 inhibitor, an A2aR antagonist, and one or both of a TGF- ⁇ inhibitor or a CSF-1/1R binding agent;
- a PD-1 inhibitor (vii) a PD-1 inhibitor, a c-MET inhibitor, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor;
- TNBC triple negative breast cancer
- a PD-1 inhibitor a CSF-1/1R binding agent, and one or more of (e.g., two, three, or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, or an IL-1 ⁇ inhibitor, e.g., to treat a breast cancer (e.g., a TNBC);
- a PD-1 inhibitor e.g., an A2aR antagonist, and one or more (e.g., two three, four, five, or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, an IL-1 ⁇ inhibitor, an IL-15/IL-15RA complex, or a CSF-1/1R binding agent, e.g., to treat a breast cancer (e.g., a TNBC), a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a breast cancer e.g., a TNBC
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- MSS CRC microsatellite stable colorectal cancer
- a PD-1 inhibitor e.g., an IL-1 ⁇ inhibitor, and one or more of (e.g., two, three, four or more) of a TGF- ⁇ inhibitor, an IL-15/IL-15RA complex, a c-MET inhibitor, a CSF-1/1R binding agent, or a TIM-3 inhibitor, e.g., to treat a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- a PD-1 inhibitor e.g., a MEK inhibitor, and one or more of (e.g., two, three, four or more) of a TGF- ⁇ inhibitor, an IL-15/IL-15RA complex, a c-MET inhibitor, a CSF-1/1R binding agent, or a TIM-3 inhibitor, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- an IL-1 ⁇ inhibitor an A2aR antagonist, and one or both of an IL-15/IL-15Ra complex or a TGF- ⁇ inhibitor, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- xv an IL-15/IL-15Ra complex, and a TGF- ⁇ inhibitor, and one or more of (e.g., two, three, or more) of an IL-1 ⁇ inhibitor, a CSF-1/1R binding agent, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a
- a PD-1 inhibtior and a TIM-3 inhibitor, and one or more of (e.g., both), a STING agonist, or a CSF-1/1R binding agent, e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer;
- a PD-1 inhibitor a TIM-3 inhibitor and an A2aR antagonist, and one or more of (e.g., both) a CSF-1/1R binding agent or a TGF- ⁇ inhibitor, e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer;
- a Galectin inhibitor e.g., one or more of (e.g., both), a Galectin 1 inhibitor or a Galectin 3 inhibitor, and a PD-1 inhibitor, e.g., to treat a solid tumor or a hematological malignancy; or (xix) a PD-1 inhibitor and CXCR2 inhibitor, e.g., to treat a solid tumor, e.g., a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC)), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)) or a breast cancer (e.g., a TNBC).
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC)
- a lung cancer e.g., a non-small cell lung cancer (NSCLC)
- a breast cancer e.g., a
- the disclosure features a composition (e.g., one or more compositions or dosage forms as described herein), for use in treating a disorder, e.g., a cancer.
- the composition for use includes a composition (e.g., one or more compositions or dosage forms), that includes a combination comprising three or more (e.g., four, five, six, seven, eight, or more) therapeutic agents disclosed herein.
- the therapeutic agent is chosen from: a PD-1 inhibitor, a LAG-3 inhibitor, a TIM-3 inhibitor, a GITR agonist, a SERD, a CDK4/6 inhibitor, a CXCR2 inhibitor, a CSF-1/1R binding agent, a c-MET inhibitor, a TGF- ⁇ inhibitor, an A2aR antagonist, an IDO inhibitor, a STING agonist, a Galectin inhibitor, a MEK inhibitor, an IL-15/IL-15RA complex, an IL-1 ⁇ inhibitor, an MDM2 inhibitor, or any combination thereof.
- the cancer is chosen from a breast cancer, a pancreatic cancer, a colorectal cancer (CRC), a skin cancer, a gastric cancer, a gastroesophageal cancer, or an ER+ cancer.
- the skin cancer is a melanoma (e.g., a refractory melanoma).
- the ER+ cancer is an ER+ breast cancer.
- the breast cancer is a TNBC.
- the CRC is a MSS CRC.
- the combination comprises:
- a PD-1 inhibitor (i) a PD-1 inhibitor, a SERD, and a CDK4/6 inhibitor, e.g., to treat an ER+ cancer or a breast cancer;
- a PD-1 inhibitor (ii) a PD-1 inhibitor, a CXCR2 inhibitor, a CSF-1/1R binding agent, and optionally, one or more (e.g., two or all) of a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a pancreatic cancer or a colorectal cancer;
- a PD-1 inhibitor (iii) a PD-1 inhibitor, a CXCR2 inhibitor, and one or more (e.g., two or all) of a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a pancreatic cancer or a colorectal cancer;
- a PD-1 inhibitor (iv) a PD-1 inhibitor, a GITR agonist, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor, e.g., to treat a pancreatic cancer, a colorectal cancer, or a melanoma;
- a PD-1 inhibitor (v) a PD-1 inhibitor, a LAG-3 inhibitor, a GITR agonist, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor, e.g., to treat a pancreatic cancer, a colorectal cancer, or a melanoma;
- a PD-1 inhibitor, an A2aR antagonist, and one or both of a TGF- ⁇ inhibitor or a CSF-1/1R binding agent e.g., to treat a pancreatic cancer, a colorectal cancer, or a melanoma
- a PD-1 inhibitor, a c-MET inhibitor, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor e.g., to treat a pancreatic cancer, a colorectal cancer, a gastric cancer, or a melanoma;
- a PD-1 inhibitor (viii) a PD-1 inhibitor, an IDO inhibitor, and one or more (e.g., two, three, four, or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, a CSF-1/1R binding agent, a c-MET inhibitor, or a GITR agonist, e.g., to treat a pancreatic cancer, a colorectal cancer, a gastric cancer, or a melanoma;
- a PD-1 inhibitor (ix) a PD-1 inhibitor, a LAG-3 inhibitor, and one or more (e.g., two three, four, five, six or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, an IL-1 ⁇ inhibitor, a MEK inhibitor or a GITR agonist or a CSF-1/1R binding agent, e.g., to treat a breast cancer, e.g., a triple negative breast cancer (TNBC);
- TNBC triple negative breast cancer
- a PD-1 inhibitor a CSF-1/1R binding agent, and one or more of (e.g., two, three, or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, or an IL-1 ⁇ inhibitor, e.g., to treat a breast cancer (e.g., a TNBC);
- a PD-1 inhibitor e.g., an A2aR antagonist, and one or more (e.g., two three, four, five, or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, an IL-1 ⁇ inhibitor, an IL-15/IL-15RA complex, or a CSF-1/1R binding agent, e.g., to treat a breast cancer (e.g., a TNBC), a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a breast cancer e.g., a TNBC
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- MSS CRC microsatellite stable colorectal cancer
- a PD-1 inhibitor e.g., an IL-1 ⁇ inhibitor, and one or more of (e.g., two, three, four or more) of a TGF- ⁇ inhibitor, an IL-15/IL-15RA complex, a c-MET inhibitor, a CSF-1/1R binding agent, or a TIM-3 inhibitor, e.g., to treat a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- a PD-1 inhibitor a MEK inhibitor, and one or more of (e.g., two, three, four or more) of a a TGF- ⁇ inhibitor, an IL-15/IL-15RA complex, a c-MET inhibitor, a CSF-1/1R binding agent, or a TIM-3 inhibitor, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- an IL-1 ⁇ inhibitor an A2aR antagonist, and one or both of an IL-15/IL-15Ra complex or a TGF- ⁇ inhibitor, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- xv an IL-15/IL-15Ra complex, and a TGF- ⁇ inhibitor, and one or more of (e.g., two, three, or more) of an IL-1 ⁇ inhibitor, a CSF-1/1R binding agent, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- a PD-1 inhibtior, and a TIM-3 inhibitor and one or more of (e.g., both), a STING agonist, or a CSF-1/1R binding agent, e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer
- a PD-1 inhibitor, a TIM-3 inhibitor and an A2aR antagonist and one or more of (e.g., both) a CSF-1/1R binding agent or a TGF- ⁇ inhibitor, e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer
- TGF- ⁇ inhibitor e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer
- a Galectin inhibitor e.g., one or more of (e.g., both), a Galectin 1 inhibitor or a Galectin 3 inhibitor, and a PD-1 inhibitor, e.g., to treat a solid tumor or a hematological malignancy; or
- a PD-1 inhibitor and CXCR2 inhibitor e.g., to treat a solid tumor, e.g., a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC)), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)) or a breast cancer (e.g., a TNBC).
- a solid tumor e.g., a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC)
- a lung cancer e.g., a non-small cell lung cancer (NSCLC)
- NNBC non-small cell lung cancer
- the therapeutic agent is chosen from: a PD-1 inhibitor, a LAG-3 inhibitor, a TIM-3 inhibitor, a GITR agonist, a SERD, a CDK4/6 inhibitor, a CXCR2 inhibitor, a CSF- 1/1R binding agent, a MET inhibitor, a TGF- ⁇ inhibitor, an A2aR antagonist, an IDO inhibitor, a STING agonist, a Galectin inhibitor, a MEK inhibitor, an IL-15/IL-15RA complex, an IL-1 ⁇ inhibitor, an MDM2 inhibitor, or any combination thereof.
- the combination comprises:
- a PD-1 inhibitor (i) a PD-1 inhibitor, a SERD, and a CDK4/6 inhibitor, e.g., to treat an ER+ cancer or a breast cancer;
- a PD-1 inhibitor (ii) a PD-1 inhibitor, a CXCR2 inhibitor, a CSF-1/1R binding agent, and optionally, one or more (e.g., two or all) of a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a pancreatic cancer or a colorectal cancer;
- a PD-1 inhibitor (iii) a PD-1 inhibitor, a CXCR2 inhibitor, and one or more (e.g., two or all) of a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a pancreatic cancer or a colorectal cancer;
- a PD-1 inhibitor (iv) a PD-1 inhibitor, a GITR agonist, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor, e.g., to treat a pancreatic cancer, a colorectal cancer, or a melanoma;
- a PD-1 inhibitor (v) a PD-1 inhibitor, a LAG-3 inhibitor, a GITR agonist, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor, e.g., to treat a pancreatic cancer, a colorectal cancer, or a melanoma;
- a PD-1 inhibitor, an A2aR antagonist, and one or both of a TGF- ⁇ inhibitor or a CSF-1/1R binding agent e.g., to treat a pancreatic cancer, a colorectal cancer, or a melanoma
- a PD-1 inhibitor, a c-MET inhibitor, and one or more (e.g., two or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, or a c-MET inhibitor e.g., to treat a pancreatic cancer, a colorectal cancer, a gastric cancer, or a melanoma;
- a PD-1 inhibitor (viii) a PD-1 inhibitor, an IDO inhibitor, and one or more (e.g., two, three, four, or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, a CSF-1/1R binding agent, a c-MET inhibitor, or a GITR agonist, e.g., to treat a pancreatic cancer, a colorectal cancer, a gastric cancer, or a melanoma;
- a PD-1 inhibitor (ix) a PD-1 inhibitor, a LAG-3 inhibitor, and one or more (e.g., two three, four, five, six or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, an IL-1 ⁇ inhibitor, a MEK inhibitor, a GITR agonist or a CSF-1/1R binding agent, e.g., to treat a breast cancer, e.g., a triple negative breast cancer (TNBC);
- TNBC triple negative breast cancer
- a PD-1 inhibitor a CSF-1/1R binding agent, and one or more of (e.g., two, three, or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, or an IL-1 ⁇ inhibitor, e.g., to treat a breast cancer (e.g., a TNBC);
- a PD-1 inhibitor e.g., an A2aR antagonist, and one or more (e.g., two three, four, five, or all) of a TGF- ⁇ inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, an IL-1 ⁇ inhibitor, an IL-15/IL-15RA complex, or a CSF-1/1R binding agent, e.g., to treat a breast cancer (e.g., a TNBC), a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a breast cancer e.g., a TNBC
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- MSS CRC microsatellite stable colorectal cancer
- a PD-1 inhibitor e.g., an IL-1 ⁇ inhibitor, and one or more of (e.g., two, three, four or more) of a TGF- ⁇ inhibitor, an IL-15/IL-15RA complex, a c-MET inhibitor, a CSF-1/1R binding agent, or a TIM-3 inhibitor, e.g., to treat a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- a PD-1 inhibitor e.g., a MEK inhibitor, and one or more of (e.g., two, three, four or more) of a a TGF- ⁇ inhibitor, an IL-15/IL-15RA complex, a c-MET inhibitor, a CSF-1/1R binding agent, or a TIM-3 inhibitor, e.g., to treat a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- an IL-1 ⁇ inhibitor an A2aR antagonist, and one or both of an IL-15/IL-15Ra complex or a TGF- ⁇ inhibitor, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer;
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC), a gastroesophageal cancer or a pancreatic cancer
- xv an IL-15/IL-15Ra complex, and a TGF- ⁇ inhibitor, and one or more of (e.g., two, three, or more) of an IL-1 ⁇ inhibitor, a CSF-1/1R binding agent, a c-MET inhibitor, or an A2aR antagonist, e.g., to treat a a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC), a
- a PD-1 inhibtior, and a TIM-3 inhibitor and one or more of (e.g., both), a STING agonist, or a CSF-1/1R binding agent, e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer
- a PD-l inhibitor, a TIM-3 inhibitor and an A2aR antagonist and one or more of (e.g., both) a CSF-1/1R binding agent or a TGF-b inhibitor, e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer
- TGF-b inhibitor e.g., to treat a solid tumor, e.g., a pancreatic cancer, or a colon cancer
- a Galectin inhibitor e.g., one or more of (e.g., both), a Galectin 1 inhibitor or a Galectin 3 inhibitor, and a PD-l inhibitor, e.g., to beat a solid tumor or a hematological malignancy; or
- a PD-l inhibitor and a CXCR2 inhibitor e.g., to treat a solid tumor, e.g., a colorectal cancer (e.g., a microsatellite stable colorectal cancer (MSS CRC)), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)) or a breast cancer (e.g., a TNBC).
- a colorectal cancer e.g., a microsatellite stable colorectal cancer (MSS CRC)
- a lung cancer e.g., a non-small cell lung cancer (NSCLC)
- NNBC breast cancer
- a method of treating a subject comprises administration of a combination as part of a therapeutic regimen.
- a therapeutic regimen comprises one or more, e.g., two, three, or four combinations described herein.
- the therapeutic regimen is administered to the subject in at least one phase, and optionally two phases, e.g., a first phase and a second phase.
- the first phase comprises a dose escalation phase.
- the first phase comprises one or more dose escalation phases, e.g., a first, second, or third dose escalation phase.
- the dose escalation phase comprises administration of a combination comprising two, three, four, or more therapeutic agents, e.g., as described herein.
- the second phase comprises a dose expansion phase.
- the dose expansion phase comprises administration of a combination comprising two, three, four, or more therapeutic agents, e.g., as described herein.
- the dose expansion phase comprises the same two, three, four, or more therapeutic agents as the dose escalation phase.
- the first dose escalation phase comprises administration of a combination comprising two therapeutic agents, e.g., two therapeutic agents described herein, wherein a maximum tolerated dose (MTD) or recommended dose for expansion (RDE) for one or both of the therapeutic agents of is determined.
- MTD maximum tolerated dose
- RDE recommended dose for expansion
- the second dose escalation phase comprises administration of a combination comprising three therapeutic agents, e.g., three therapeutic agents described herein, wherein a maximum tolerated dose (MTD) or recommended dose for expansion (RDE) for one, two, or all of the therapeutic agents is determined.
- MTD maximum tolerated dose
- RDE recommended dose for expansion
- the second dose escalation phase starts after the first dose escalation phase ends.
- the second dose escalation phase comprises administration of one or more of the therapeutic agents administered in the first dose escalation phase.
- the second dose escalation phase is performed without performing the first dose escalation phase.
- the third dose escalation phase comprises administration of a combination comprising four therapeutic agents, e.g., four therapeutic agents described herein, wherein a maximum tolerated dose (MTD) or recommended dose for expansion (RDE) of one, two, three, or all of the therapeutic agents is determined.
- the third dose escalation phase starts after the first or second dose escalation phase ends.
- the third dose escalation phase comprises administration of one or more (e.g., all) of therapeutic agents administered in the second dose escalation phase.
- the third dose escalation phase comprises administration of one or more of the therapeutic agents administered in the first dose escalation phase.
- the third dose escalation phase is performed without performing the first, second, or both dose escalation phases.
- the first dose escalation phase comprises administration of a PD-1 inhibitor and a LAG-3 inhibitor (e.g., a PD-1 inhibitor and a LAG-3 inhibitor described herein), and the second dose escalationphase can further comprise administration of a GITR agonist, a TIM-3 inhibitor, an IL-1 ⁇ inhibitor, a TGF- ⁇ inhibitor, a c-MET inhibitor, a CSF-1/1R binding agent (e.g., a GITR agonist, a TIM-3 inhibitor, an IL-1 ⁇ inhibitor, a TGF- ⁇ inhibitor, a c-MET inhibitor, or a CSF-1/1R binding agent described herein).
- a GITR agonist, a TIM-3 inhibitor, an IL-1 ⁇ inhibitor, a TGF- ⁇ inhibitor, a c-MET inhibitor e.g., a GITR agonist, a TIM-3 inhibitor, an IL-1 ⁇ inhibitor, a TGF- ⁇ inhibitor, a c-MET inhibitor, or a CSF
- the first dose escalation phase comprises administration of an A2aR antagonist (e.g., an A2aR antagonist described herein), and a GITR agonist, a TIM-3 inhibitor, an IL-1 ⁇ inhibitor, a TGF- ⁇ inhibitor, a c-MET inhibitor, or a CSF-1/1R binding agent (e.g., a GITR agonist, a TIM-3 inhibitor, an IL-1 ⁇ inhibitor, a TGF- ⁇ inhibitor, a c-MET inhibitor, or a CSF-1/1R binding agent described herein).
- an A2aR antagonist e.g., an A2aR antagonist described herein
- a GITR agonist, a TIM-3 inhibitor an IL-1 ⁇ inhibitor, a TGF- ⁇ inhibitor, a c-MET inhibitor, or a CSF-1/1R binding agent described herein.
- the first dose escalation phase comprises administration of a PD-1 inhibitor, a LAG-3 inhibitor, and a GITR agonist (e.g., a PD-1 inhibitor, a LAG-3 inhibitor and a GITR agonist described herein), and the second dose escalationphase can further comprise administration of a TIM-3 inhibitor, an IL-1 ⁇ inhibitor, a TGF- ⁇ inhibitor, a c-MET inhibitor, or a CSF-1/1R binding agent (e.g., a GITR agonist, a TIM-3 inhibitor, an IL-1 ⁇ inhibitor, a TGF- ⁇ inhibitor, a c-MET inhibitor, or a CSF-1/1R binding agent described herein).
- a GITR agonist e.g., a PD-1 inhibitor, a LAG-3 inhibitor and a GITR agonist described herein
- the second dose escalationphase can further comprise administration of a TIM-3 inhibitor, an IL-1 ⁇ inhibitor, a TGF- ⁇ inhibitor, a
- the dose escalation phase e.g., the first dose escalation phase, comprises administration of a PD-1 inhibitor and a CXCR2 inhibitor (e.g., a PD-1 inhibitor and a CXCR2 inhibitor described herein).
- a PD-1 inhibitor and a CXCR2 inhibitor e.g., a PD-1 inhibitor and a CXCR2 inhibitor described herein.
- a method of treating a subject comprises administering to the subject in need thereof a PD-1 inhibitor (e.g., PDR001) and a CXCR2 inhibitor (e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N- methoxy-N-methylbenzenesulfonamide or a choline salt thereof).
- a PD-1 inhibitor e.g., PDR001
- a CXCR2 inhibitor e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino
- the dose expansion phase starts after the first, second or third dose escalation phase ends.
- the dose expansion phase comprises administration of a combination administered in the dose escalation phase, e.g., the first, second, or third dose escalation phase.
- a biopsy is obtained from a subject in the dose expansion phase.
- the subject is treated for a breast cancer, e.g., a triple-negative breast cancer (TNBC), e.g., advanced or metastatic TNBC.
- TNBC triple-negative breast cancer
- a therapeutic regimen comprising a dose escalation phase and a dose expansion phase allows for entry of new agents or regiments for combination, rapid generation of combinations, and/or assessment of safety and activity of tolerable combinations.
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a SERD (e.g., a SERD described herein), and a CDK4/6 inhibitor (e.g., a CDK4/6 inhibitor described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a SERD e.g., a SERD described herein
- CDK4/6 inhibitor e.g., a CDK4/6 inhibitor described herein
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered at a dose of about 300-400 mg. In embodiments, the PD-1 inhibitor is administered once every 3 weeks. In embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300 mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400 mg once every 4 weeks.
- the SERD is chosen from LSZ102, fulvestrant, brilanestrant, or elacestrant. In some embodiments, the SERD is LSZ102.
- the CDK4/6 inhibitor is chosen from ribociclib, abemaciclib (Eli Lilly), or palbociclib. In some embodiments, the CDK 4/6 inhibitor is ribociclib. In some embodiments, the CDK4/6 inhibitor, e.g., ribociclib, is administered once daily at a dose of about 200-600 mg.
- the CDK4/6 inhibitor is administered once daily at a dose of about 200, 300, 400, 500, or 600 mg, or about 200-300, 300-400, 400-500, or 500-600 mg.
- the CDK4/6 inhibitor e.g., ribociclib
- this treatment is followed by one week of no treatment.
- the CDK4/6 inhibitor e.g., ribociclib
- the CDK4/6 inhibitor is administered in repeated dosing cycles of 3 weeks on and 1 week off, e.g., the compound is administered once daily for 3 weeks (e.g., 21 days), followed by no administration for 1 week (e.g., 7 days), after which the cycle is repeated, e.g., the compound is administered daily for 3 weeks followed by no administration for 1 week.
- the CDK4/6 inhibitor e.g., ribociclib
- the combination comprises PDR001, a SERD described herein, and a CDK4/6 inhibitor described herein. In some embodiments, the combination comprises a PD-1 inhibitor described herein, LSZ102, and a CDK4/6 inhibitor described herein. In some embodiments, the combination comprises a PD-1 inhibitor described herein, a SERD described herein, and ribociclib. In some embodiments, the combination comprises PDR001, LSZ102, and a CDK4/6 inhibitor described herein. In some embodiments, the combination comprises PDR001, a SERD described herein, and ribociclib. In some embodiments, the combination comprises a PD-1 inhibitor described herein, LSZ102, and ribociclib. In some embodiments, the combination comprises PDR001), LSZ102, and ribociclib.
- the combination further comprises a fourth therapeutic agent, e.g., a therapeutic agent described herein.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject or cancer is identified as having a biomarker described herein.
- the cancer is a cancer expressing estrogen receptor (ER+) or a breast cancer, e.g., an ER+ breast cancer.
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a CXCR2 inhibitor (e.g., a CXCR2 inhibitor described herein), and a CSF-1/1R binding agent (e.g., a CSF-1/1R binding agent disclosed herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a CXCR2 inhibitor e.g., a CXCR2 inhibitor described herein
- a CSF-1/1R binding agent e.g., a CSF-1/1R binding agent disclosed herein.
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680 (Medimmune), REGN2810 (Regeneron), TSR-042 (Tesaro), PF-06801591 (Pfizer), BGB-A317
- the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered at a dose of about 300-400 mg. In embodiments, the PD-1 inhibitor is administered once every 3 weeks. In embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300 mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400 mg once every 4 weeks.
- the CXCR2 inhibitor is chosen from 6-chloro-3-((3,4-dioxo-2-(pentan-3- ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt, danirixin, reparixin, or navarixin.
- the CXCR2 inhibitor is 6-chloro-3-((3,4-dioxo- 2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[d]thiazol-6- yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK) (e.g., M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[
- the CSF-1/1R binding agent is BLZ945. In some embodiments, the CSF-1/1R binding agent is MCS110.
- the combination comprises PDR001, a CXCR2 inhibitor described herein, and a CSF-1/1R binding agent disclosed herein. In some embodiments, the combination comprises a PD- 1 inhibitor described herein, a CXCR2 inhibitor described herein, and BLZ945. In some embodiments, the combination comprises PDR001, a CXCR2 inhibitor described herein, and BLZ945.
- the combination comprises PDR001, a CXCR2 inhibitor described herein, and a CSF-1/1R binding agent disclosed herein. In some embodiments, the combination comprises a PD- 1 inhibitor described herein, a CXCR2 inhibitor described herein, and MCS110. In some embodiments, the combination comprises PDR001, a CXCR2 inhibitor described herein, and MCS110.
- the combination further comprises a TIM-3 inhibitor, e.g., a TIM-3 inhibitor disclosed herein.
- the TIM-3 inhibitor is MBG453 (Novartis) or TSR-022 (Tesaro). In some embodiments, the TIM-3 inhibitor is MBG453. In some embodiments, the combination comprises PDR001, a CXCR2 inhibitor described herein, a CSF-1/1R binding agent disclosed herein, and MBG453. In some embodiments, the combination comprises a PD-1 inhibitor described herein, a CXCR2 inhibitor described herein, BLZ945, and MBG453. In some embodiments, the combination comprises a PDR001, a CXCR2 inhibitor described herein, BLZ945, and MBG453. In some embodiments, the combination comprises a PD-1 inhibitor described herein, a CXCR2 inhibitor described herein, MCS110, and
- the combination comprises a PDR001, a CXCR2 inhibitor described herein, MCS110, and MBG453.
- the combination further comprises a c-MET inhibitor, e.g., a c-MET inhibitor disclosed herein.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
- the c-MET inhibitor is capmatinib (INC280).
- the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 100-2000mg, about 200-2000mg, about 200-1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg.
- the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 400mg.
- the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 600mg.
- the combination comprises PDR001, a CXCR2 inhibitor described herein, a CSF-1/1R binding agent disclosed herein, and capmatinib (INC280).
- the combination comprises a PD-1 inhibitor described herein, a CXCR2 inhibitor described herein, BLZ945, and capmatinib (INC280).
- the combination comprises a PDR001, a CXCR2 inhibitor described herein, BLZ945, and capmatinib (INC280).
- the combination comprises a PD-1 inhibitor described herein, a CXCR2 inhibitor described herein, MCS110, and capmatinib (INC280).
- the combination comprises a PDR001, a CXCR2 inhibitor described herein, MCS110, and capmatinib (INC280).
- the combination further comprises an A2aR antagonist, e.g., an A2aR inhibitor disclosed herein.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN-115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the combination comprises PDR001, a CXCR2 inhibitor described herein, a CSF-1/1R binding agent disclosed herein, and PBF509 (NIR178). In some embodiments, the combination comprises a PD-1 inhibitor described herein, a CXCR2 inhibitor described herein, BLZ945, and PBF509 (NIR178). In some embodiments, the combination comprises a PDR001, a CXCR2 inhibitor described herein, BLZ945, and PBF509 (NIR178).
- the combination comprises PDR001, a CXCR2 inhibitor described herein, a CSF-1/1R binding agent disclosed herein, and PBF509 (NIR178). In some embodiments, the combination comprises a PD-1 inhibitor described herein, a CXCR2 inhibitor described herein, MCS110, and PBF509 (NIR178). In some embodiments, the combination comprises a PDR001, a CXCR2 inhibitor described herein, MCS110, and PBF509 (NIR178).
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject or cancer is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a pancreatic cancer or a colorectal cancer (CRC).
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a CXCR2 inhibitor (e.g., a CXCR2 inhibitor described herein), and a third therapeutic agent.
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a CXCR2 inhibitor e.g., a CXCR2 inhibitor described herein
- a third therapeutic agent e.g., a PD-1 inhibitor described herein
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400 mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300 mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400 mg once every 4 weeks.
- the CXCR2 inhibitor is chosen from 6-chloro-3-((3,4-dioxo-2-(pentan-3- ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt, danirixin, reparixin, or navarixin.
- the CXCR2 inhibitor is 6-chloro-3-((3,4-dioxo-2-(pentan-3- ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt.
- the CXCR2 inhibitor is 2-Hydroxy-N,N,N-trimethylethan-1-aminium 3-chloro-6- ( ⁇ 3,4-dioxo-2-[(pentan-3-yl)amino]cyclobut-1-en-1-yl ⁇ amino)-2-(N-methoxy-N- methylsulfamoyl)phenolate (i.e., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)- 2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt).
- the CXCR2 inhibitor is administered at a dose of about 50-1000 mg (e.g., about 50-400 mg, 50-300 mg, 50-200 mg, 50-100 mg, 150-900 mg, 150-600 mg, 200-800 mg, 300-600 mg, 400-500 mg, 300-500 mg, 200-500 mg, 100-500 mg, 100-400 mg, 200-300 mg, 100-200 mg, 250-350 mg, or about 75 mg, 150 mg, 300 mg, 450 mg, or 600mg).
- the CXCR2 inhibitor is administered daily, e.g., twice daily.
- the CXCR2 inhibitor is administered for the first two weeks (e.g., 14 days) in a 4 week cycle (e.g., 28 day cycle). In some embodiments, the CXCR2 inhibitor is administered daily, e.g., twice daily at a total dose of about 50-1000 mg (e.g., about 50-400 mg, 50-300 mg, 50-200 mg, 50-100 mg, 150-900 mg, 150-600 mg, 200-800 mg, 300-600 mg, 400-500 mg, 300-500 mg, 200-500 mg, 100- 500 mg, 100-400 mg, 200-300 mg, 100-200 mg, 250-350 mg, or about 75 mg, 150 mg, 300 mg, 450 mg, or 600mg).
- 50-1000 mg e.g., about 50-400 mg, 50-300 mg, 50-200 mg, 50-100 mg, 150-900 mg, 150-600 mg, 200-800 mg, 300-600 mg, 400-500 mg, 300-500 mg, 200-500 mg, 100- 500 mg, 100-
- the CXCR2 inhibitor is administered twice daily and each dose, e.g., the first and second dose, is in the same amount. In some embodiments, the CXCR2 inhibitor is administered twice daily and each dose, e.g., the first and second dose, comprises about 25-400 mg (e.g., 25-100 mg, 50-200 mg, 75-150, or 100-400 mg) of the CXCR2 inhibitor. In some embodiments, the CXCR2 inhibitor is administered orally twice daily at a dose of 75 mg for two weeks (e.g., 14 days) in a 4 week cycle (e.g., 28 day cycle).
- the CXCR2 inhibitor is administered orally twice daily at a does of 150 mg for two weeks (e.g., 14 days) in a 4 week cycle (e.g., 28 day cycle). In some embodiments, the CXCR2 inhibitor is administered orally twice daily for 2 weeks in a 4 week cycle, e.g., 2 weeks of treatment with the CXCR2 inhibitor and 2 weeks of no treatment in a 4 week cycle.
- the combination comprises PDR001 and a CXCR2 inhibitor described herein (e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N- methoxy-N-methylbenzenesulfonamide choline salt).
- a CXCR2 inhibitor described herein e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N- methoxy-N-methylbenzenesulfonamide choline salt.
- the combination comprises a PD-1 inhibitor (e.g., PDR001) and 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1- yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt.
- the combination comprises PDR001 and 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1- yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt.
- the combination comprises PDR001, a CXCR2 inhibitor described herein (e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide choline salt), and a third therapeutic agent (e.g., a therapeutic agent described herein).
- a CXCR2 inhibitor described herein e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide choline salt
- a third therapeutic agent e.g., a therapeutic agent described herein.
- the third therapeutic agent comprises a TIM-3 inhibitor, e.g., a TIM-3 inhibitor disclosed herein.
- the TIM-3 inhibitor is MBG453 (Novartis) or TSR-022 (Tesaro).
- the TIM-3 inhibitor is MBG453.
- the combination comprises PDR001, a CXCR2 inhibitor described herein, and MBG453.
- third therapeutic agent comprises a c-MET inhibitor, e.g., a c-MET inhibitor disclosed herein.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
- the c-MET inhibitor is capmatinib (INC280).
- the combination comprises PDR001, a CXCR2 inhibitor described herein, and capmatinib (INC280).
- the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 100- 2000mg, about 200-2000mg, about 200-1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg.
- the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 400mg.
- the c-MET inhibitor e.g., INC280
- the third therapeutic agent comprises an A2aR antagonist, e.g., an A2Ar inhibitor disclosed herein.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN-115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the combination comprises PDR001, a CXCR2 inhibitor described herein, and PBF509 (NIR178).
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a CXCR2 inhibitor (e.g., a CXCR2 inhibitor described herein), and one or more (e.g., two or all) of a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein), a c-MET inhibitor (e.g., a c- MET inhibitor described herein), or an A2aR antagonist (e.g., an A2aR antagonist described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a CXCR2 inhibitor e.g., a CXCR2 inhibitor described herein
- one or more e.g., two or all
- a TIM-3 inhibitor e.g., a TIM-3 inhibitor described herein
- a c-MET inhibitor e.g., a c- MET inhibitor described herein
- an A2aR antagonist
- the combination further comprises a fourth therapeutic agent, e.g., a therapeutic agent described herein.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject or cancer is identified as having a biomarker described herein.
- the cancer is, e.g., a solid tumor, e.g., a pancreatic cancer, a breast cancer (e.g., a triple negative breast cancer (TNBC)), a lung cancer (e.g., an NSCLC), or a colorectal cancer (CRC) (e.g., a microsatellite stable colorectal cancer (MSS-CRC).
- a solid tumor e.g., a pancreatic cancer
- a breast cancer e.g., a triple negative breast cancer (TNBC)
- a lung cancer e.g., an NSCLC
- CRC colorectal cancer
- MSS-CRC microsatellite stable colorectal cancer
- the subject in need of the combination e.g., PD-1 inhibitor described herein, and a CXCR2 inhibitor described herein
- the subject in need of the combination is not a patient requiring medications with narrow therapeutic index CYP3A4 substrates.
- the subject in need of the combination e.g., PD-1 inhibitor described herein, and a CXCR2 inhibitor described herein
- is not a patient using any form of hormonal contraception e.g., oral, injected, implanted, or transdermal.
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a GITR agonist (e.g., a GITR agonist described herein), and a third therapeutic agent.
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400 mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300 mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400 mg once every 4 weeks.
- the GITR agonist is chosen from GWN323, BMS-986156, MK-4166, MK-1248, TRX518, INCAGN1876, AMG 228, or INBRX-110. In some embodiments, the GITR agonist is GWN323.
- the combination comprises PDR001 and GWN323.
- the third therapeutic agent comprises a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor disclosed herein.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089.
- the TGF- ⁇ inhibitor is XOMA 089.
- the combination comprises PDR001, a GITR agonist described herein, and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, GWN323, and XOMA 089.
- the combination comprises PDR001, GWN323, and XOMA 089.
- the third therapeutic agent comprises an A2aR antagonist, e.g., an A2Ar inhibitor disclosed herein.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN-115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the combination comprises PDR001, a GITR agonist described herein, and PBF509 (NIR178). In some embodiments, the combination comprises a PD-1 inhibitor described herein, GWN323, and PBF509 (NIR178). In some embodiments, the combination comprises PDR001, GWN323, and PBF509 (NIR178).
- the third therapeutic agent comprises a c-MET inhibitor, e.g., a c-MET inhibitor disclosed herein.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
- the c-MET inhibitor is capmatinib (INC280).
- the combination comprises PDR001, a GITR agonist described herein, and capmatinib (INC280).
- the combination comprises a PD-1 inhibitor described herein, GWN323, and capmatinib (INC280). In some embodiments, the combination comprises PDR001, GWN323, and capmatinib (INC280).
- the c-MET inhibitor e.g., INC280
- the c-MET inhibitor is administered twice a day at a dose of about 100-2000mg, about 200-2000mg, about 200-1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg.
- the c-MET inhibitor e.g., INC280
- the c-MET inhibitor is administered twice a day at a dose of about 400mg.
- the c-MET inhibitor e.g., INC280
- the third therapeutic agent comprises a TIM-3 inhibitor, e.g., a TIM-3 inhibitor disclosed herein.
- the TIM-3 inhibitor is chosen from MBG453 or TSR- 022.
- the TIM-3 inhibitor is MBG453.
- the combination comprises PDR001, a GITR agonist described herein, and MBG453.
- the combination comprises a PD-1 inhibitor described herein, GWN323, and MBG453.
- the combination comprises PDR001, GWN323, and MBG453.
- the third therapeutic agent comprises a LAG-3 inhibitor, e.g., a LAG-3 inhibitor disclosed herein.
- the LAG-3 inhibitor is chosen from LAG525, BMS- 986016, or TSR-033. In some embodiments, the LAG-3 inhibitor is LAG525.
- the LAG-3 inhibitor is administered at a dose of about 300 to about 500 mg, about 400mg to about 800mg, or about 700 to about 900 mg. In some embodiments, the LAG-3 inhibitor is administered once every 3 weeks. In some embodiments, the LAG-3 inhibitor is administered once every 4 weeks. In other embodiments, the LAG-3 inhibitor is administered at a dose of about 300 mg to about 500 mg (e.g., about 400 mg) once every 3 weeks. In other embodiments, the LAG-3 inhibitor is administered at a dose of about 400 mg to about 800 mg (e.g., about 600 mg) once every 4 weeks. In yet other embodiments, the LAG-3 inhibitor is administered at a dose of about 700 mg to about 900 mg (e.g., about 800 mg) once every 4 weeks.
- the combination comprises PDR001, a GITR agonist described herein, and LAG525. In some embodiments, the combination comprises a PD-1 inhibitor described herein, GWN323, and LAG525. In some embodiments, the combination comprises PDR001, GWN323, and LAG525.
- the GITR agonist e.g., GWN323 is administered at a dose of about 2 mg to about 10 mg, about 5 mg to about 20 mg, about 20 mg to about 40 mg, about 50 mg to about 100 mg, about 100 mg to about 200 mg, about 200 mg to about 400 mg, or about 400 mg to about 600 mg, once every week, once every three weeks, or once every six weeks.
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a GITR agonist (e.g., a GITR agonist described herein), and one or more (e.g., two or all) of a TGF- ⁇ inhibitor (e.g., a TGF- ⁇ inhibitor described herein), a c-MET inhibitor (e.g., a c-MET inhibitor described herein), an A2aR antagonist (e.g., an A2aR antagonist described herein), a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein), or a LAG-3 inhibitor (e.g., a LAG-3 inhibitor described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a GITR agonist e.g., a GITR agonist described herein
- one or more (e.g., two or all) of a TGF- ⁇ inhibitor e.g
- the combination further comprises a fourth therapeutic agent, e.g., a therapeutic agent described herein.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has or cancer is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a pancreatic cancer, a colorectal cancer (CRC), or a melanoma (e.g., a refractory melanoma).
- CRC colorectal cancer
- a melanoma e.g., a refractory melanoma
- the combination comprises a PD-1 inhibitor, (e.g., a PD-1 inhibitor described herein), and a LAG-3 inhibitor (e.g., a LAG-3 inhibitor described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a LAG-3 inhibitor e.g., a LAG-3 inhibitor described herein
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400 mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300 mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400 mg once every 4 weeks.
- the LAG-3 inhibitor is chosen from LAG525 (Novartis), BMS-986016 (Bristol-Myers Squibb), or TSR-033 (Tesaro).
- the LAG-3 inhibitor is LAG525.
- the LAG-3 inhibitor is administered at a dose of about 300 to about 500 mg, about 400mg to about 800mg, or about 700 to about 900 mg.
- the LAG-3 inhibitor is administered once every 3 weeks.
- the LAG-3 inhibitor is administered once every 4 weeks.
- the LAG-3 inhibitor is administered at a dose of about 300 mg to about 500 mg (e.g., about 400 mg) once every 3 weeks.
- the LAG-3 inhibitor is administered at a dose of about 400 mg to about 800 mg (e.g., about 600 mg) once every 4 weeks. In yet other embodiments, the LAG-3 inhibitor is administered at a dose of about 700 mg to about 900 mg (e.g., about 800 mg) once every 4 weeks.
- the composition comprises a combination of a PD-1 inhibitor, e.g., PDR001, and a LAG-3 inhibitor, e.g., LAG525.
- the combination comprises PDR001, and a LAG-3 inhibitor described herein.
- the combination comprises a PD-1 inhibitor described herein and LAG525.
- the combination comprises PDR001 and LAG525.
- the LAG-3 inhibitor e.g., LAG525, is administered, e.g., infused, prior to administration, e.g., infusion, of the PD-1 inhibitor, e.g., PDR001.
- the PD-1 inhibitor, e.g., PDR001 is administered, e.g., infused, after administration, e.g., infusion, of the LAG-3 inhibitor, e.g., LAG525.
- both the PD-1 inhibitor, e.g., PDR001, and the LAG-3 inhibitor, e.g., LAG525, are administered, e.g., infused at the same site of administration, e.g., infusion site.
- the combination further comprises a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor disclosed herein.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089.
- the TGF- ⁇ inhibitor is XOMA 089.
- the combination comprises PDR001, a LAG-3 inhibitor described herein, and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, LAG525 and XOMA 089.
- the combination comprises PDR001, LAG525, and XOMA 089.
- the combination further comprises a TIM-3 inhibitor, e.g., a TIM-3 inhibitor described herein.
- the TIM-3 inhibitor is chosen from MBG453 or TSR- 022.
- the TIM-3 inhibitor is MBG453.
- the combination comprises PDR001, a LAG-3 inhibitor described herein, and MBG453.
- the combination comprises a PD-1 inhibitor described herein, LAG525 and MBG453.
- the combination comprises PDR001, LAG525, and MBG453.
- the combination further comprises a c-MET inhibitor, e.g., a c-MET inhibitor described herein.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
- the c-MET inhibitor is capmatinib (INC280).
- the combination comprises PDR001, a LAG-3 inhibitor described herein, and capmatinib (INC280).
- the combination comprises a PD-1 inhibitor described herein, LAG525 and capmatinib (INC280). In some embodiments, the combination comprises PDR001, LAG525, and capmatinib (INC280).
- the c-MET inhibitor e.g., capmatinib
- the c-MET inhibitor is administered twice a day at a dose of about 100-2000mg, about 200-2000mg, about 200-1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg. In an embodiment, the c-MET inhibitor (e.g., capmatinib) is administered twice a day at a dose of about 400mg. In an embodiment, the c-MET inhibitor (e.g., capmatinib) is administered twice a day at a dose of about 600mg.
- the combination further comprises an IL-1 ⁇ inhibitor, e.g., an IL-1 ⁇ inhibitor described herein.
- the IL-1 ⁇ inhibitor is chosen from canakinumab, gevokizumab, Anakinra, or Rilonacept.
- the combination comprises PDR001, a LAG-3 inhibitor described herein, and an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept).
- the combination comprises a PD-1 inhibitor described herein, LAG525, and an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept).
- the combination comprises PDR001, LAG525 and, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept).
- the combination further comprises a MEK inhibitor, e.g., a MEK inhibitor described herein.
- the MEK inhibitor is chosen from Trametinib, selumetinib, AS703026, BIX 02189, BIX 02188, CI-1040, PD0325901, PD98059, U0126, XL-518, G-38963, or G02443714.
- the MEK inhibitor is Trametinib.
- the combination comprises PDR001, a LAG-3 inhibitor described herein, and Trametinib.
- the combination comprises a PD-1 inhibitor described herein, LAG525 and Trametinib.
- the combination comprises PDR001, LAG525, and Trametinib.
- the combination further comprises a GITR agonist, e.g., a GITR agonist described herein.
- the GITR agonist is chosen from GWN323, BMS-986156, MK- 4166, MK-1248, TRX518, INCAGN1876, AMG 228, or INBRX-110.
- the GITR agonist is GWN323.
- the combination comprises PDR001, a LAG-3 inhibitor described herein, and GWN323.
- the combination comprises a PD-1 inhibitor described herein, LAG525 and GWN323.
- the combination comprises PDR001, LAG525, and GWN323.
- the combination further comprises a CSF-1/1R binding agent, e.g., a CSF- 1/1R binding agent described herein.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M- CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK) (e.g., pexidartinib), or an antibody targeting CSF-1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- the CSF-1/1R inhibitor is BLZ945. In some embodiments, the CSF- 1/1R binding agent is MCS110. In some embodiments, the combination comprises PDR001, a LAG-3 inhibitor described herein, and MCS110. In some embodiments, the combination comprises a PD-1 inhibitor described herein, LAG525 and MCS110. In some embodiments, the combination comprises PDR001, LAG525, and MCS110. In some embodiments, the combination comprises PDR001, a LAG-3 inhibitor described herein, and BLZ945. In some embodiments, the combination comprises a PD-1 inhibitor described herein, LAG525 and BLZ945. In some embodiments, the combination comprises PDR001, LAG525, and BLZ945.
- the combination further comprises an A2aR antagonist, e.g., an A2aR antagonist described herein.
- the A2aR antagonist is chosen from: PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN-115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the combination comprises PDR001, a LAG-3 inhibitor described herein, and PBF509 (NIR178).
- the combination comprises PDR001, LAG525, and PBF509 (NIR178).
- the combination comprises PDR001, LAG525, and PBF509 (NIR178).
- the combination further comprises a MEK inhibitor, e.g., trametinib or cobimetinib, paclitaxel, and a PD-L1 inhibitor, e.g., Atezolizumab.
- the combination comprises a PD-1 inhibitor described herein, a MEK inhibitor, e.g., trametinib or cobimetinib and paclitaxel.
- the combination comprises PDR001, cobimetinib and paclitaxel.
- the combination comprises a PD-1 inhibitor described herein, a MEK inhibitor described herein, e.g., trametinib or cobimetinib, paclitaxel and Atezolizumab.
- the combination comprises PDR001, cobimetinib, paclitaxel and Atezolizumab.
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a LAG-3 inhibitor (e.g., a LAG-3 inhibitor described herein), and one or more (e.g., two or all) of a TGF- ⁇ inhibitor (e.g., a TGF- ⁇ inhibitor described herein), a TIM-3 inhibitor (e.g., a TIM- 3 inhibitor described herein), a c-MET inhibitor (e.g., a c-MET inhibitor described herein), an IL-1 ⁇ inhibitor (e.g., an IL-1 ⁇ inhibitor described herein) a MEK inhibitor (e.g., a MEK inhibitor described herein) a GITR agonist (e.g., a GITR agonist described herein), an A2aR antagonist (e.g., an A2aR antagonist described herein), or a CSF-1/1R binding agent (e.g., a CSF-1/1R binding agent described herein).
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a breast cancer, e.g., a triple negative breast cancer (TNBC).
- TNBC triple negative breast cancer
- the cancer is a TNBC, e.g., an advanved or metastatic TNBC.
- the combination comprises a PD-1 inhibitor, (e.g., a PD-1 inhibitor described herein), and a CSF-1/1R binding agent (e.g., a CSF-1/1R binding agent disclosed herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a CSF-1/1R binding agent e.g., a CSF-1/1R binding agent disclosed herein.
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400mg once every 4 weeks.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[d]thiazol-6- yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK) (e.g., pexidartinib), or an antibody targeting CSF-1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- MCS110 monoclonal antibody or Fab to M-CSF
- CSF-1R tyrosine kinase inhibitor e
- the composition comprises a combination of a PD-1 inhibitor, e.g., PDR001, and a CSF-1/1R binding agent, e.g., BLZ945.
- a PD-1 inhibitor e.g., PDR001
- a CSF-1/1R binding agent e.g., BLZ945.
- the combination comprises PDR001, and a CSF-1/1R binding agent described herein, e.g., MCS110 or BLZ945.
- the combination comprises a PD-1 inhibitor described herein and BLZ945.
- the combination comprises PDR001 and BLZ945.
- the composition comprises a combination of a PD-1 inhibitor, e.g., PDR001, and a CSF-1/1R binding agent, e.g., MCS110.
- a PD-1 inhibitor e.g., PDR001
- a CSF-1/1R binding agent e.g., MCS110.
- the combination comprises PDR001, and a CSF-1/1R binding agent described herein.
- the combination comprises a PD-1 inhibitor described herein and MCS110.
- the combination comprises PDR001 and MCS110.
- the combination further comprises a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor disclosed herein.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089.
- the TGF- ⁇ inhibitor is XOMA 089.
- the combination comprises PDR001, a CSF-1/1R binding agent described herein, and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, BLZ945 and XOMA 089.
- the combination comprises PDR001, BLZ945, and XOMA 089.
- the combination further comprises a TIM-3 inhibitor, e.g., a TIM-3 inhibitor described herein.
- the TIM-3 inhibitor is chosen from MBG453 or TSR- 022.
- the TIM-3 inhibitor is MBG453.
- the combination comprises PDR001, a CSF-1/1R binding agent described herein, and MBG453.
- the combination comprises a PD-1 inhibitor described herein, BLZ945 and MBG453.
- the combination comprises PDR001, BLZ945, and MBG453.
- the combination further comprises a c-MET inhibitor, e.g., a c-MET inhibitor described herein.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
- the c-MET inhibitor is capmatinib (INC280).
- the combination comprises PDR001, a CSF-1/1R binding agent described herein, and capmatinib (INC280).
- the combination comprises a PD-1 inhibitor described herein, BLZ945 and capmatinib (INC280). In some embodiments, the combination comprises PDR001, BLZ945, and capmatinib (INC280).
- the c-MET inhibitor e.g., INC280
- the c-MET inhibitor is administered twice a day at a dose of about 100-2000mg, about 200-2000mg, about 200-1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg.
- the c-MET inhibitor e.g., INC280
- the c-MET inhibitor is administered twice a day at a dose of about 400mg.
- the c-MET inhibitor e.g., INC280
- the combination further comprises an IL-1 ⁇ inhibitor, e.g., an IL-1 ⁇ inhibitor described herein.
- the IL-1 ⁇ inhibitor is chosen from canakinumab, gevokizumab, Anakinra, or Rilonacept.
- the combination comprises PDR001, a CSF-1/1R binding agent described herein, and an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra or Rilonacept).
- the combination comprises a PD-1 inhibitor described herein, BLZ945 and, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra or Rilonacept).
- the combination comprises PDR001, BLZ945, and an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra or Rilonacept).
- the combination further comprises Eribulin, also known as E7389 and ER- 086526.
- the combination comprises PDR001, a CSF-1/1R binding agent described herein, e.g., BLZ945 or pexidartinib, and Eribulin.
- the combination comprises PDR001, BLZ945, and Eribulin.
- the combination comprises PDR001, pexidartinib, and Eribulin.
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a CSF-1/1R binding agent (e.g., a CSF-1/1R binding agent described herein), and one or more (e.g., two or all) of a TGF- ⁇ inhibitor (e.g., a TGF- ⁇ inhibitor described herein), a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein), a c-MET inhibitor (e.g., a c-MET inhibitor described herein), and an IL-1beta inhibitor (e.g., an IL-1beta inhibitor described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a CSF-1/1R binding agent e.g., a CSF-1/1R binding agent described herein
- one or more (e.g., two or all) of a TGF- ⁇ inhibitor e.g., a TGF- ⁇ inhibitor described
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a breast cancer, a colorectal cancer (CRC), a gastroesophageal cancer or a pancreatic cancer.
- the breast cancer is a triple negative breast cancer (TNBC).
- TNBC triple negative breast cancer
- the CRC is a microsatellite stable CRC (MSS CRC). Combination Targeting PD-1 and A2aR
- the combination comprises a PD-1 inhibitor, (e.g., a PD-1 inhibitor described herein), and an A2aR antagonist (e.g., an A2aR antagonist described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- an A2aR antagonist e.g., an A2aR antagonist described herein
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400 mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300 mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400 mg once every 4 weeks.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN- 115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the composition comprises a combination of a PD-1 inhibitor, e.g., PDR001, and an A2aR antagonist, e.g., PBF509 (NIR178).
- the combination comprises PDR001 and an A2aR antagonist described herein.
- the combination comprises a PD-1 inhibitor described herein and PBF509 (NIR178).
- the combination comprises PDR001 and PBF509 (NIR178).
- the combination further comprises a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor disclosed herein.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089.
- the TGF- ⁇ inhibitor is XOMA 089.
- the combination comprises PDR001, an A2aR antagonist described herein, and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, PBF509 (NIR178) and XOMA 089.
- the combination comprises PDR001, PBF509 (NIR178), and XOMA 089.
- the combination further comprises a TIM-3 inhibitor, e.g., a TIM-3 inhibitor described herein.
- the TIM-3 inhibitor is chosen from MBG453 or TSR- 022.
- the TIM-3 inhibitor is MBG453.
- the combination comprises PDR001, an A2aR antagonist described herein, and MBG453.
- the combination comprises a PD-1 inhibitor described herein, PBF509 (NIR178) and MBG453.
- the combination comprises PDR001, PBF509 (NIR178), and MBG453.
- the combination further comprises a c-MET inhibitor, e.g., a c-MET inhibitor described herein.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
- the c-MET inhibitor is capmatinib (INC280).
- the combination comprises PDR001, an A2aR antagonist described herein, and capmatinib (INC280).
- the combination comprises a PD-1 inhibitor described herein, PBF509 (NIR178) and capmatinib (INC280). In some embodiments, the combination comprises PDR001, PBF509 (NIR178), and capmatinib (INC280).
- the c-MET inhibitor e.g., INC280
- the c-MET inhibitor is administered twice a day at a dose of about 100-2000mg, about 200-2000mg, about 200-1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg.
- the c-MET inhibitor e.g., INC280
- the c-MET inhibitor is administered twice a day at a dose of about 400mg.
- the c-MET inhibitor e.g., INC280
- the combination further comprises an IL-1 ⁇ inhibitor, e.g., an IL-1 ⁇ inhibitor described herein.
- the IL-1 ⁇ inhibitor is chosen from canakinumab, gevokizumab, Anakinra, or Rilonacept.
- the combination comprises PDR001, an A2aR antagonist described herein, and an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept ).
- the combination comprises a PD-1 inhibitor described herein, PBF509 (NIR178), an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept ).
- the combination comprises PDR001, PBF509 (NIR178), and an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept ).
- the combination further comprises an IL-15/IL-15Ra complex, e.g., an IL- 15/IL-15Ra complex described herein.
- the IL-15/IL-15Ra complex is chosen from NIZ985 (Novartis), ATL-803 (Altor) or CYP0150 (Cytune).
- the IL-15/IL-15RA complex is NIZ985.
- the combination comprises PDR001, an A2aR antagonist described herein, and NIZ985.
- the combination comprises a PD-1 inhibitor described herein, PBF509 (NIR178), and NIZ985.
- the combination comprises PDR001, PBF509 (NIR178), and NIZ985.
- the combination further comprises a CSF-1/1R binding agent.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N- methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK) (e.g., pexidartinib), or an antibody targeting CSF-1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- MCS110 monoclonal antibody or Fab to M-CSF
- the combination comprises PDR001, an A2aR antagonist described herein, and BLZ945. In some embodiments, the combination comprises a PD-1 inhibitor described herein, PBF509 (NIR178) and BLZ945. In some embodiments, the combination comprises PDR001, PBF509 (NIR178), and BLZ945.
- the combination comprises PDR001, an A2aR antagonist described herein, and MCS110. In some embodiments, the combination comprises a PD-1 inhibitor described herein, PBF509 (NIR178), and MCS110. In some embodiments, the combination comprises PDR001, PBF509 (NIR178), and MCS110.
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), an A2aR antagonist (e.g., an A2aR antagonist described herein), and one or more (e.g., two, three, four, or all) of a TGF- ⁇ inhibitor (e.g., a TGF- ⁇ inhibitor described herein), a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein), a c-MET inhibitor (e.g., a c-MET inhibitor described herein), an IL-1beta inhibitor (e.g., an IL-1beta inhibitor described herein), an IL-15/IL-15RA complex (e.g., an IL-15/IL-15RA complex described herein), or a CSF-1/1R binding agent (e.g., a CSF-1/1R binding agent described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- an A2aR antagonist e.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a breast cancer, a colorectal cancer (CRC), a gastroesophageal cancer or a pancreatic cancer.
- the breast cancer is a triple negative breast cancer (TNBC).
- the CRC is a microsatellite stable CRC (MSS CRC).
- the combination comprises a PD-1 inhibitor, (e.g., a PD-1 inhibitor described herein), and an IL-1beta inhibitor (e.g., an IL-1beta inhibitor described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- an IL-1beta inhibitor e.g., an IL-1beta inhibitor described herein
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300 mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400 mg once every 4 weeks.
- the IL-1 ⁇ inhibitor is chosen from canakinumab, gevokizumab, Anakinra, or Rilonacept
- the composition comprises a combination of a PD-1 inhibitor, e.g., PDR001, and an IL-1 ⁇ inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept.
- a PD-1 inhibitor e.g., PDR001
- an IL-1 ⁇ inhibitor e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept.
- the combination comprises PDR001 and an IL-1 ⁇ inhibitor described herein.
- the combination comprises a PD-1 inhibitor described herein and, canakinumab, gevokizumab, Anakinra, or Rilonacept.
- the combination comprises PDR001 and, canakinumab, gevokizumab, Anakinra, or Rilonacept.
- the combination further comprises a TGFb inhibitor, e.g., a TGFb inhibitor disclosed herein.
- the TGFb inhibitor is fresolimumab or XOMA 089.
- the TGFb inhibitor is XOMA 089.
- the combination comprises PDR001, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and XOMA 089.
- the combination further comprises an IL-15/IL-15Ra complex, e.g., an IL-15/IL-15Ra complex described herein.
- the IL-15/IL-15Ra complex is chosen from NIZ985 (Novartis), ATL-803 (Altor), or CYP0150 (Cytune).
- the IL-15/IL- 15RA complex is NIZ985.
- the combination comprises PDR001, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and NIZ985.
- the combination further comprises a CSF-1/1R binding agent.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N- methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK) (e.g., pexidartinib), or an antibody targeting CSF-1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- MCS110 monoclonal antibody or Fab to M-CSF
- CSF-1R tyrosine kinase inhibitor e
- the combination comprises PDR001, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and MCS110.
- the combination comprises a PD-1 inhibitor described herein, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and MCS110.
- the combination comprises PDR001, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and BLZ945.
- the combination comprises a PD-1 inhibitor described herein, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept) and BLZ945.
- the combination further comprises a TIM-3 inhibitor, e.g., a TIM-3 inhibitor described herein.
- the TIM-3 inhibitor is chosen from MBG453 or TSR- 022.
- the TIM-3 inhibitor is MBG453.
- the combination comprises PDR001, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and MBG453.
- the combination comprises a PD-1 inhibitor described herein, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and MBG453.
- the combination further comprises a c-MET inhibitor, e.g., a c-MET inhibitor described herein.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
- the c-MET inhibitor is capmatinib (INC280).
- the combination comprises PDR001, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and capmatinib (INC280).
- the combination comprises a PD-1 inhibitor described herein, an IL-1 ⁇ inhibitor described herein (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and capmatinib (INC280).
- the c-MET inhibitor e.g., INC280
- the c-MET inhibitor is administered twice a day at a dose of about 100-2000mg, about 200-2000mg, about 200- 1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg.
- the c-MET inhibitor e.g., INC280
- the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 600mg.
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), an IL-1 ⁇ inhibitor (e.g., an IL-1 ⁇ inhibitor described herein), and one or more (e.g., two, three, four, or all) of a TGF- ⁇ inhibitor (e.g., a TGF- ⁇ inhibitor described herein), a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein), a c-MET inhibitor (e.g., a c-MET inhibitor described herein), an IL-15/IL-15RA complex (e.g., an IL-15/IL-15RA complex described herein), or a CSF-1/1R binding agent (e.g., a CSF-1/1R binding agent described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a colorectal cancer (CRC), a gastroesophageal cancer or a pancreatic cancer.
- the CRC is a microsatellite stable CRC (MSS CRC).
- the combination comprises a PD-1 inhibitor, (e.g., a PD-1 inhibitor described herein), and a MEK inhibitor (e.g., a MEK inhibitor described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a MEK inhibitor e.g., a MEK inhibitor described herein
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400 mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300 mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400 mg once every 4 weeks.
- the MEK inhibitor is chosen from Trametinib, binimetinib, selumetinib, AS703026, BIX 02189, BIX 02188, CI-1040, PD0325901, PD98059, U0126, XL-518, G-38963, or G02443714.
- the MEK inhibitor is Trametinib.
- the MEK inhibitor or trametinib is administered at a dose between 0.1 mg and 4 mg (e.g., between 0.5 mg and 3 mg, e.g., at a dose of 0.5 mg), e.g., once a day.
- the MEK inhibitor or trametinib is administered at a dose of 0.5mg, e.g., once a day.
- the MEK inhibitor or trametinib is administered orally.
- the composition comprises a combination of a PD-1 inhibitor, e.g., PDR001, and a MEK inhibitor, e.g., trametinib.
- the combination comprises PDR001 and a MEK inhibitor, e.g., trametinib.
- the combination comprises a PD-1 inhibitor, e.g., PDR001, and trametinib.
- the combination comprises PDR001 and trametinib.
- the combination comprises a PD-1 inhibitor, e.g., PDR001 and a MEK inhibitor, e.g., binimetinib. In some embodiments, the combination comprises PDR001 and binimetinib.
- the combination further comprises a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor disclosed herein.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089.
- the TGF- ⁇ inhibitor is XOMA 089.
- the combination comprises PDR001, a MEK inhibitor described herein, and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, trametinib and XOMA 089.
- the combination comprises PDR001, trametinib, and XOMA 089.
- the combination further comprises an IL-15/IL-15Ra complex, e.g., an IL- 15/IL-15Ra complex described herein.
- the IL-15/IL-15Ra complex is chosen from NIZ985 (Novartis), ATL-803 (Altor) or CYP0150 (Cytune).
- the IL-15/IL-15RA complex is NIZ985.
- the combination comprises PDR001, a MEK inhibitor described herein, and NIZ985.
- the combination comprises a PD-1 inhibitor described herein, trametinib, and NIZ985.
- the combination comprises PDR001, trametinib, and NIZ985.
- the combination further comprises a CSF-1/1R binding agent.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N- methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK) (e.g., pexidartinib), or an antibody targeting CSF-1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- MCS110 monoclonal antibody or Fab to M-CSF
- the combination comprises PDR001, a MEK inhibitor described herein, and MCS110. In some embodiments, the combination comprises a PD-1 inhibitor described herein, trametinib and MCS110. In some embodiments, the combination comprises PDR001, trametinib, and MCS110.
- the combination comprises PDR001, a MEK inhibitor described herein, and BLZ945. In some embodiments, the combination comprises a PD-1 inhibitor described herein, trametinib and BLZ945. In some embodiments, the combination comprises PDR001, trametinib, and BLZ945. In some embodiments, the combination further comprises a TIM-3 inhibitor, e.g., a TIM-3 inhibitor described herein. In some embodiments, the TIM-3 inhibitor is chosen from MBG453 or TSR- 022. In some embodiments, the TIM-3 inhibitor is MBG453. In some embodiments, the combination comprises PDR001, a MEK inhibitor described herein, and MBG453. In some embodiments, the combination comprises a PD-1 inhibitor described herein, trametinib and MBG453. In some embodiments, the combination comprises PDR001, trametinib, and MBG453.
- the combination further comprises a c-MET inhibitor, e.g., a c-MET inhibitor described herein.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
- the c-MET inhibitor is capmatinib (INC280).
- the combination comprises PDR001, a MEK inhibitor described herein, and capmatinib (INC280).
- the combination comprises a PD-1 inhibitor described herein, trametinib, and capmatinib (INC280). In some embodiments, the combination comprises PDR001, trametinib, and capmatinib (INC280).
- the c-MET inhibitor e.g., INC280
- the c-MET inhibitor is administered twice a day at a dose of about 100-2000mg, about 200-2000mg, about 200-1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg. In an embodiment, the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 400mg. In an embodiment, the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 600mg.
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a MEK inhibitor (e.g., a MEK inhibitor described herein), and one or more (e.g., two, three, four, or all) of a TGF- ⁇ inhibitor (e.g., a TGF- ⁇ inhibitor described herein), a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein), a c-MET inhibitor (e.g., a c-MET inhibitor described herein), an IL- 15/IL-15RA complex (e.g., an IL-15/IL-15RA complex described herein), or a CSF-1/1R binding agent (e.g., a CSF-1/1R binding agent described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- MEK inhibitor e.g., a MEK inhibitor described herein
- one or more e.g., two, three, four, or all
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a colorectal cancer (CRC), a gastroesophageal cancer or a pancreatic cancer.
- the CRC is a microsatellite stable CRC (MSS CRC).
- the combination comprises a PD-1 inhibitor, (e.g., a PD-1 inhibitor described herein), a LAG-3 inhibitor (e.g., a LAG-3 inhibitor described herein), and a GITR agonist (e.g., a GITR agonist described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a LAG-3 inhibitor e.g., a LAG-3 inhibitor described herein
- a GITR agonist e.g., a GITR agonist described herein
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400mg once every 4 weeks.
- the LAG-3 inhibitor is chosen from LAG525 (Novartis), BMS-986016 (Bristol-Myers Squibb), or TSR-033 (Tesaro). In some embodiments, the LAG-3 inhibitor is LAG525.
- the GITR agonist is chosen from GWN323, BMS-986156, MK-4166, MK-1248, TRX518, INCAGN1876, AMG 228 or INBRX-110. In some embodiments, the GITR agonist is GWN323.
- the composition comprises a combination of a PD-1 inhibitor, e.g., PDR001, a GITR agonist, e.g., GWN323, and a LAG-3 inhibitor, e.g., LAG525.
- a PD-1 inhibitor e.g., PDR001
- a GITR agonist e.g., GWN323
- a LAG-3 inhibitor e.g., LAG525.
- the combination comprises PDR001, a LAG-3 inhibitor described herein, and a GITR agonist described herein. In some embodiments, the combination comprises a PD-1 inhibitor described herein, LAG525, and a GITR agonist described herein. In some embodiments, the combination comprises a PD-1 inhibitor described herein, a LAG-3 inhibitor described herein, and GWN323. In some embodiments, the combination comprises PDR001, LAG525, and a GITR agonist described herein. In some embodiments, the combination comprises PDR001, a LAG-3 inhibitor described herein, and GWN323. In some embodiments, the combination comprises a PD-1 inhibitor described herein, LAG525, and GWN323. In some embodiments, the combination comprises PDR001, LAG525, and GWN323.
- the combination further comprises a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor disclosed herein.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089.
- the TGF- ⁇ inhibitor is XOMA 089.
- the combination comprises PDR001, a LAG-3 inhibitor described herein, a GITR agonist and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, LAG525, a GITR agonist and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, a LAG-3 inhibitor described herein, GWN323, and XOMA 809.
- the combination comprises PDR001, LAG525, GWN323 and XOMA 089.
- the combination further comprises an A2aR antagonist, e.g., an A2aR antagonist disclosed herein.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN-115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the combination comprises PDR001, a LAG-3 inhibitor described herein, a GITR agonist and PBF509 (NIR178). In some embodiments, the combination comprises a PD-1 inhibitor described herein, LAG525, a GITR agonist and PBF509 (NIR178). In some embodiments, the combination comprises a PD-1 inhibitor described herein, a LAG-3 inhibitor described herein, GWN323, and PBF509 (NIR178). In some embodiments, the combination comprises PDR001, LAG525, GWN323 and PBF509 (NIR178).
- the combination further comprises a c-MET inhibitor, e.g., a c-MET inhibitor disclosed herein.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
- the c-MET inhibitor is capmatinib (INC280).
- the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 100-2000mg, about 200-2000mg, about 200-1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg.
- the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 400mg.
- the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 600mg.
- the combination comprises PDR001, a LAG-3 inhibitor described herein, a GITR agonist and capmatinib (INC280). In some embodiments, the combination comprises a PD-1 inhibitor described herein, LAG525, a GITR agonist and capmatinib (INC280). In some embodiments, the combination comprises a PD-1 inhibitor described herein, a LAG-3 inhibitor described herein, GWN323, and capmatinib (INC280). In some embodiments, the combination comprises PDR001, LAG525, GWN323 and capmatinib (INC280).
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a LAG-3 inhibitor (e.g., a LAG-3 inhibitor described herein), a GITR agonist (e.g., a GITR agonist described herein), and one or more (e.g., two or all) of a TGF- ⁇ inhibitor (e.g., a TGF- ⁇ inhibitor described herein), a c-MET inhibitor (e.g., a c-MET inhibitor described herein), or an A2aR antagonist (e.g., an A2aR antagonist described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- LAG-3 inhibitor e.g., a LAG-3 inhibitor described herein
- a GITR agonist e.g., a GITR agonist described herein
- one or more (e.g., two or all) of a TGF- ⁇ inhibitor e.g.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a pancreatic cancer, a colorectal cancer (CRC) or a melanoma (e.g., a refractory melanoma).
- CRC colorectal cancer
- a melanoma e.g., a refractory melanoma
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), an A2aR antagonist (e.g., an A2aR antagonist described herein), and a third therapeutic agent.
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- an A2aR antagonist e.g., an A2aR antagonist described herein
- a third therapeutic agent e.g., a third therapeutic agent.
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400 mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300 mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400 mg once every 4 weeks.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN- 115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the combination comprises PDR001 and PBF509 (NIR178).
- the third therapeutic agent comprises a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor disclosed herein.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089.
- the TGF- ⁇ inhibitor is XOMA 089.
- the combination comprises PDR001, an A2aR antagonist described herein, and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, PBF509 (NIR178), and XOMA 089.
- the combination comprises PDR001, PBF509 (NIR178), and XOMA 089.
- the third therapeutic agent comprises a CSF-1/1R binding agent, e.g., a CSF-1/1R binding agent disclosed herein.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK)(e.g., pexidartinib), or an antibody targeting CSF1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- the combination comprises PDR001, an A2aR antagonist described herein, and BLZ945. In some embodiments, the combination comprises a PD-1 inhibitor described herein, PBF509 (NIR178), and BLZ945. In some embodiments, the combination comprises a PDR001, PBF509 (NIR178), and BLZ945.
- the combination comprises PDR001, an A2aR antagonist described herein, and MCS110. In some embodiments, the combination comprises a PD-1 inhibitor described herein, PBF509 (NIR178), and MCS110. In some embodiments, the combination comprises a PDR001, PBF509 (NIR178), and MCS110.
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), an A2aR antagonist (e.g., an A2aR antagonist described herein), and one or both of a TGF- ⁇ inhibitor (e.g., a TGF- ⁇ inhibitor described herein) or a CSF-1/1R binding agent (e.g., a CSF-1/1R binding agent described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- an A2aR antagonist e.g., an A2aR antagonist described herein
- TGF- ⁇ inhibitor e.g., a TGF- ⁇ inhibitor described herein
- CSF-1/1R binding agent e.g., a CSF-1/1R binding agent described herein
- the combination further comprises a fourth therapeutic agent, e.g., a therapeutic agent described herein.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a pancreatic cancer, a colorectal cancer (CRC) or a melanoma (e.g., a refractory melanoma).
- CRC colorectal cancer
- a melanoma e.g., a refractory melanoma
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a c-MET inhibitor (e.g., a c-MET inhibitor described herein), and a third therapeutic agent.
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a c-MET inhibitor e.g., a c-MET inhibitor described herein
- a third therapeutic agent e.g., a PD-1 inhibitor described herein
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400mg once every 4 weeks.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib. In some embodiments, the c-MET inhibitor is capmatinib (INC280).
- the combination comprises PDR001 and capmatinib (INC280).
- the therapeutic agent comprises a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor disclosed herein.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089.
- the TGF- ⁇ inhibitor is XOMA 089.
- the combination comprises PDR001, a c-MET inhibitor described herein, and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, capmatinib (INC280), and XOMA 089.
- the combination comprises PDR001, capmatinib (INC280), and XOMA 089.
- the third therapeutic agent comprises an A2aR antagonist, e.g., an A2Ar inhibitor disclosed herein.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN-115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the combination comprises PDR001, a c-MET inhibitor described herein, and PBF509 (NIR178). In some embodiments, the combination comprises a PD-1 inhibitor described herein, capmatinib (INC280), and PBF509 (NIR178). In some embodiments, the combination comprises PDR001, capmatinib (INC280), and PBF509 (NIR178).
- the third therapeutic agent comprises a CSF-1/1R binding agent, e.g., a CSF-1/1R binding agent disclosed herein.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK)(e.g., pexidartinib), or an antibody targeting CSF-1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- the combination comprises PDR001, a c-MET inhibitor described herein, and BLZ945.
- the combination comprises a PD-1 inhibitor described herein, capmatinib (INC280), and BLZ945.
- the combination comprises PDR001, capmatinib (INC280), and BLZ945.
- the combination comprises PDR001, a c-MET inhibitor described herein, and MCS110.
- the combination comprises a PD-l inhibitor described herein, capmatinib (INC280), and MCS110.
- the combination comprises PDR001, capmatinib (INC280), and MCS110.
- the combination further comprises a fourth therapeutic agent, e.g., a therapeutic agent described herein.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a pancreatic cancer, a colorectal cancer (CRC) a gastric cancer, or a melanoma, e.g., a refractory melanoma.
- the combination comprises a PD-l inhibitor (e.g., a PD-l inhibitor described herein), an IDO inhibitor (e.g., an IDO inhibitor described herein), and a third therapeutic agent.
- a PD-l inhibitor e.g., a PD-l inhibitor described herein
- an IDO inhibitor e.g., an IDO inhibitor described herein
- a third therapeutic agent e.g., a third therapeutic agent.
- the PD-l inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-l inhibitor is administered at a dose of about 300-400mg. In some embodiments, the PD-l inhibitor is PDR001. In some embodiments, the PD-l inhibitor is administered once every 3 weeks. In some embodiments, the PD-l inhibitor is administered once every 4 weeks. In other embodiments, the PD-l inhibitor is administered at a dose of about 300mg once every 3 weeks. In yet other embodiments, the PD-l inhibitor is administered at a dose of about 400mg once every 4 weeks.
- the IDO inhibitor is chosen from epacadostat (also known as epacadostat).
- the combination comprises PDR001 and an IDO inhibitor described herein.
- the IDO inhibitor is epacadostat.
- the combination further comprises a TGF-b inhibitor, e.g., a TGF-b inhibitor disclosed herein.
- the TGF-b inhibitor is fresolimumab or XOMA 089.
- the TGF-b inhibitor comprises XOMA 089.
- the combination comprises PDR001, an IDO inhibitor described herein, and a TGF-b inhibitor described herein.
- the combination comprises a PD-l inhibitor described herein, an IDO inhibitor described herein, and XOMA 089.
- the combination comprises PDR001, an IDO inhibitor described herein, and XOMA 089.
- the third therapeutic agent comprises an A2aR antagonist, e.g., an A2Ar inhibitor disclosed herein.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN-115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the combination comprises PDR001, an IDO inhibitor described herein, and an A2aR antagonist described herein. In some embodiments, the combination comprises a PD-1 inhibitor described herein, an IDO inhibitor described herein, and PBF509 (NIR178). In some embodiments, the combination comprises PDR001, an IDO inhibitor described herein, and PBF509 (NIR178).
- the third therapeutic agent comprises a CSF-1/1R binding agent, e.g., a CSF-1/1R binding agent disclosed herein.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK)(e.g., pexidartinib), or an antibody targeting CSF1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- the combination comprises PDR001, an IDO inhibitor described herein, and a CSF-1/1R binding agent described herein. In some embodiments, the combination comprises a PD- 1 inhibitor described herein, an IDO inhibitor described herein, and BLZ945. In some embodiments, the combination comprises PDR001, an IDO inhibitor described herein, and BLZ945.
- the combination comprises PDR001, an IDO inhibitor described herein, and a CSF-1/1R binding agent described herein. In some embodiments, the combination comprises a PD- 1 inhibitor described herein, an IDO inhibitor described herein, and MCS110. In some embodiments, the combination comprises PDR001, an IDO inhibitor described herein, and MCS110.
- a composition further comprises a c-MET inhibitor, e.g., a c-MET inhibitor disclosed herein.
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib or golvatinib.
- the c-MET inhibitor comprises capmatinib (INC280).
- the combination comprises PDR001, an IDO inhibitor described herein, and a c-MET inhibitor described herein.
- the combination comprises a PD-1 inhibitor described herein, an IDO inhibitor described herein, and capmatinib (INC280). In some embodiments, the combination comprises PDR001, an IDO inhibitor described herein, and capmatinib (INC280).
- the c-MET inhibitor e.g., INC280
- the c-MET inhibitor is administered twice a day at a dose of about 100-2000mg, about 200-2000mg, about 200-1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg. In an embodiment, the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 400mg. In an embodiment, the c-MET inhibitor (e.g., INC280) is administered twice a day at a dose of about 600mg.
- the combination further comprises a GITR agonist, e.g., a GITR agonist disclosed herein.
- the GITR agonist is chosen from GWN323, BMS-986156, MK- 4166, MK-1248, TRX518, INCAGN1876, AMG 228 or INBRX-110.
- the GITR agonist is GWN323.
- the combination comprises PDR001, an IDO inhibitor described herein, and a GITR agonist described herein.
- the combination comprises a PD-1 inhibitor described herein, an IDO inhibitor described herein, and GWN323.
- the combination comprises PDR001, an IDO inhibitor described herein, and GWN323.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a pancreatic cancer, a colorectal cancer (CRC), a gastric cancer, or a melanoma, e.g., a refractory melanoma.
- the combination comprises a PD-1 inhibitor, (e.g., a PD-1 inhibitor described herein), a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein), and a third therapeutic agent.
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a TIM-3 inhibitor e.g., a TIM-3 inhibitor described herein
- a third therapeutic agent e.g., a TIM-3 inhibitor described herein
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400mg once every 4 weeks. In some embodiments, the TIM-3 inhibitor is chosen from MBG453 or TSR-022. In some embodiments, the TIM-3 inhibitor is MBG453.
- the composition comprises PDR001, and a TIM-3 inhibitor described herein, and a third therapeutic agent (e.g., a third therapeutic agent described herein).
- the combination comprises a PD-1 inhibitor described herein, MBG453, and a third therapeutic agent (e.g., a third therapeutic agent described herein).
- the composition comprises PDR001, MBG453, and a third therapeutic agent (e.g., a third therapeutic agent described herein).
- the third therapeutic agent comprises a CSF-1/1R binding agent, e.g., a CSF-1/1R binding agent disclosed herein.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK)(e.g., pexidartinib), or an antibody targeting CSF1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- the combination comprises PDR001, a TIM-3 inhibitor described herein, and a CSF-1/1R binding agent described herein. In some embodiments, the combination comprises a PD- 1 inhibitor described herein, a TIM-3 inhibitor described herein, and BLZ945. In some embodiments, the combination comprises a PD-1 inhibitor described herein, MBG453, and a CSF-1/1R binding agent described herein. In some embodiments, the combination comprises PDR001, MBG453, and a CSF-1/1R binding agent described herein. In some embodiments, the combination comprises PDR001, a TIM-3 inhibitor described herein, and BLZ945. In some embodiments, the combination comprises a PD-1 inhibitor described herein, MBG453, and BLZ945. In some embodiments, the combination comprises PDR001, MBG453, and BLZ945.
- the combination comprises PDR001, a TIM-3 inhibitor described herein, and a CSF-1/1R binding agent described herein. In some embodiments, the combination comprises a PD- 1 inhibitor described herein, a TIM-3 inhibitor described herein, and MCS110. In some embodiments, the combination comprises a PD-1 inhibitor described herein, MBG453, and a CSF-1/1R binding agent described herein. In some embodiments, the combination comprises PDR001, MBG453, and a CSF-1/1R binding agent described herein. In some embodiments, the combination comprises PDR001, a TIM-3 inhibitor described herein, and MCS110. In some embodiments, the combination comprises a PD-1 inhibitor described herein, MBG453, and MCS110.
- the combination comprises PDR001, MBG453, and MCS110.
- the third therapeutic agent comprises a STING agonist, e.g., a STING agonist described herein.
- the STING agonist comprises, MK-1454.
- the combination comprises PDR001, a TIM-3 inhibitor described herein, and a STING agonist described herein.
- the combination comprises a PD-1 inhibitor described herein, a TIM-3 inhibitor described herein, and MK-1454.
- the combination comprises a PD-1 inhibitor described herein, MBG453, and a STING agonist described herein.
- the combination comprises PDR001, MBG453, and MK-1454.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject or cancer is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a pancreatic cancer, or a colon cancer.
- the combination comprises a PD-1 inhibitor, (e.g., a PD-1 inhibitor described herein), a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein), and an A2ar antagonist (e.g., an A2aR antagonist described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a TIM-3 inhibitor e.g., a TIM-3 inhibitor described herein
- an A2ar antagonist e.g., an A2aR antagonist described herein
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400mg. In some embodiments, the PD-1 inhibitor is PDR001. In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400mg once every 4 weeks.
- the TIM-3 inhibitor is chosen from MBG453 or TSR-022. In some embodiments, the TIM-3 inhibitor is MBG453.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN- 115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the composition comprises a combination of a PD-1 inhibitor, e.g., PDR001, a TIM-3 inhibitor, e.g., MBG453, and an A2aR antagonist, e.g., PBF509 (NIR178).
- the composition comprises PDR001, a TIM-3 inhibitor described herein, and an A2aR antagonist described herein.
- the combination comprises a PD-l inhibitor described herein, MBG453, and an A2aR antagonist described herein.
- the combination comprises a PD-l inhibitor described herein, a TIM-3 inhibitor described herein, and PBF509 (NIR178).
- the composition comprises PDR001, MBG453,and an A2aR antagonist described herein. In some embodiments, the composition comprises PDR001, a TIM-3 inhibitor described herein, and PBF509 (NIR178). In some embodiments, the composition comprises a PD-l inhibitor described herein, MBG453 and PBF509 (NIR178). In some embodiments, the composition comprises PDR001, MBG453, and PBF509 (NIR178).
- the combination further comprises a CSF-1/1R binding agent, e.g., a CSF-1/1R binding agent disclosed herein.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((lR,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK)(e.g., pexidartinib), or an antibody targeting CSF1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- the combination comprises PDR001, a TIM-3 inhibitor described herein, an A2aR antagonist described herein, and BLZ945. In some embodiments, the combination comprises a PD-l inhibitor described herein, MBG453, an A2aR antagonist described herein, and BLZ945. In some embodiments, the combination comprises a PD-l inhibitor described herein, a TIM-3 inhibitor described herein, PBF509 (NIR178), and BLZ945. In some embodiments, the combination comprises PDR001, MBG453, an A2aR antagonist described herein, and BLZ945. In some embodiments, the combination comprises PDR001, a TIM-3 inhibitor described herein, PBF509 (NIR178), and BLZ945. In some embodiments, the combination comprises a PD-l inhibitor, MBG453, PBF509 (NIR178), and BLZ945.
- the combination comprises PDR001, MBG453, PBF509 (NIR178), and BLZ945.
- the combination comprises PDR001, a TIM-3 inhibitor described herein, an A2aR antagonist described herein, and MCS110. In some embodiments, the combination comprises a PD-l inhibitor described herein, MBG453, an A2aR antagonist described herein, and MCS110. In some embodiments, the combination comprises a PD-l inhibitor described herein, a TIM-3 inhibitor described herein, PBF509 (NIR178), and MCS110. In some embodiments, the combination comprises PDR001, MBG453, an A2aR antagonist described herein, and MCS110. In some embodiments, the combination comprises PDR001, a TIM-3 inhibitor described herein, PBF509 (NIR178), and MCS110. In some embodiments, the combination comprises a PD-1 inhibitor, MBG453, PBF509 (NIR178), and MCS110. In some embodiments, the combination comprises PDR001, MBG453, PBF509 (NIR178), and MCS110.
- the combination further comprises a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor disclosed herein.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089. In some embodiments, the TGF- ⁇ inhibitor is XOMA 089.
- the combination comprises PDR001, a TIM-3 inhibitor described herein, an A2aR antagonist described herein, and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, MBG453, an A2aR antagonist described herein, and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, a TIM-3 inhibitor described herein, PBF509 (NIR178), and XOMA 089.
- the combination comprises PDR001, MBG453, an A2aR antagonist described herein, and XOMA 089.
- the combination comprises PDR001, a TIM-3 inhibitor described herein, PBF509 (NIR178), and XOMA 089.
- the combination comprises a PD-1 inhibitor, MBG453, PBF509 (NIR178), and XOMA 089.
- the combination comprises PDR001, MBG453, PBF509 (NIR178), and XOMA 089.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a pancreatic cancer, or a colon cancer.
- the combination comprises an IL-1 ⁇ inhibitor (e.g., an IL-1 ⁇ inhibitor described herein), and an A2aR antagonist (e.g., an A2aR antagonist described herein).
- the combination further comprises and an additional therapeutic agent, e.g., one or more additional therapeutic agents (e.g., a third therapeutic agent, or a third and a fourth therapeutic agent).
- the IL-1 ⁇ inhibitor is chosen from canakinumab, gevokizumab, Anakinra, or Rilonacept.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN- 115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the combination comprises an IL-1 ⁇ inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept, and an A2aR antagonist, e.g., PBF509 (NIR178).
- the combination comprises an IL-1b inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept, and PBF509 (NIR178).
- the combination comprises a third therapeutic agent.
- the third therapeutic agent comprises an IL-15/IL-15Ra complex, e.g., an IL-15/IL-15Ra complex described herein.
- the IL-15/IL-15Ra complex is chosen from NIZ985 (Novartis), ATL-803 (Altor) or CYP0150 (Cytune).
- the IL-15/IL-15RA complex is NIZ985.
- the combination comprises an IL-1b inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept, an A2aR antagonist, e.g., PBF509 (NIR178), and an IL-15/IL- 15Ra complex, e.g., NIZ985.
- the combination comprises an IL-1 ⁇ inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept, PBF509 (NIR178), and an IL-15/IL-15Ra complex, e.g., NIZ985.
- the combination comprises an IL-1b inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept, PBF509 (NIR178), and NIZ985.
- the combination further comprises a fourth therapeutic agent.
- the fourth therapeutic agent comprises a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor described herein.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089.
- the TGF- ⁇ inhibitor is XOMA 089.
- the combination comprises PDR001, a LAG-3 inhibitor described herein, and XOMA 089.
- the combination comprises a PD-1 inhibitor described herein, LAG525 and XOMA 089.
- the combination comprises PDR001, LAG525, and XOMA 089.
- the combination comprises an IL-1b inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept, an A2aR antagonist, e.g., PBF509 (NIR178), an IL-15/IL-15Ra complex, e.g., NIZ985, and a TGF- ⁇ inhibitor, e.g., XOMA 089.
- an IL-1b inhibitor e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept
- an A2aR antagonist e.g., PBF509 (NIR178)
- an IL-15/IL-15Ra complex e.g., NIZ985
- TGF- ⁇ inhibitor e.g., XOMA 089.
- the combination comprises an IL-1 ⁇ inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept, PBF509 (NIR178), an IL-15/IL-15Ra complex, e.g., NIZ985, and a TGF- ⁇ inhibitor, e.g., XOMA 089.
- the combination comprises an IL-1 ⁇ inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept, PBF509 (NIR178), NIZ985, and a TGF- ⁇ inhibitor, e.g., XOMA 089.
- the combination comprises an IL-1 ⁇ inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept, PBF509 (NIR178), NIZ985, and XOMA 089.
- an IL-1 ⁇ inhibitor e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept
- PBF509 NIR178
- NIZ985 NIZ985
- XOMA 089 XOMA 089.
- the combination comprises an IL-1 ⁇ inhibitor (e.g., an IL-1 ⁇ inhibitor described herein), an A2aR antagonist (e.g., an A2aR antagonist described herein), and one or both of an IL-15/IL-15Ra complex (e.g., and IL-15/IL-15Ra complex described herein) or a TGF- ⁇ inhibitor (e.g., a TGF- ⁇ inhibitor described herein).
- an IL-1 ⁇ inhibitor e.g., an IL-1 ⁇ inhibitor described herein
- an A2aR antagonist e.g., an A2aR antagonist described herein
- an IL-15/IL-15Ra complex e.g., and IL-15/IL-15Ra complex described herein
- TGF- ⁇ inhibitor e.g., a TGF- ⁇ inhibitor described herein
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a colorectal cancer (CRC), a gastroesophageal cancer or a pancreatic cancer.
- the CRC is a microsatellite stable CRC (MSS CRC).
- the combination comprises an IL-15/IL-15Ra complex, e.g., an IL-15/IL-15Ra complex described herein, and a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor described herein.
- the combination further comprises additional therapeutic agents, e.g., one or two additional therapeutic agents, e.g., therapeutic agents described herein.
- the IL-15/IL-15Ra complex is chosen from NIZ985 (Novartis), ATL-803 (Altor) or CYP0150 (Cytune).
- the IL-15/IL-15RA complex is NIZ985.
- the combination comprises an IL-1b inhibitor, e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept, an A2aR antagonist, e.g., PBF509 (NIR178), and an IL-15/IL-15Ra complex, e.g., NIZ985.
- the TGF- ⁇ inhibitor is fresolimumab or XOMA 089. In some embodiments, the TGF- ⁇ inhibitor is XOMA 089. In some embodiments, the combination comprises PDR001, a LAG-3 inhibitor described herein, and XOMA 089. In some embodiments, the combination comprises a PD-1 inhibitor described herein, LAG525 and XOMA 089. In some embodiments, the combination comprises PDR001, LAG525, and XOMA 089.
- the combination comprises an IL-15/IL-15Ra complex (e.g., NIZ985), and a TGF- ⁇ inhibitor (e.g., XOMA 089).
- the combination comprises NIZ985, and a TGF- ⁇ inhibitor (e.g., XOMA 089).
- the combination comprises NIZ985, and XOMA 089.
- the combination comprising an IL-15/IL-15Ra complex, e.g., an IL-15/IL- 15Ra complex described herein, and a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor described herein further comprises one or more, e.g., two, therapeutic agents.
- the combination comprises an IL-1b inhibitor, e.g., an IL-1b inhibitor described herein, and a CSF-1/1R binding agent, e.g., a CSF- 1/1R binding agent described herein.
- the IL-1b inhibitor is chosen from canakinumab, gevokizumab, Anakinra, or Rilonacept.
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[d]thiazol-6- yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK) (e.g., pexidartinib), or an antibody targeting CSF-1R (e.g., emactuzumab or FPA008).
- M-CSF macrophage colony-stimulating factor
- MCS110 monoclonal antibody or Fab to M-CSF
- CSF-1R tyrosine kinase inhibitor e
- the combination comprises an IL-15/IL-15Ra complex (e.g., NIZ985), a TGF- ⁇ inhibitor (e.g., XOMA 089), an IL-1b inhibitor (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and a CSF-1/1R binding agent (e.g., MCS110 or BLZ495).
- an IL-15/IL-15Ra complex e.g., NIZ985
- TGF- ⁇ inhibitor e.g., XOMA 089
- an IL-1b inhibitor e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept
- CSF-1/1R binding agent e.g., MCS110 or BLZ495.
- the combination comprises NIZ985, a TGF- ⁇ inhibitor (e.g., XOMA 089), an IL-1b inhibitor (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and a CSF-1/1R binding agent (e.g., MCS110 or BLZ495).
- the combination comprises NIZ985, XOMA 089, an IL-1b inhibitor (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and a CSF-1/1R binding agent (e.g., MCS110 or BLZ495).
- the combination comprises NIZ985, XOMA 089, an IL-1b inhibitor (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and MCS110.
- the combination comprises NIZ985, XOMA 089, an IL-1b inhibitor (e.g., canakinumab, gevokizumab, Anakinra, or Rilonacept), and BLZ495.
- the combination comprising an IL-15/IL-15Ra complex, e.g., an IL-15/IL- 15Ra complex described herein, and a TGF- ⁇ inhibitor, e.g., a TGF- ⁇ inhibitor described herein further comprises one or more, e.g., two, therapeutic agents.
- the combination comprises an A2aR antagonist, e.g., A2aR antagonist described herein, and a c-MET inhibitor, e.g., a c-MET inhibitor described herein.
- the A2aR antagonist is chosen from PBF509 (NIR178), CPI444/V81444, AZD4635/HTL-1071, Vipadenant, GBV-2034, AB928, Theophylline, Istradefylline, Tozadenant/SYN- 115, KW-6356, ST-4206, or Preladenant/SCH 420814.
- the A2aR antagonist is PBF509 (NIR178).
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib. In some embodiments, the c-MET inhibitor is capmatinib (INC280).
- the combination comprises an IL-15/IL-15Ra complex (e.g., NIZ985), a TGF- ⁇ inhibitor (e.g., XOMA 089), an A2aR antagonist (e.g., PBF509 (NIR178)), and a c-MET inhibitor (e.g., capmatinib).
- the combination comprises NIZ985, a TGF- ⁇ inhibitor (e.g., XOMA 089), an A2aR antagonist (e.g., PBF509 (NIR178)), and a c-MET inhibitor (e.g., capmatinib).
- the combination comprises NIZ985, XOMA 089, an A2aR antagonist (e.g., PBF509 (NIR178)), and a c-MET inhibitor (e.g., capmatinib).
- the combination comprises NIZ985, XOMA 089, PBF509 (NIR178), and a c-MET inhibitor (e.g., capmatinib).
- the combination comprises NIZ985, XOMA 089, an A2aR antagonist (e.g., PBF509 (NIR178)), and capmatinib.
- the combination comprises NIZ985, XOMA 089, PBF509 (NIR178), and capmatinib.
- the combination comprises an IL-15/IL-15Ra complex (e.g., and IL-15/IL- 15Ra complex described herein), a TGF- ⁇ inhibitor (e.g. a TGF- ⁇ inhibitor described herein), and one or more of (e.g., two, three, or more) of an IL-1 ⁇ inhibitor (e.g., an IL-1 ⁇ inhibitor described herein), a CSF- 1/1R binding agent (e.g., a CSF-1/1R binding agent described herein), a c-MET inhibitor(e.g., a c-MET inhibitor described herein), or an A2aR antagonist (e.g., an A2aR antagonist described herein).
- an IL-15/IL-15Ra complex e.g., and IL-15/IL- 15Ra complex described herein
- TGF- ⁇ inhibitor e.g. a TGF- ⁇ inhibitor described herein
- one or more of e.g., two, three, or more of an IL-1 ⁇ inhibitor (
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor, e.g., a colorectal cancer (CRC), a gastroesophageal cancer or a pancreatic cancer.
- CRC is a microsatellite stable CRC (MSS CRC).
- the combination comprises a Galectin (e.g., Galectin-1 or Galectin-3) inhibitor, e.g., a Galectin (e.g., Galectin-1 or Galectin-3) inhibitor described herein.
- a Galectin e.g., Galectin-1 or Galectin-3 inhibitor
- a Galectin e.g., Galectin-1 or Galectin-3 inhibitor described herein.
- the combination comprises a Galectin (e.g., Galectin-1 or Galectin-3) inhibitor, e.g., a Galectin (e.g., Galectin-1 or Galectin-3) inhibitor described herein, and an additional therapeutic agent, e.g., one or more therapeutic agents described herein.
- the combination comprises a Galectin (e.g., Galectin-1 or Galectin-3) inhibitor, e.g., a Galectin (e.g., Galectin-1 or Galectin-3) inhibitor described herein, and a PD-1 inhibitor, .e.g., a PD-1 inhibitor described herein.
- the combination comprises a Galectin-1 inhibitor (e.g., an anti-Galectin-1 antibody molecule) and a Galectin-3 inhibitor (e.g., an anti-Galectin-3 antibody molecule).
- the combination of antibody molecules can be administered separately, e.g., as separate antibody molecules, or linked, e.g., as a multispecific (e.g., bispecific) antibody molecule.
- a bispecific antibody molecule that comprises an anti-Galectin-1 antibody molecule and an anti-Galectin-3 antibody molecule is administered.
- the bispecific antibody molecule comprises an antigen- binding fragment of an anti-Galectin-1 antibody and an antigen-binding fragment of an anti-Galectin-3 antibody.
- the combination is used to treat a cancer, e.g., a cancer as described herein (e.g., a solid tumor or a hematologic malignancy).
- the Galectin e.g., Galectin-1 or Galectin-3, inhibitor is chosen from an anti-Galectin (e.g., anti-Galectin-1 or anti-Galectin-3) antibody molecule, GR-MD-02, Galectin-3C, Anginex, or OTX-008.
- the Galectin inhibitor is an anti Galectin (e.g., anti- Galectin-1 or anti-Galectin-3) antibody molecule, e.g., a monospecific or multispecific (e.g., bispecific) antibody molecule.
- the Galectin inhibitor is a monospecific antibody molecule.
- the Galectin inhibitor is an anti-Galectin-1 antibody, e.g., a monospecific antibody against Galectin-1.
- the Galectin inhibitor is an anti-Galectin-3 antibody, e.g., a monospecific antibody against Galectin-3.
- the composition comprises a combination of a Galectin inhibitor, e.g., an anti-Galectin-1 monospecific antibody molecule, and an additional Galectin inhibitor, e.g., an anti- Galectin-3 monospecific antibody molecule.
- a Galectin inhibitor e.g., an anti-Galectin-1 monospecific antibody molecule
- an additional Galectin inhibitor e.g., an anti- Galectin-3 monospecific antibody molecule.
- the combination comprises a Galectin (e.g., Galectin-1 or Galectin-3) inhibitor, e.g., a Galectin (e.g., Galectin-1 or Galectin-3) monospecific antibody molecule, and a PD-1 inhibitor, .e.g., a PD-1 inhibitor described herein.
- a Galectin e.g., Galectin-1 or Galectin-3 inhibitor
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein.
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-1 inhibitor is administered at a dose of about 300-400mg. In some embodiments, the PD-1 inhibitor is PDR001. In embodiments, the PD-1 inhibitor is administered once every 3 weeks. In embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 300mg once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 400mg once every 4 weeks.
- the composition comprises a combination of a Galectin inhibitor, e.g., an anti-Galectin-1 monospecific antibody molecule, and a PD-1 inhibitor, e.g., PDR001.
- a Galectin inhibitor e.g., an anti-Galectin-1 monospecific antibody molecule
- a PD-1 inhibitor e.g., PDR001.
- the composition comprises a combination of a Galectin inhibitor, e.g., an anti- Galectin-3 monospecific antibody molecule, and a PD-1 inhibitor, e.g., PDR001.
- a Galectin inhibitor e.g., an anti- Galectin-3 monospecific antibody molecule
- a PD-1 inhibitor e.g., PDR001.
- the combination comprises a Galectin (e.g., Galectin-1 or Galectin-3) inhibitor, e.g., a Galectin (e.g., Galectin-1 or Galectin-3) bispecific antibody molecule, and a PD-1 inhibitor, .e.g., a PD-1 inhibitor described herein.
- a Galectin e.g., Galectin-1 or Galectin-3 inhibitor
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein.
- the Galectin inhibitor is a bispecific antibody molecule.
- the first epitope of the anti-Galectin bispecific antibody molecule is located on Galectin-1
- the second epitope of the anti-Galectin bispecific antibody molecule is located on Galectin-3.
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680
- the PD-l inhibitor is administered at a dose of about 300-400mg. In some embodiments, the PD-l inhibitor is PDR001. In some embodiments, the PD-l inhibitor is administered once every 3 weeks. In some embodiments, the PD-l inhibitor is administered once every 4 weeks. In other embodiments, the PD-l inhibitor is administered at a dose of about 300mg once every 3 weeks. In yet other embodiments, the PD-l inhibitor is administered at a dose of about 400mg once every 4 weeks.
- the composition comprises a combination of a Galectin inhibitor, e.g., an anti-Galectin-l and anti-Galectin-3 bispecific antibody molecule, and a PD-l inhibitor, e.g., PDR001.
- a Galectin inhibitor e.g., an anti-Galectin-l and anti-Galectin-3 bispecific antibody molecule
- a PD-l inhibitor e.g., PDR001.
- the combination is administered or used in a therapeutically effective amount (e.g., in accordance with a dosage regimen described herein) to treat a disorder (e.g., a cancer, e.g., a cancer described herein) in a subject in need thereof.
- a disorder e.g., a cancer, e.g., a cancer described herein
- the subject has cancer or is identified as having a biomarker described herein.
- the cancer is a solid tumor or a hematological malignancy.
- the combinations disclosed herein can result in one or more of: an increase in antigen presentation, an increase in effector cell function (e.g., one or more of T cell proliferation, IFN-g secretion or cytolytic function), inhibition of regulatory T cell function, an effect on the activity of multiple cell types (e.g., regulatory T cell, effector T cells and NK cells), an increase in tumor infiltrating lymphocytes, an increase in T-cell receptor mediated proliferation, a decrease in immune evasion by cancerous cells, and a decrease in oncogenic activity (e.g., overexpression of an oncogene).
- an increase in antigen presentation an increase in effector cell function (e.g., one or more of T cell proliferation, IFN-g secretion or cytolytic function), inhibition of regulatory T cell function, an effect on the activity of multiple cell types (e.g., regulatory T cell, effector T cells and NK cells), an increase in tumor infiltrating lymphocytes, an increase in T-cell receptor mediated proliferation, a decrease in immune
- the use of a PD-l inhibitor in the combinations inhibits, reduces or neutralizes one or more activities of PD-l, resulting in blockade or reduction of an immune checkpoint.
- a PD-l inhibitor in the combinations inhibits, reduces or neutralizes one or more activities of PD-l, resulting in blockade or reduction of an immune checkpoint.
- a method of modulating an immune response in a subject comprises administering to the subject a combination disclosed herein (e.g., a combination comprising a therapeutically effective amount of a PD-l inhibitor described herein), alone or in combination with one or more agents or procedures, such that the immune response in the subject is modulated.
- the antibody molecule enhances, stimulates, restores, or increases the immune response in the subject.
- the subject can be a mammal, e.g., a primate, preferably a higher primate, e.g. , a human (e.g. , a patient having, or at risk of having, a disorder described herein).
- the subject is in need of enhancing an immune response.
- the subject has, or is at risk of, having a disorder described herein, e.g., a cancer or an infectious disorder as described herein.
- the subject is, or is at risk of being, immunocompromised.
- the subject is undergoing or has undergone a chemotherapeutic treatment and/or radiation therapy.
- the subject is, or is at risk of being, immunocompromised as a result of an infection.
- a method of treating e.g., one or more of reducing, inhibiting, or delaying progression
- the method comprises administering to the subject a combination disclosed herein (e.g., e.g., a combination comprising a therapeutically effective amount of a PD-l inhibitor described herein).
- the cancer treated with the combination includes but is not limited to, a solid tumor, a hematological cancer (e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma), and a metastatic lesion.
- a hematological cancer e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma
- a metastatic lesion e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma
- the cancer is a solid tumor.
- solid tumors include malignancies, e.g., sarcomas and carcinomas, e.g., adenocarcinomas of the various organ systems, such as those affecting the lung, breast, ovarian, lymphoid, gastrointestinal (e.g., colon), anal, genitals and genitourinary tract (e.g., renal, urothelial, bladder cells, prostate), pharynx, CNS (e.g., brain, neural or glial cells), head and neck, skin (e.g., melanoma), and pancreas, as well as adenocarcinomas which include malignancies such as colon cancers, rectal cancer, renal cancer (e.g., renal-cell carcinoma (clear cell or non-clear cell renal cell carcinoma), liver cancer, lung cancer (e.g., non-small cell lung cancer (squamous or non-squamous non-small cell lung cancer)), cancer of the small intestine and cancer of the e
- the cancer is chosen from a breast cancer, a pancreatic cancer, a colorectal cancer, a skin cancer, or a gastric cancer.
- the cancer is an ER+ cancer (e.g., an ER+ breast cancer).
- the cancer is a breast cancer.
- the cancer is a pancreatic cancer.
- the cancer is a colorectal cancer.
- the cancer is a skin cancer (e.g., a melanoma, e.g., a refractory melanoma).
- the cancer is a gastric cancer.
- the cancer is an advanced cancer. In some embodiments, the cancer is a metastatic cancer. In some embodiments, the cancer is a relapsed cancer. In some embodiments, the cancer is a refractory cancer. In some embodiments, the cancer is a recurrent cancer. In some embodiments, the cancer is an unresectable cancer.
- the cancer is a microsatellite instability-high (MSI-H) cancer. In some embodiments, the cancer is a mismatch repair deficient (dMMR) cancer.
- MSI-H microsatellite instability-high
- dMMR mismatch repair deficient
- the cancer e.g., cancer cells, cancer microenvironment, or both
- the cancer has an elevated level of PD-L1 expression.
- the cancer e.g., cancer cells, cancer microenvironment, or both
- the subject has, or is identified as having, a cancer that has one or more of high PD-L1 level or expression, or as being tumor infiltrating lymphocyte (TIL)+ (e.g., as having an increased number of TILs), or both.
- TIL tumor infiltrating lymphocyte
- the subject has, or is identified as having, a cancer that has high PD-L1 level or expression and that is TIL+.
- the method described herein further includes identifying a subject based on having a cancer that has one or more of high PD-L1 level or expression, or as being TIL+, or both. In certain embodiments, the method described herein further includes identifying a subject based on having a cancer that has high PD-L1 level or expression and as being TIL+. In some embodiments, a cancer that is TIL+ is positive for CD8 and IFN ⁇ . In some embodiments, the subject has, or is identified as having, a high percentage of cells that are positive for one, two or more of PD-L1, CD8, or IFN ⁇ . In certain embodiments, the subject has, or is identified as having, a high percentage of cells that are positive for all of PD-L1, CD8, and IFN ⁇ .
- the methods described herein further includes identifying a subject based on having a high percentage of cells that are positive for one, two or more of PD-L1, CD8, and/or IFN ⁇ . In certain embodiments, the methods described herein further includes identifying a subject based on having a high percentage of cells that are positive for all of PD-L1, CD8, and IFN ⁇ . In some embodiments,
- the subject has, or is identified as having, one, two or more of PD-L1, CD8, and/or IFN ⁇ , and one or more of a breast cancer, a pancreatic cancer, a colorectal cancer, a skin cancer, a gastric cancer, or an ER+ cancer.
- the method described herein further includes identifying a subject based on having one, two or more of PD-L1, CD8, and/or IFN ⁇ , and one or more of a breast cancer, a pancreatic cancer, a colorectal cancer, a skin cancer, a gastric cancer, or an ER+ cancer).
- the subject has, or is identified as having, a cancer that expresses one or more (e.g., two, three, four, or more) of PD-1, LAG-3, TIM-3, GITR, estrogen receptor (ER), CDK4, CDK6, CXCR2, CSF1, CSF1R, c-MET, TGF- ⁇ , A2Ar, IDO, STING or Galectin, e.g., Galectin-1 or Galectin-3.
- a cancer that expresses one or more (e.g., two, three, four, or more) of PD-1, LAG-3, TIM-3, GITR, estrogen receptor (ER), CDK4, CDK6, CXCR2, CSF1, CSF1R, c-MET, TGF- ⁇ , A2Ar, IDO, STING or Galectin, e.g., Galectin-1 or Galectin-3.
- Methods and compositions disclosed herein are useful for treating metastatic lesions associated with the aforementioned cancers.
- the invention provides a method of treating an infectious disease in a subject, comprising administering to a subject a combination as described herein, e.g., a combination comprising a therapeutically effective amount of a PD-1 inhibitor described herein.
- the infection disease is chosen from hepatitis (e.g., hepatitis C infection), or sepsis.
- the invention provides a method of enhancing an immune response to an antigen in a subject, comprising administering to the subject: (i) the antigen; and (ii) a combination as described herein, e.g., a combination comprising a therapeutically effective amount of a PD-1 inhibitor described herein, such that an immune response to the antigen in the subject is enhanced.
- the antigen can be, for example, a tumor antigen, a viral antigen, a bacterial antigen or an antigen from a pathogen.
- the combinations as described herein can be administered to the subject systemically (e.g., orally, parenterally, subcutaneously, intravenously, rectally, intramuscularly, intraperitoneally, intranasally, transdermally, or by inhalation or intracavitary installation), topically, or by application to mucous membranes, such as the nose, throat and bronchial tubes.
- the PD-1 inhibitor is administered by injection (e.g., subcutaneously or intravenously) at a dose (e.g., a flat dose) of about 100 mg to 600 mg, e.g., about 200 mg to 500 mg, e.g., about 250 mg to 450 mg, about 300 mg to 400 mg, about 250 mg to 350 mg, about 350 mg to 450 mg, or about 100 mg, about 200 mg, about 300 mg, or about 400 mg.
- the dosing schedule (e.g., flat dosing schedule) can vary from e.g., once a week to once every 2, 3, 4, 5, or 6 weeks.
- the PD-1 inhibitor is administered at a dose from about 300 mg to 400 mg once every three weeks or once every four weeks. In one embodiment, the PD-1 inhibitor is administered at a dose from about 300 mg once every three weeks. In one embodiment, the PD-1 inhibitor is administered at a dose from about 400 mg once every four weeks. In one embodiment, the PD-1 inhibitor is administered at a dose from about 300 mg once every four weeks. In one embodiment, the PD-1 inhibitor is administered at a dose from about 400 mg once every three weeks.
- the PD-1 inhibitor is administered by injection (e.g., subcutaneously or intravenously) at a dose of about 1 to 30 mg/kg, e.g., about 5 to 25 mg/kg, about 10 to 20 mg/kg, about 1 to 5 mg/kg, or about 3 mg/kg.
- the dosing schedule can vary from e.g., once a week to once every 2, 3, or 4 weeks.
- the PD-1 inhibitor is administered at a dose from about 10 to 20 mg/kg every other week.
- any of the methods disclosed herein further includes evaluating or monitoring the effectiveness of a therapy (e.g., a monotherapy or a combination therapy) described herein, in a subject (e.g., a subject having a cancer, e.g., a cancer described herein).
- the method includes acquiring a value of effectiveness to the therapy, wherein said value is indicative of the effectiveness of the therapy.
- the value of effectiveness to the therapy comprises a measure of one, two, three, four, five, six, seven, eight, nine or more (e.g., all) of the following:
- TIL tumor infiltrating lymphocyte
- the parameter of a TIL phenotype comprises the level or activity of one, two, three, four or more (e.g., all) of Hematoxylin and eosin (H&E) staining for TIL counts, CD8, FOXP3, CD4, or CD3, in the subject, e.g., in a sample from the subject (e.g., a tumor sample).
- H&E Hematoxylin and eosin
- the parameter of a myeloid cell population comprises the level or activity of one or both of CD68 or CD163, in the subject, e.g., in a sample from the subject (e.g., a tumor sample).
- the parameter of a surface expression marker comprises the level or activity of one or more (e.g., two, three, four, or all) of PD-1, PD-L1, LAG-3, TIM-3, or GITR, in the subject, e.g., in a sample from the subject (e.g., a tumor sample).
- the level of PD-1, PD-L1, LAG-3, TIM-3, or GITR is determined by immunohistochemistry (IHC).
- the parameter of a biomarker of an immunologic response comprises the level or sequence of one or more nucleic acid-based markers, in the subject, e.g., in a sample from the subject (e.g., a tumor sample).
- the parameter of systemic cytokine modulation comprises the level or activity of one, two, three, four, five, six, seven, eight, or more (e.g., all) of IL-18, IFN- ⁇ , ITAC
- CXCL11 CXCL11
- IL-6 IL-6
- IL-10 IL-4
- IL-17 IL-15
- TGF-beta TGF-beta
- the parameter of cfDNA comprises the sequence or level of one or more circulating tumor DNA (cfDNA) molecules (e.g., tumor mutation burden), in the subject, e.g., in a sample from the subject (e.g., a blood sample, e.g., a plasma sample).
- cfDNA circulating tumor DNA
- the parameter of systemic immune-modulation comprises phenotypic characterization of an activated immune cell, e.g., a CD3-expressing cell, a CD8-expressing cell, or both, in the subject, e.g., in a sample from the subject (e.g., a blood sample, e.g., a PBMC sample).
- an activated immune cell e.g., a CD3-expressing cell, a CD8-expressing cell, or both
- a sample from the subject e.g., a blood sample, e.g., a PBMC sample.
- the parameter of microbiome comprises the sequence or expression level of one or more genes in the microbiome, in the subject, e.g., in a sample from the subject (e.g., a stool sample).
- the parameter of a marker of activation in a circulating immune cell comprises the level or activity of one, two, three, four, five or more (e.g., all) of circulating CD8+, HLA- DR+Ki67+, T cells, IFN- ⁇ , IL-18, or CXCL11 (IFN- ⁇ induced CCK) expressing cells, in a sample (e.g., a blood sample, e.g., a plasma sample).
- a sample e.g., a blood sample, e.g., a plasma sample.
- the parameter of a circulating cytokine comprises the level or activity of IL-6, in the subject, e.g., in a sample from the subject (e.g., a blood sample, e.g., a plasma sample).
- a sample from the subject e.g., a blood sample, e.g., a plasma sample.
- the therapy comprises a combination described herein (e.g., a combination comprising a therapeutically effective amount of a PD- 1 inhibitor described herein).
- the measure of one or more of (i)- (x) is obtained from a sample acquired from the subject.
- the sample is chosen from a tumor sample, a blood sample (e.g., a plasma sample or a PBMC sample), or a stool sample.
- the subject is evaluated prior to receiving, during, or after receiving, the therapy.
- the measure of one or more of (i)- (x) evaluates a profile for one or more of gene expression, flow cytometry or protein expression.
- the presence of an increased level or activity of one, two, three, four, five, or more (e.g., all) of circulating CD8+, HLA-DR+Ki67+, T cells, IFN- ⁇ , IL-18, or CXCL11 (IFN- ⁇ induced CCK) expressing cells, and/or the presence of an decreased level or activity of IL-6, in the subject or sample, is a positive predictor of the effectiveness of the therapy.
- administering to the subject an additional agent (e.g., a therapeutic agent described herein) in combination with the therapy; or
- FIG.1 shows a Western blot of cell lysates from four MC38 cell lines (A-D) probed with an antibody against Galectin-3 or an antibody against Galectin-1.
- Sample A represents wild type MC38 cells;
- B represents Galectin-3 deleted MC38 cells,
- C represents Galectin-1 deleted MC38 cells, and
- D represents MC38 cells in which both Galectin-1 and Galectin-3 have been deleted.
- FIG.2 depicts flow cytometry analysis of tumors derived from MC38 derived cells lines A-D that were implanted in immunocompetent mice. Tumor cells were dissociated and stained with an anti- CD45 antibody.
- FIG.3 shows a graph of mean tumor volume of tumors generated from MC38 derived cells lines A-D in immunocompetent mice.
- the graph depicts mean tumor volume (y-axis) as a function of time post-implant in days (x-axis).
- FIGS.4A-4B depict graphs of IL-2 production from the SEB assay with samples from donor E411.
- FIG.4A shows a graph of Group 1 parameters tested which include a fixed dose of PDR001 and/or LAG525 with titrations of GWN323.
- FIG.4B shows a graph of Group 2 parameters tested which include a fixed dose of PDR001 and/or GWN323 with titrations of LAG525.
- FIGS.5A-5B depict graphs of IL-2 production from the SEB assay with samples from donor E490.
- FIG.5A shows a graph of Group 1 parameters tested which include a fixed dose of PDR001 and/or LAG525 with titrations of GWN323.
- FIG.5B shows a graph of Group 2 parameters tested which include a fixed dose of PDR001 and/or GWN323 with titrations of LAG525.
- FIGS.6A-6B depict graphs of IL-2 production from the SEB assay with samples from donor 1876.
- FIG.6A shows a graph of Group 1 parameters tested which include a fixed dose of PDR001 and/or LAG525 with titrations of GWN323.
- FIG.6B shows a graph of Group 2 parameters tested which include a fixed dose of PDR001 and/or GWN323 with titrations of LAG525.
- FIG.7 depicts PD-L1 expression in F480+ and F480- cells harvested from MC38 tumors implanted in mice treated with vehicle control, BLZ 945 and isotype control, vehicle and an anti-TIM3 antibody (5D12), or BLZ945 and an anti-TIM3 antibody (5D12).
- FIGS.8A-8B demonstrate TIM-3 expression in CD103+ dendritic cells from colon carcinoma infiltrates obtained from WT or TIM-3 KO mice.
- FIG.8A shows dot-plots of TIM-3 expression in CD103+/- cells from TIM-3 WT mice, and TIM-3 expression in CD103+ cells from TIM-3 KO mice.
- FIG.8B shows the quantity of infiltrated CD103+ cells per cm3 tumor in colon carcinomas harvested from TIM-3 WT or TIM-3 KO mice.
- the articles “a” and “an” refer to one or to more than one (e.g., to at least one) of the grammatical object of the article.
- the term “or” is used herein to mean, and is used interchangeably with, the term “and/or”, unless context clearly indicates otherwise.
- “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
- the articles “a” and “an” refer to one or to more than one (e.g., to at least one) of the grammatical object of the article.
- “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
- the therapeutic agents in the combination can be administered concurrently with, prior to, or subsequent to, one or more other additional therapies or therapeutic agents.
- the therapeutic agents or therapeutic protocol can be administered in any order. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent. It will further be appreciated that the additional therapeutic agent utilized in this combination may be administered together in a single composition or administered separately in different compositions. In general, it is expected that additional therapeutic agents utilized in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
- the additional therapeutic agent is administered at a therapeutic or lower-than therapeutic dose.
- the concentration of the second therapeutic agent that is required to achieve inhibition, e.g., growth inhibition is lower when the second therapeutic agent is administered in combination with the first therapeutic agent, e.g., the anti-PD-1 antibody molecule, than when the second therapeutic agent is administered individually.
- the concentration of the first therapeutic agent that is required to achieve inhibition, e.g., growth inhibition is lower when the first therapeutic agent is administered in combination with the second therapeutic agent than when the first therapeutic agent is administered individually.
- the concentration of the second therapeutic agent that is required to achieve inhibition, e.g., growth inhibition is lower than the therapeutic dose of the second therapeutic agent as a monotherapy, e.g., 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, or 80-90% lower.
- the concentration of the first therapeutic agent that is required to achieve inhibition, e.g., growth inhibition is lower than the therapeutic dose of the first therapeutic agent as a monotherapy, e.g., 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, or 80-90% lower.
- inhibitortion includes a reduction in a certain parameter, e.g., an activity, of a given molecule, e.g., an immune checkpoint inhibitor.
- a certain parameter e.g., an activity, of a given molecule, e.g., an immune checkpoint inhibitor.
- inhibition of an activity e.g., an activity of a given molecule, e.g., an inhibitory molecule, of at least 5%, 10%, 20%, 30%, 40% or more is included by this term.
- inhibition need not be 100%.
- A“fusion protein” and a“fusion polypeptide” refer to a polypeptide having at least two portions covalently linked together, where each of the portions is a polypeptide having a different property.
- the property may be a biological property, such as activity in vitro or in vivo.
- the property can also be simple chemical or physical property, such as binding to a target molecule, catalysis of a reaction, etc.
- the two portions can be linked directly by a single peptide bond or through a peptide linker, but are in reading frame with each other.
- activation includes an increase in a certain parameter, e.g., an activity, of a given molecule, e.g., a costimulatory molecule.
- a certain parameter e.g., an activity, of a given molecule
- a costimulatory molecule e.g., a costimulatory molecule
- increase of an activity, e.g., a costimulatory activity, of at least 5%, 10%, 25%, 50%, 75% or more is included by this term.
- anti-cancer effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of cancer cells, a decrease in the number of metastases, an increase in life expectancy, decrease in cancer cell proliferation, decrease in cancer cell survival, or amelioration of various physiological symptoms associated with the cancerous condition.
- An“anti-cancer effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies in prevention of the occurrence of cancer in the first place.
- anti-tumor effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in tumor cell proliferation, or a decrease in tumor cell survival.
- cancer refers to a disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers are described herein and include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer and the like.
- tumor and“cancer” are used interchangeably herein, e.g., both terms encompass solid and liquid, e.g., diffuse or circulating, tumors.
- cancer includes premalignant, as well as malignant cancers and tumors.
- cancer includes primary malignant cells or tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor) and secondary malignant cells or tumors (e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor).
- the terms“treat,”“treatment” and“treating” refer to the reduction or amelioration of the progression, severity and/or duration of a disorder, e.g., a proliferative disorder, or the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of the disorder resulting from the administration of one or more therapies.
- the terms“treat,”“treatment” and “treating” refer to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as growth of a tumor, not necessarily discernible by the patient.
- the terms“treat”,“treatment” and“treating” refer to the inhibition of the progression of a proliferative disorder, either physically by, e.g., stabilization of a discernible symptom, physiologically by, e.g., stabilization of a physical parameter, or both.
- the terms“treat”,“treatment” and “treating” refer to the reduction or stabilization of tumor size or cancerous cell count.
- compositions and methods of the present invention encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95%, 96%, 97%, 98%, 99% identical or higher to the sequence specified.
- substantially identical is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity.
- amino acid sequences that contain a common structural domain having at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
- nucleotide sequence in the context of nucleotide sequence, the term "substantially identical" is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
- “functional variant” refers to polypeptides that have a substantially identical amino acid sequence to the naturally-occurring sequence, or are encoded by a substantially identical nucleotide sequence, and are capable of having one or more activities of the naturally-occurring sequence.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
- the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the nucleic acid and protein sequences described herein can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol.215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res.25:3389-3402.
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions describes conditions for hybridization and washing.
- Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6, which is incorporated by reference. Aqueous and nonaqueous methods are described in that reference and either can be used.
- Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions in 6X sodium chloride/sodium citrate (SSC) at about 45oC, followed by two washes in 0.2X SSC, 0.1% SDS at least at 50oC (the temperature of the washes can be increased to 55oC for low stringency conditions); 2) medium stringency hybridization conditions in 6X SSC at about 45oC, followed by one or more washes in 0.2X SSC, 0.1% SDS at 60oC; 3) high stringency hybridization conditions in 6X SSC at about 45oC, followed by one or more washes in 0.2X SSC, 0.1% SDS at 65oC; and preferably 4) very high stringency hybridization conditions are 0.5M sodium phosphate, 7% SDS at 65oC, followed by one or more washes at 0.2X SSC, 1% SDS at 65oC. Very high stringency conditions (4) are the preferred conditions and the ones that should be used unless otherwise specified.
- molecules of the present invention may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on their functions.
- amino acid is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids.
- exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing.
- amino acid includes both the D- or L- optical isomers and peptidomimetics.
- a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
- beta-branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
- polypeptide polypeptide
- peptide protein
- protein protein
- the terms “polypeptide”, “peptide” and “protein” (if single chain) are used interchangeably herein to refer to polymers of amino acids of any length.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
- the polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
- nucleic acid refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- the polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non coding (antisense) strand.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- the nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a nonnatural arrangement.
- isolated refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring).
- a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated.
- Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
- a combination described herein comprises a therapeutic agent which is an antibody molecule.
- antibody molecule refers to a protein comprising at least one immunoglobulin variable domain sequence.
- the term antibody molecule includes, for example, full- length, mature antibodies and antigen-binding fragments of an antibody.
- an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL).
- an antibody molecule in another example, includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab’, F(ab’)2, Fc, Fd, Fd’, Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g., humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor.
- Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgG1, IgG2, IgG3, and IgG4) of antibodies.
- the antibodies of the present invention can be monoclonal or polyclonal.
- the antibody can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
- the antibody can have a heavy chain constant region chosen from, e.g., IgG1, IgG2, IgG3, or IgG4.
- the antibody can also have a light chain chosen from, e.g., kappa or lambda.
- antigen-binding fragments include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g., Bird et al.
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
- a F(ab')2 fragment a bivalent fragment comprising two Fab fragments linked by a
- antibody includes intact molecules as well as functional fragments thereof. Constant regions of the antibodies can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- Antibody molecules can also be single domain antibodies. Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies.
- Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine.
- a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains.
- Such single domain antibodies are disclosed in WO 9404678, for example.
- this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
- Such a VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco.
- Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
- VH and VL regions can be subdivided into regions of hypervariability, termed
- CDR complementarity determining regions
- FR framework regions
- CDR complementarity determining region
- HCDR1, HCDR2, HCDR3 three CDRs in each heavy chain variable region
- LCDR1, LCDR2, LCDR3 three CDRs in each light chain variable region
- the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991),“Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (“Kabat” numbering scheme), Al-Lazikani et al., (1997) JMB 273,927-948 (“Chothia” numbering scheme). As used herein, the CDRs defined according the“Chothia” number scheme are also sometimes referred to as“hypervariable loops.”
- the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89- 97 (LCDR3).
- the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the amino acid residues in VL are numbered 26-32 (LCDR1), 50- 52 (LCDR2), and 91-96 (LCDR3).
- the CDRs consist of amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3) in human VH and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3) in human VL.
- an“immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain.
- the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain.
- the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
- antigen-binding site refers to the part of an antibody molecule that comprises determinants that form an interface that binds to the PD-1 polypeptide, or an epitope thereof.
- the antigen-binding site typically includes one or more loops (of at least four amino acids or amino acid mimics) that form an interface that binds to the PD-1 polypeptide.
- the antigen-binding site of an antibody molecule includes at least one or two CDRs and/or hypervariable loops, or more typically at least three, four, five or six CDRs and/or hypervariable loops.
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
- An“effectively human” protein is a protein that does not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response.
- HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition.
- a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al., Cancer Immunol. Immunother., 32:180-190 (1990)) and also because of potential allergic reactions (see, e.g., LoBuglio et al., Hybridoma, 5:5117-5123 (1986)).
- the antibody molecule can be a polyclonal or a monoclonal antibody. In other embodiments, the antibody can be recombinantly produced, e.g., produced by phage display or by combinatorial methods.
- Phage display and combinatorial methods for generating antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Patent No. 5,223,409; Kang et al. International Publication No. WO 92/18619; Dower et al. International Publication No. WO 91/17271; Winter et al. International
- the antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human immunoglobulin sequence), or a non-human antibody, e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody.
- a rodent mouse or rat
- the non-human antibody is a rodent (mouse or rat antibody).
- Methods of producing rodent antibodies are known in the art.
- Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g., Wood et al. International Application WO
- An antibody can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR-grafted, and humanized antibodies are within the invention. Antibodies generated in a non-human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
- Chimeric antibodies can be produced by recombinant DNA techniques known in the art (see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S. Patent No.4,816,567; Cabilly et al., European Patent Application 125,023; Better et al. (1988 Science 240:1041-1043); Liu et al.
- a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immuoglobulin chains) replaced with a donor CDR.
- the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to PD-1.
- the donor will be a rodent antibody, e.g., a rat or mouse antibody
- the recipient will be a human framework or a human consensus framework.
- the immunoglobulin providing the CDRs is called the "donor” and the immunoglobulin providing the framework is called the “acceptor.”
- the donor immunoglobulin is a non-human (e.g., rodent).
- the acceptor framework is a naturally-occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, preferably 90%, 95%, 99% or higher identical thereto.
- Consensus sequence refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
- a “consensus framework” refers to the framework region in the consensus immunoglobulin sequence.
- An antibody can be humanized by methods known in the art (see e.g., Morrison, S. L., 1985, Science 229:1202-1207, by Oi et al., 1986, BioTechniques 4:214, and by Queen et al. US 5,585,089, US 5,693,761 and US 5,693,762, the contents of all of which are hereby incorporated by reference).
- Humanized or CDR-grafted antibodies can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced. See e.g., U.S. Patent 5,225,539; Jones et al.1986 Nature 321:552-525; Verhoeyan et al.1988 Science 239:1534; Beidler et al. 1988 J. Immunol.141:4053-4060; Winter US 5,225,539, the contents of all of which are hereby expressly incorporated by reference. Winter describes a CDR-grafting method which may be used to prepare the humanized antibodies of the present invention (UK Patent Application GB 2188638A, filed on March 26, 1987; Winter US 5,225,539), the contents of which is expressly incorporated by reference.
- humanized antibodies in which specific amino acids have been substituted, deleted or added. Criteria for selecting amino acids from the donor are described in US 5,585,089, e.g., columns 12-16 of US 5,585,089, e.g., columns 12-16 of US 5,585,089, the contents of which are hereby incorporated by reference. Other techniques for humanizing antibodies are described in Padlan et al. EP 519596 A1, published on December 23, 1992.
- the antibody molecule can be a single chain antibody.
- a single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52).
- the single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target protein.
- the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE;
- the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
- the constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
- the antibody has: effector function; and can fix complement.
- the antibody does not; recruit effector cells; or fix complement.
- the antibody has reduced or no ability to bind an Fc receptor.
- it is a isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
- Antibodies with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the C1 component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 A1, U.S. Pat. No.5,624,821 and U.S. Pat. No. 5,648,260, the contents of all of which are hereby incorporated by reference). Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
- an antibody molecule can be derivatized or linked to another functional molecule (e.g., another peptide or protein).
- a "derivatized" antibody molecule is one that has been modified. Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin. Accordingly, the antibody molecules of the invention are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules.
- an antibody molecule can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- another antibody e.g., a bispecific antibody or a diabody
- detectable agent e.g., a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- One type of derivatized antibody molecule is produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bispecific antibodies).
- Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate).
- Such linkers are available from Pierce Chemical Company, Rockford, Ill.
- An antibody molecules may be conjugated to another molecular entity, typically a label or a therapeutic (e.g., a cytotoxic or cytostatic) agent or moiety.
- Radioactive isotopes can be used in diagnostic or therapeutic applications. Radioactive isotopes that can be coupled to the anti-PSMA antibodies include, but are not limited to ⁇ -, ⁇ -, or ⁇ -emitters, or ⁇ -and ⁇ -emitters.
- radioactive isotopes include, but are not limited to iodine ( 131 I or 125 I), yttrium ( 90 Y), lutetium ( 177 Lu), actinium ( 225 Ac), praseodymium, astatine ( 211 At), rhenium ( 186 Re), bismuth ( 212 Bi or 213 Bi), indium ( 111 In), technetium ( 99 mTc), phosphorus ( 32 P), rhodium ( 188 Rh), sulfur (35S) , carbon ( 14 C), tritium ( 3 H), chromium ( 51 Cr), chlorine ( 36 Cl), cobalt ( 57 Co or 58 Co), iron ( 59 Fe), selenium ( 75 Se), or gallium ( 67 Ga).
- Radioisotopes useful as therapeutic agents include yttrium ( 90 Y), lutetium ( 177 Lu), actinium ( 225 Ac), praseodymium, astatine ( 211 At), rhenium ( 186 Re), bismuth ( 212 Bi or 213 Bi), and rhodium ( 188 Rh).
- Radioisotopes useful as labels include iodine ( 131 I or 125 I), indium ( 111 In), technetium ( 99 mTc), phosphorus ( 32 P), carbon ( 14 C), and tritium ( 3 H), or one or more of the therapeutic isotopes listed above.
- the invention provides radiolabeled antibody molecules and methods of labeling the same.
- a method of labeling an antibody molecule is disclosed. The method includes contacting an antibody molecule, with a chelating agent, to thereby produce a conjugated antibody.
- the conjugated antibody is radiolabeled with a radioisotope, e.g., 111Indium, 90Yttrium and 177Lutetium, to thereby produce a labeled antibody molecule.
- the antibody molecule can be conjugated to a therapeutic agent.
- therapeutically active radioisotopes have already been mentioned.
- examples of other therapeutic agents include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicine, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin, maytansinoids, e.g., maytansinol (see U.S. Pat.
- Therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6- thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, CC-1065, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclinies (e.g., daunorubicin (formerly daunomycin) and doxorubicin
- antimetabolites e.g., methotrexate, 6-mercaptopurine, 6- thioguanine, cytarabine, 5-fluorouracil decarba
- an antibody molecule is a multispecific antibody molecule, e.g., it comprises a plurality of immunoglobulin variable domains sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap. In an embodiment the first and second epitopes do not overlap.
- first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
- a multispecific antibody molecule comprises a third, fourth or fifth immunoglobulin variable domain.
- a multispecific antibody molecule is a bispecific antibody molecule, a trispecific antibody molecule, or tetraspecific antibody molecule.
- the Galectin inhibitor is a multispecific antibody molecule.
- a multispecific antibody molecule is a bispecific antibody molecule.
- a bispecific antibody has specificity for no more than two antigens.
- a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap.
- the first and second epitopes do not overlap.
- first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
- a bispecific antibody molecule comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody having binding specificity for a first epitope and a half antibody having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a scFv, or fragment thereof, have binding specificity for a first epitope and a scFv, or fragment thereof, have binding specificity for a second epitope.
- the Galectin inhibitor is a bispecific antibody molecule.
- the first epitope is located on Galectin- 1
- the second epitope is located on Galectin-3.
- Protocols for generating bispecific or heterodimeric antibody molecules are known in the art; including but not limited to, for example, the“knob in a hole” approach described in, e.g. , US5731168 ; the electrostatic steering Fc pairing as described in, e.g., WO 09/089004, WO 06/106905 and WO 2010/129304; Strand Exchange Engineered Domains (SEED) heterodimer formation as described in, e.g., WO 07/110205; Fab arm exchange as described in, e.g., WO 08/119353, WO 2011/131746, and WO 2013/060867; double antibody conjugate, e.g., by antibody cross-linking to generate a bi-specific structure using a heterobifunctional reagent having an amine -reactive group and a sulfhydryl reactive group as described in, e.g., US4433059; bispecific antibody determinants generated by recombining half antibodies (heavy-light chain
- trifunctional antibodies e.g., three Fab' fragments cross-linked through sulfhdryl reactive groups, as described in, e.g., US5273743; biosynthetic binding proteins, e.g., pair of scFvs cross-linked through C- terminal tails preferably through disulfide or amine-reactive chemical cross-linking, as described in, e.g., US5534254; bifunctional antibodies, e.g., Fab fragments with different binding specificities dimerized through leucine zippers (e.g., c-fos and c-jun) that have replaced the constant domain, as described in, e.g., US5582996; bispecific and oligospecific mono-and oligovalent receptors, e.g., VF1-CF11 regions of two antibodies (two Fab fragments) linked through a polypeptide spacer between the CPU region of one antibody and the VH region of the other antibody typically with associated light chains, as described in,
- bispecific fusion proteins e.g., an expression construct containing two scFvs with a hydrophilic helical peptide linker between them and a full constant region, as described in, e.g., US5637481; multivalent and multispecific binding proteins, e.g., dimer of polypeptides having first domain with binding region of Ig heavy chain variable region, and second domain with binding region of Ig light chain variable region, generally termed diabodies (higher order structures are also disclosed creating bispecific, trispecific, or tetraspecific molecules, as described in, e.g., US5837242; minibody constructs with linked VL and VH chains further connected with peptide spacers to an antibody hinge region and CH3 region, which can be dimerized to form bispecific/multivalent molecules, as described in, e.g., US5837821; VH and VL domains linked with a short peptide linker (e.g., 5 or 10 amino acids
- the contents of the above-referenced applications are incorporated herein by reference in their entireties.
- the anti-Galectin e.g., anti-Galectin-1 or anti-Galectin-3, antibody molecule
- a monospecific, bispecific, or multispecific antibody molecule is covalently linked, e.g., fused, to another partner e.g., a protein, e.g., as a fusion molecule for example a fusion protein.
- a bispecific antibody molecule has a first binding specificity to a first target (e.g., to Galectin-1), a second binding specificity to a second target (e.g., Galectin-3).
- This invention provides an isolated nucleic acid molecule encoding the above antibody molecule, vectors and host cells thereof.
- the nucleic acid molecule includes but is not limited to RNA, genomic DNA and cDNA.
- a combination described herein comprises a PD-1 inhibitor.
- the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680 (Medimmune), REGN2810 (Regeneron), TSR-042 (Tesaro), PF-06801591 (Pfizer), BGB-A317 (Beigene), BGB-108 (Beigene), INCSHR1210 (Incyte), or AMP-224 (Amplimmune).
- the PD-1 inhibitor is PDR001.
- PDR001 is also known as Spartalizumab.
- the PD-1 inhibitor is an anti-PD-1 antibody molecule. In one embodiment, the PD-1 inhibitor is an anti-PD-1 antibody molecule as described in US 2015/0210769, published on July 30, 2015, entitled“Antibody Molecules to PD-1 and Uses Thereof,” incorporated by reference in its entirety. In some embodiments, the anti-PD-1 antibody molecule is Spartalizumab (PDR001).
- the anti-PD-1 antibody molecule comprises at least one, two, three, four, five or six complementarity determining regions (CDRs) (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1 (e.g., from the heavy and light chain variable region sequences of BAP049-Clone-E or BAP049-Clone-B disclosed in Table 1), or encoded by a nucleotide sequence shown in Table 1.
- the CDRs are according to the Kabat definition (e.g., as set out in Table 1).
- the CDRs are according to the Chothia definition (e.g., as set out in Table 1).
- the CDRs are according to the combined CDR definitions of both Kabat and Chothia (e.g., as set out in Table 1).
- the combination of Kabat and Chothia CDR of VH CDR1 comprises the amino acid sequence
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions (e.g., conservative amino acid substitutions) or deletions, relative to an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
- the anti-PD-1 antibody molecule comprises a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 501, a VHCDR2 amino acid sequence of SEQ ID NO: 502, and a VHCDR3 amino acid sequence of SEQ ID NO: 503; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 510, a VLCDR2 amino acid sequence of SEQ ID NO: 511, and a VLCDR3 amino acid sequence of SEQ ID NO: 512, each disclosed in Table 1.
- VH heavy chain variable region
- VL light chain variable region
- the antibody molecule comprises a VH comprising a VHCDR1 encoded by the nucleotide sequence of SEQ ID NO: 524, a VHCDR2 encoded by the nucleotide sequence of SEQ ID NO: 525, and a VHCDR3 encoded by the nucleotide sequence of SEQ ID NO: 526; and a VL comprising a VLCDR1 encoded by the nucleotide sequence of SEQ ID NO: 529, a VLCDR2 encoded by the nucleotide sequence of SEQ ID NO: 530, and a VLCDR3 encoded by the nucleotide sequence of SEQ ID NO: 531, each disclosed in Table 1.
- the anti-PD-1 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 506, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 506. In one embodiment, the anti-PD-1 antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 520, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 520. In one embodiment, the anti-PD-1 antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 516, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 516.
- the anti-PD-1 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 506 and a VL comprising the amino acid sequence of SEQ ID NO: 520. In one embodiment, the anti-PD- 1 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 506 and a VL comprising the amino acid sequence of SEQ ID NO: 516.
- the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 507, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 507. In one embodiment, the antibody molecule comprises a VL encoded by the nucleotide sequence of SEQ ID NO: 521 or 517, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 521 or 517. In one embodiment, the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 507 and a VL encoded by the nucleotide sequence of SEQ ID NO: 521 or 517.
- the anti-PD-1 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 508, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 508. In one embodiment, the anti-PD-1 antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 522, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 522. In one embodiment, the anti-PD-1 antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 518, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 518.
- the anti-PD-1 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 508 and a light chain comprising the amino acid sequence of SEQ ID NO: 522. In one embodiment, the anti-PD-1 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 508 and a light chain comprising the amino acid sequence of SEQ ID NO: 518.
- the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 509, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 509.
- the antibody molecule comprises a light chain encoded by the nucleotide sequence of SEQ ID NO: 523 or 519, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 523 or 519.
- the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 509 and a light chain encoded by the nucleotide sequence of SEQ ID NO: 523 or 519.
- the antibody molecules described herein can be made by vectors, host cells, and methods described in US 2015/0210769, incorporated by reference in its entirety. Table 1. Amino acid and nucleotide sequences of exemplary anti-PD-1 antibody molecules
- GKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTISSLQPEDIATYY CQNDYSYPYTFGQGTKVEIK SEQ ID NO: 517 DNA VL GAGATCGTCCTGACTCAGTCACCCGCTACCCTGAGCCTGAGCCC
- the PD-1 inhibitor is administered at a dose of about 200 mg to about 500 mg (e.g., about 300 mg to about 400 mg). In some embodiments, the PD-1 inhibitor is administered once every 3 weeks. In some embodiments, the PD-1 inhibitor is administered once every 4 weeks. In other embodiments, the PD-1 inhibitor is administered at a dose of about 200 mg to about 400 mg (e.g., about 300 mg) once every 3 weeks. In yet other embodiments, the PD-1 inhibitor is administered at a dose of about 300 mg to about 500 mg (e.g., about 400 mg) once every 4 weeks.
- the combination comprises a PD-1 inhibitor, e.g., PDR001, and a TGF- ⁇ inhibitor, e.g., NIS793.
- this combination is administered to a subject in a therapeutically effective amount to treat, e.g., a pancreatic cancer.
- the combination comprises a PD-1 inhibitor, e.g., PDR001, and a TLR7 agonist, e.g., LHC165.
- this combination is administered to a subject in a therapeutically effective amount to treat, e.g., a pancreatic cancer.
- the TLR7 agonist, e.g., LHC165 is administered via intra-tumoral injection.
- the combination comprises a PD-1 inhibitor, e.g., PDR001, and an adenosine receptor antagonist, e.g., PBF509 (NIR178).
- this combination is administered to a subject in a therapeutically effective amount to treat, e.g., a pancreatic cancer.
- the combination comprises a PD-1 inhibitor, e.g., PDR001, and an inhibitor of Porcupine, e.g., WNT974.
- this combination is administered to a subject in a therapeutically effective amount to treat, e.g., a pancreatic cancer.
- the combination comprises a PD-1 inhibitor, e.g., PDR001, and an A2aR antagonist, e.g., PBF509 (NIR178).
- this combination is administered to a subject in a therapeutically effective amount to treat, e.g., a CRC or gastric cancer.
- a combination comprising a PD-1 inhibitor, e.g., PDR001, and an A2aR antagonist, e.g., PBF509 (NIR178), can result in increased efficacy of the anti-PD-1 inhibitor.
- the combination of a PD-1 inhibitor, e.g., PDR001, and an A2aR antagonist, e.g., PBF509 (NIR178) results in regression of a CRC tumor.
- the combination comprises a PD-1 inhibitor, e.g., PDR001, and a PD-L1 inhibitor, e.g., FAZ053.
- the combination is administered to a subject in a therapeutically effective amount to treat, e.g., a breast cancer, e.g., a triple negative breast cancer.
- a PD-1 inhibitor e.g., PDR001
- a PD-L1 inhibitor e.g., FAZ053.
- the combination is administered to a subject in a therapeutically effective amount to treat, e.g., a breast cancer, e.g., a triple negative breast cancer.
- the anti-PD-1 antibody molecule is Nivolumab (Bristol-Myers Squibb), also known as MDX-1106, MDX-1106-04, ONO-4538, BMS-936558, or OPDIVO®. Nivolumab (clone 5C4) and other anti-PD-1 antibodies are disclosed in US 8,008,449 and WO 2006/121168, incorporated by reference in their entirety.
- the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of Nivolumab, e.g., as disclosed in Table 2.
- the anti-PD-1 antibody molecule is Pembrolizumab (Merck & Co), also known as Lambrolizumab, MK-3475, MK03475, SCH-900475, or KEYTRUDA®.
- Pembrolizumab and other anti-PD-1 antibodies are disclosed in Hamid, O. et al. (2013) New England Journal of Medicine 369 (2): 134–44, US 8,354,509, and WO 2009/114335, incorporated by reference in their entirety.
- the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of Pembrolizumab, e.g., as disclosed in Table 2.
- the anti-PD-1 antibody molecule is Pidilizumab (CureTech), also known as CT-011. Pidilizumab and other anti-PD-1 antibodies are disclosed in Rosenblatt, J. et al. (2011) J Immunotherapy 34(5): 409-18, US 7,695,715, US 7,332,582, and US 8,686,119, incorporated by reference in their entirety.
- the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of Pidilizumab, e.g., as disclosed in Table 2.
- the anti-PD-1 antibody molecule is MEDI0680 (Medimmune), also known as AMP-514.
- MEDI0680 and other anti-PD-1 antibodies are disclosed in US 9,205,148 and WO
- the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of MEDI0680.
- the anti-PD-1 antibody molecule is REGN2810 (Regeneron). In one embodiment, the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of REGN2810.
- the anti-PD-1 antibody molecule is PF-06801591 (Pfizer). In one embodiment, the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of PF-06801591.
- the anti-PD-1 antibody molecule is BGB-A317 or BGB-108 (Beigene). In one embodiment, the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of BGB-A317 or BGB-108.
- the anti-PD-1 antibody molecule is INCSHR1210 (Incyte), also known as INCSHR01210 or SHR-1210. In one embodiment, the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of INCSHR1210.
- the anti-PD-1 antibody molecule is TSR-042 (Tesaro), also known as ANB011.
- the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of TSR-042.
- anti-PD-1 antibodies include those described, e.g., in WO 2015/112800, WO 2016/092419, WO 2015/085847, WO 2014/179664, WO 2014/194302, WO 2014/209804, WO
- the anti-PD-1 antibody is an antibody that competes for binding with, and/or binds to the same epitope on PD-1 as, one of the anti-PD-1 antibodies described herein.
- the PD-1 inhibitor is a peptide that inhibits the PD-1 signaling pathway, e.g., as described in US 8,907,053, incorporated by reference in its entirety.
- the PD-1 inhibitor is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD-1 binding portion of PD-L1 or PD-L2 fused to a constant region (e.g., an Fc region of an immunoglobulin sequence).
- the PD-1 inhibitor is AMP-224 (B7-DCIg (Amplimmune), e.g., disclosed in WO 2010/027827 and WO 2011/066342, incorporated by reference in their entirety). Table 2. Amino acid sequences of other exemplary anti-PD-1 antibody molecules
- the combination comprises a PD-1 inhibitor (e.g., PDR001), and an inhibitor of apoptosis (IAP) inhibitor (e.g., LCL161).
- a PD-1 inhibitor e.g., PDR001
- an inhibitor of apoptosis (IAP) inhibitor e.g., LCL161.
- the combination comprises PDR001 and an IAP inhibitor.
- the combination comprises PDR001 and LCL161.
- the IAP inhibitor comprises LCL161 or a compound disclosed in
- the IAP inhibitor e.g., LCL161
- the IAP inhibitor is administered daily at a dose of 100-2000mg, or 200-1500mg, e.g., about 300-900mg.
- the IAP inhibitor e.g., LCL161
- the IAP inhibitor e.g., LCL161
- the IAP inhibitor (e.g., LCL161), is administered once a week at a dose of about 300-900mg. In some embodiments, the IAP inhibitor (e.g., LCL161), is administered once a week at a dose of 300 mg. In some embodiments, the IAP inhibitor (e.g., LCL161), is administered once a week at a dose of 900 mg. In some embodiments, this combination is administered to a subject in a therapeutically effective amount to treat a cancer, e.g., a cancer described herein, e.g., a colorectal cancer.
- a cancer e.g., a cancer described herein, e.g., a colorectal cancer.
- the combination comprises a PD-1 inhibitor (e.g., PDR001), and an mTOR inhibitor, e.g., RAD001 (also known as everolimus).
- the combination comprises PDR001 and an mTOR inhibitor, e.g., RAD001.
- the combination comprises PDR001 and RAD001.
- the mTOR inhibitor, e.g., RAD001 is administered once weekly at a dose of at least 0.5 mg, 1 mg, 2 mg, 3 mg, 4 mg, 5 mg, 6 mg, 7 mg, 8 mg, 9 mg, or 10 mgs.
- the mTOR inhibitor e.g., RAD001
- the mTOR inhibitor is administered once weekly at a dose of 10mg.
- the mTOR inhibitor e.g., RAD001
- the mTOR inhibitor is administered once weekly at a dose of 5mg.
- the mTOR inhibitor, e.g., RAD001 is administered once daily at a dose of at least 0.5mg, 1 mg, 2 mg, 3 mg, 4 mg, 5 mg, 6 mg, 7 mg, 8 mg, 9 mg, or 10 mgs.
- the mTOR inhibitor, e.g., RAD001 is administered once daily at a dose of 0.5mg.
- this combination is administered to a subject in a therapeutically effective amount to treat a cancer, e.g., a cancer described herein, e.g., a colorectal cancer.
- the combination comprises a PD-1 inhibitor (e.g., PDR001), and a HDAC inhibitor, e.g., LBH589.
- LBH589 is also known as panobinostat.
- the combination comprises PDR001 and a HDAC inhibitor, e.g., LBH589.
- the combination comprises PDR001 and LHB589.
- the HDAC inhibitor, e.g., LBH589 is administered at a dose of at least 10, 15, 20, 25, 30, 40, 50, 60, 70, or 80 mg.
- the HDAC inhibitor, e.g., LBH589 is administered at a dose of 20mg.
- the HDAC inhibitor, e.g., LBH589 is administered at a dose of 10mg. In some embodiments, the HDAC inhibitor, e.g., LBH589 is administered at a dose of 10mg or 20mg once every other day, e.g., on days 1, 3, 5, 8, 10 and 12, of a dosing cycle, e.g., a dosing cycle consisting of 21 days. In some embodiments, the HDAC inhibitor, e.g., LBH589, is administered every other day, e.g., administered three times a week.
- the HDAC inhibitor e.g., LBH589
- the HDAC inhibitor is administered for at least dosing 8 cycles, e.g., 1, 2, 3, 4, 5, 6, 7, or 8 cycles, wherein each dosing cycle consists of 21 days.
- the HDAC inhibitor, e.g., LBH589 is administered at a dose of 10mg or 20mg on days 1, 3, 5, 8, 10 and 12 of a dosing cycle, for 8 dosing cycles.
- this combination is administered to a subject in a therapeutically effective amount to treat a cancer, e.g., a cancer described herein, e.g., a colorectal cancer or multiple myeloma.
- the combination comprises a PD-1 inhibitor (e.g., PDR001), and an IL-17 inhibitor, e.g., CJM112.
- the combination comprises PDR001 and an IL-17 inhibitor, e.g., CJM112.
- the combination comprises PDR001 and CJM112.
- this combination is administered to a subject in a therapeutically effective amount to treat a cancer, e.g., a cancer described herein, e.g., a colorectal cancer.
- a combination described herein comprises a LAG-3 inhibitor.
- the LAG-3 inhibitor is chosen from LAG525 (Novartis), BMS-986016 (Bristol-Myers Squibb), or TSR-033 (Tesaro).
- Exemplary LAG-3 Inhibitors are chosen from LAG525 (Novartis), BMS-986016 (Bristol-Myers Squibb), or TSR-033 (Tesaro).
- the LAG-3 inhibitor is an anti-LAG-3 antibody molecule. In one embodiment, the LAG-3 inhibitor is an anti-LAG-3 antibody molecule as disclosed in US 2015/0259420, published on September 17, 2015, entitled“Antibody Molecules to LAG-3 and Uses Thereof,” incorporated by reference in its entirety.
- the anti-LAG-3 antibody molecule comprises at least one, two, three, four, five or six complementarity determining regions (CDRs) (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 5 (e.g., from the heavy and light chain variable region sequences of BAP050-Clone I or BAP050-Clone J disclosed in Table 5), or encoded by a nucleotide sequence shown in Table 5.
- the CDRs are according to the Kabat definition (e.g., as set out in Table 5).
- the CDRs are according to the Chothia definition (e.g., as set out in Table 5).
- the CDRs are according to the combined CDR definitions of both Kabat and Chothia (e.g., as set out in Table 5).
- the combination of Kabat and Chothia CDR of VH CDR1 comprises the amino acid sequence GFTLTNYGMN (SEQ ID NO: 766).
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions (e.g., conservative amino acid substitutions) or deletions, relative to an amino acid sequence shown in Table 5, or encoded by a nucleotide sequence shown in Table 5.
- the anti-LAG-3 antibody molecule comprises a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 701, a VHCDR2 amino acid sequence of SEQ ID NO: 702, and a VHCDR3 amino acid sequence of SEQ ID NO: 703; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 710, a VLCDR2 amino acid sequence of SEQ ID NO: 711, and a VLCDR3 amino acid sequence of SEQ ID NO: 712, each disclosed in Table 5.
- VH heavy chain variable region
- VL light chain variable region
- the anti-LAG-3 antibody molecule comprises a VH comprising a VHCDR1 encoded by the nucleotide sequence of SEQ ID NO: 736 or 737, a VHCDR2 encoded by the nucleotide sequence of SEQ ID NO: 738 or 739, and a VHCDR3 encoded by the nucleotide sequence of SEQ ID NO: 740 or 741; and a VL comprising a VLCDR1 encoded by the nucleotide sequence of SEQ ID NO: 746 or 747, a VLCDR2 encoded by the nucleotide sequence of SEQ ID NO: 748 or 749, and a VLCDR3 encoded by the nucleotide sequence of SEQ ID NO: 750 or 751, each disclosed in Table 5.
- the anti-LAG-3 antibody molecule comprises a VH comprising a VHCDR1 encoded by the nucleotide sequence of SEQ ID NO: 758 or 737, a VHCDR2 encoded by the nucleotide sequence of SEQ ID NO: 759 or 739, and a VHCDR3 encoded by the nucleotide sequence of SEQ ID NO: 760 or 741; and a VL comprising a VLCDR1 encoded by the nucleotide sequence of SEQ ID NO: 746 or 747, a VLCDR2 encoded by the nucleotide sequence of SEQ ID NO: 748 or 749, and a VLCDR3 encoded by the nucleotide sequence of SEQ ID NO: 750 or 751, each disclosed in Table 5.
- the anti-LAG-3 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 706, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 706. In one embodiment, the anti-LAG-3 antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 718, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 718. In one embodiment, the anti-LAG-3 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 724, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 724.
- the anti-LAG-3 antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 730, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 730.
- the anti-LAG-3 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 706 and a VL comprising the amino acid sequence of SEQ ID NO: 718.
- the anti-LAG-3 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 724 and a VL comprising the amino acid sequence of SEQ ID NO: 730.
- the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 707 or 708, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 707 or 708. In one embodiment, the antibody molecule comprises a VL encoded by the nucleotide sequence of SEQ ID NO: 719 or 720, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 719 or 720.
- the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 725 or 726, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 725 or 726. In one embodiment, the antibody molecule comprises a VL encoded by the nucleotide sequence of SEQ ID NO: 731 or 732, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 731 or 732.
- the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 707 or 708 and a VL encoded by the nucleotide sequence of SEQ ID NO: 719 or 720. In one embodiment, the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 725 or 726 and a VL encoded by the nucleotide sequence of SEQ ID NO: 731 or 732.
- the anti-LAG-3 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 709, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 709.
- the anti-LAG-3 antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 721, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 721.
- the anti-LAG-3 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 727, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 727.
- the anti-LAG-3 antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 733, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 733.
- the anti-LAG-3 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 709 and a light chain comprising the amino acid sequence of SEQ ID NO: 721.
- the anti-LAG-3 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 727 and a light chain comprising the amino acid sequence of SEQ ID NO: 733.
- the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 716 or 717, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 716 or 717.
- the antibody molecule comprises a light chain encoded by the nucleotide sequence of SEQ ID NO: 722 or 723, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 722 or 723.
- the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 728 or 729, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 728 or 729.
- the antibody molecule comprises a light chain encoded by the nucleotide sequence of SEQ ID NO: 734 or 735, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 734 or 735.
- the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 716 or 717 and a light chain encoded by the nucleotide sequence of SEQ ID NO: 722 or 723. In one embodiment, the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 728 or 729 and a light chain encoded by the nucleotide sequence of SEQ ID NO: 734 or 735.
- the antibody molecules described herein can be made by vectors, host cells, and methods described in US 2015/0259420, incorporated by reference in its entirety.
- the LAG-3 inhibitor (e.g., an anti-LAG-3 antibody molecule described herein) is administered at a dose of about 300-1000mg, e.g., about 300mg to about 500 mg, about 400mg to about 800mg, or about 700mg to about 900 mg.
- the LAG-3 inhibitor is administered once every week, once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
- the LAG-3 inhibitor is administered once every 3 weeks.
- the LAG-3 inhibitor is administered once every 4 weeks.
- the LAG-3 inhibitor is administered at a dose of about 300 mg to about 500 mg (e.g., about 400 mg) once every 3 weeks.
- the PD-1 inhibitor is administered at a dose of about 700 mg to about 900 mg (e.g., about 800 mg) once every 4 weeks.
- the LAG-3 inhibitor is administered at a dose of about 400 mg to about 800 mg (e.g., about 600 mg) once every 4 weeks.
- a composition comprises a LAG-3 inhibitor, e.g., a LAG-3 inhibitor described herein, and a PD-1 inhibitor, e.g., a PD-1 inhibitor described herein.
- the combination of a LAG-3 inhibitor and a PD-1 inhibitor is administered in a therapeutically effective amount to a subject with a solid tumor, e.g., a breast cancer, e.g., a triple negative breast cancer.
- a combination comprising a LAG-3 inhibitor and a PD-1 inhibitor has increased activity compared to administration of a PD-1 inhibitor alone.
- a composition comprises a LAG-3 inhibitor, e.g., a LAG-3 inhibitor described herein, a GITR agonist, e.g., a GITR agonist described herein, and a PD-1 inhibitor, e.g., a PD- 1 inhibitor described herein.
- the combination of a LAG-3 inhibitor, a GITR agonist, and a PD-1 inhibitor is administered in a therapeutically effective amount to a subject with a solid tumor, e.g., a breast cancer, e.g., a triple negative breast cancer.
- a combination comprising a LAG-3 inhibitor, a GITR agonist, and a PD-1 inhibitor can result in increased IL-2 production.
- the anti-LAG-3 antibody molecule is BMS-986016 (Bristol-Myers Squibb), also known as BMS986016.
- BMS-986016 and other anti-LAG-3 antibodies are disclosed in WO 2015/116539 and US 9,505,839, incorporated by reference in their entirety.
- the anti- LAG-3 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of BMS-986016, e.g., as disclosed in Table 6.
- the anti-LAG-3 antibody molecule is TSR-033 (Tesaro). In one embodiment, the anti-LAG-3 antibody molecule is TSR-033 (Tesaro). In one
- the anti-LAG-3 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of TSR-033.
- the anti-LAG-3 antibody molecule is IMP731 or GSK2831781 (GSK and Prima BioMed). IMP731 and other anti-LAG-3 antibodies are disclosed in WO 2008/132601 and US 9,244,059, incorporated by reference in their entirety.
- the anti-LAG-3 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of IMP731, e.g., as disclosed in Table 6.
- the anti-LAG-3 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of GSK2831781.
- the anti-LAG-3 antibody molecule is IMP761 (Prima BioMed). In one embodiment, the anti-LAG-3 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of IMP761.
- anti-LAG-3 antibodies include those described, e.g., in WO 2008/132601, WO 2010/019570, WO 2014/140180, WO 2015/116539, WO 2015/200119, WO 2016/028672, US 9,244,059, US 9,505,839, incorporated by reference in their entirety.
- the anti-LAG-3 antibody is an antibody that competes for binding with, and/or binds to the same epitope on LAG-3 as, one of the anti-LAG-3 antibodies described herein.
- the anti-LAG-3 inhibitor is a soluble LAG-3 protein, e.g., IMP321 (Prima BioMed), e.g., as disclosed in WO 2009/044273, incorporated by reference in its entirety. Table 6. Amino acid sequences of other exemplary anti-LAG-3 antibody molecules
- a combination described herein comprises a TIM-3 inhibitor.
- TIM-3 correlates with tumor myeloid signature in The Cancer Genome Atlas (TCGA) database and the most abundant TIM-3 on normal peripheral blood mononuclear cells (PBMCs) is on myeloid cells.
- TCGA Cancer Genome Atlas
- PBMCs peripheral blood mononuclear cells
- TIM-3 is expressed on multiple myeloid subsets in human PBMCs, including, but not limited to, monocytes, macrophages and dendritic cells.
- Tumor purity estimates are negatively correlated with TIM-3 expression in a number of TCGA tumor samples (including, e.g., adrenocortical carcinoma (ACC), bladder urothelial carcinoma (BLCA), breast invasive carcinoma (BRCA), cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC), colon adenocarcinoma (COAD), glioblastoma multiforme (GBM), head and neck squamous cell carcinoma (HNSC), kidney chromophobe (KICH), kidney renal clear cell carcinoma (KIRC), kidney renal papillary cell carcinoma (KIRP), brain low grade glioma (LGG), liver hepatocellular carcinoma (LIHC), lung adenocarcinoma (LUAD), lung squamous cell carcinoma (LUSC), ovarian serous cystadenocarcinoma (OV), prostate adenocarcinoma (PRAD), rectum adenocarcinoma (READ),
- the combination is used to treat a kidney cancer (e.g., a kidney renal clear cell carcinoma (KIRC) or a kidney renal papillary cell carcinoma (KIRP)).
- a kidney cancer e.g., a kidney renal clear cell carcinoma (KIRC) or a kidney renal papillary cell carcinoma (KIRP)
- the combination is used to treat a brain tumor (e.g., a brain low grade glioma (LGG) or a glioblastoma multiforme (GBM)).
- LGG brain low grade glioma
- GBM glioblastoma multiforme
- the combination is used to treat a mesothelioma (MESO).
- the combination is used to treat a sarcoma (SARC), a lung adenocarcinoma (LUAD), a pancreatic adenocarcinoma (PAAD), or a lung squamous cell carcinoma (LUSC).
- SARC sarcoma
- LAD lung adenocarcinoma
- PAAD pancreatic adenocarcinoma
- LUSC lung squamous cell carcinoma
- cancers that can be effectively treated by a combination described herein can be identified, e.g., by determining the fraction of patients in each indication above 75 th percentile across TCGA.
- a T cell gene signature comprises expression of one or more (e.g., all) of: CD2, CD247, CD3D, CD3E, CD3G, CD8A, CD8B, CXCR6, GZMK, PYHIN1, SH2D1A, SIRPG or TRAT1.
- a Myeloid gene signature comprises expression of one or more (e.g., all) of SIGLEC1, MSR1, LILRB4, ITGAM or CD163.
- a TIM-3 gene signature comprises expression of one or more (e.g., all) of HAVCR2, ADGRG1, PIK3AP1, CCL3, CCL4, PRF1, CD8A, NKG7, or KLRK1.
- a TIM-3 inhibitor e.g., MBG453
- a PD-1 inhibitor e.g., PDR001
- MLR mixed lymphocyte reaction
- inhibition of PD-L1 and TIM-3 results in tumor reduction and survival in mouse models of cancer.
- inhibition of PD-L1 and LAG-3 results in tumor reduction and survival in mouse models of cancer.
- the combination is used to treat a cancer having high levels of expression of TIM-3 and one or more of myeloid signature genes (e.g., one or more genes expressed in
- the cancer having high levels of expression of TIM-3 and myeloid signature genes is chosen from a sarcoma (SARC), a mesothelioma (MESO), a brain tumor (e.g., a glioblastoma (GBM), or a kidney cancer (e.g., a kidney renal papillary cell carcinoma (KIRP)).
- SARC sarcoma
- MEO mesothelioma
- GBM glioblastoma
- KIRP kidney renal papillary cell carcinoma
- the combination is used to treat a cancer having high levels of expression of TIM-3 and one or more of T cell signature genes (e.g., one or more genes expressed in dendritic cells and/or T cells).
- the cancer having high levels of expression of TIM-3 and T cell signature genes is chosen from a kidney cancer (e.g., a kidney renal clear cell carcinoma (KIRC)), a lung cancer (e.g., a lung adenocarcinoma (LUAD)), a pancreatic adenocarcinoma (PAAD), or a testicular cancer (e.g., a testicular germ cell tumor (TGCT)).
- KIRC kidney renal clear cell carcinoma
- a lung cancer e.g., a lung adenocarcinoma (LUAD)
- PAAD pancreatic adenocarcinoma
- TGCT testicular germ cell tumor
- cancers that can be effectively treated by a combination targeting two, three, or more targets described herein can be identified, e.g., by determining the fraction of patients above 75 th percentile in both or all of the targets.
- the combination comprises a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein) and a PD-l inhibitor (e.g., a PD-l inhibitor described herein), e.g., to treat cancer chosen from a kidney cancer (e.g., a kidney renal papillary cell carcinoma (KIRC) or a kidney renal papillary cell carcinoma (KIRP)), a mesothelioma (MESO), a lung cancer (e.g., a lung adenocarcinoma (LUAD) or a lung squamous cell carcinoma (LUSC)), a sarcoma (SARC), a testicular cancer (e.g., a testicular germ cell tumor (TGCT)), a pancreatic cancer (e.g., a pancreatic adenocarcinoma (PAAD)), a cervical cancer (e.g., cervical squamous cell carcinoma and endocervical adenocarcino
- the combination comprises a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein) and a LAG-3 inhibitor (e.g., a LAG-3 inhibitor described herein), e.g., to treat cancer chosen from a kidney cancer (e.g., a kidney renal papillary cell carcinoma (KIRC)), a mesothelioma (MESO), a lung cancer (e.g., a lung adenocarcinoma (LUAD) or a lung squamous cell carcinoma (LUSC)), a sarcoma (SARC), a testicular cancer (e.g., a testicular germ cell tumor (TGCT)), a cervical cancer (e.g., cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC)), an ovarian cancer (OV), a head and neck cancer (e.g., a head and neck squamous cell carcinoma (HNSC)),
- the combination comprises a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein), a PD-l inhibitor (e.g., a PD-l inhibitor described herein), and a LAG-3 inhibitor (e.g., a LAG-3 inhibitor described herein), e.g., to treat a cancer chosen from a kidney cancer (e.g., a kidney renal papillary cell carcinoma (KIRC)), a lung cancer (e.g., a lung adenocarcinoma (LUAD) or a lung squamous cell carcinoma (LUSC)), a mesothelioma (MESO), a testicular cancer (e.g., a testicular germ cell tumor (TGCT)), a sarcoma (SARC), a cervical cancer (e.g., cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC)), a head and neck cancer (e.g., a TIM-3
- the combination comprises a TIM-3 inhibitor (e.g., a TIM-3 inhibitor described herein), a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), and a c-MET inhibitor (e.g., a c-MET inhibitor described herein), e.g., to treat a cancer chosen from a kidney cancer (e.g., a kidney renal papillary cell carcinoma (KIRC)), a lung cancer (e.g., a lung adenocarcinoma (LUAD), or a mesothelioma (MESO).
- a kidney cancer e.g., a kidney renal papillary cell carcinoma (KIRC)
- KIRC kidney renal papillary cell carcinoma
- a lung cancer e.g., a lung adenocarcinoma (LUAD), or a mesothelioma (MESO).
- the TIM-3 inhibitor is MBG453 (Novartis) or TSR-022 (Tesaro). In some embodiments, the TIM-3 inhibitor is MBG453.
- the TIM-3 inhibitor is an anti-TIM-3 antibody molecule. In one embodiment, the TIM-3 inhibitor is an anti-TIM-3 antibody molecule.
- the TIM-3 inhibitor is an anti-TIM-3 antibody molecule as disclosed in US 2015/0218274, published on August 6, 2015, entitled“Antibody Molecules to TIM-3 and Uses Thereof,” incorporated by reference in its entirety.
- the anti-TIM-3 antibody molecule comprises at least one, two, three, four, five or six complementarity determining regions (CDRs) (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 7 (e.g., from the heavy and light chain variable region sequences of ABTIM3-hum11 or ABTIM3-hum03 disclosed in Table 7), or encoded by a nucleotide sequence shown in Table 7.
- the CDRs are according to the Kabat definition (e.g., as set out in Table 7).
- the CDRs are according to the Chothia definition (e.g., as set out in Table 7).
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions (e.g., conservative amino acid substitutions) or deletions, relative to an amino acid sequence shown in Table 7, or encoded by a nucleotide sequence shown in Table 7.
- amino acid substitutions e.g., conservative amino acid substitutions
- deletions e.g., conservative amino acid substitutions
- the anti-TIM-3 antibody molecule comprises a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 801, a VHCDR2 amino acid sequence of SEQ ID NO: 802, and a VHCDR3 amino acid sequence of SEQ ID NO: 803; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 810, a VLCDR2 amino acid sequence of SEQ ID NO: 811, and a VLCDR3 amino acid sequence of SEQ ID NO: 812, each disclosed in Table 7.
- VH heavy chain variable region
- VL light chain variable region
- the anti-TIM-3 antibody molecule comprises a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 801, a VHCDR2 amino acid sequence of SEQ ID NO: 820, and a VHCDR3 amino acid sequence of SEQ ID NO: 803; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 810, a VLCDR2 amino acid sequence of SEQ ID NO: 811, and a VLCDR3 amino acid sequence of SEQ ID NO: 812, each disclosed in Table 7.
- VH heavy chain variable region
- VL light chain variable region
- the anti-TIM-3 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 806, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 806. In one embodiment, the anti-TIM-3 antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 816, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 816. In one embodiment, the anti-TIM-3 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 822, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 822.
- the anti-TIM-3 antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 826, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 826. In one embodiment, the anti-TIM-3 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 806 and a VL comprising the amino acid sequence of SEQ ID NO: 816. In one embodiment, the anti-TIM-3 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 822 and a VL comprising the amino acid sequence of SEQ ID NO: 826.
- the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 807, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 807. In one embodiment, the antibody molecule comprises a VL encoded by the nucleotide sequence of SEQ ID NO: 817, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 817.
- the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 823, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 823. In one embodiment, the antibody molecule comprises a VL encoded by the nucleotide sequence of SEQ ID NO: 827, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 827. In one embodiment, the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 807 and a VL encoded by the nucleotide sequence of SEQ ID NO: 817. In one embodiment, the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 823 and a VL encoded by the nucleotide sequence of SEQ ID NO: 827.
- the anti-TIM-3 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 808, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 808.
- the anti-TIM-3 antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 818, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 818.
- the anti-TIM-3 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 824, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 824.
- the anti-TIM-3 antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 828, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 828.
- the anti-TIM-3 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 808 and a light chain comprising the amino acid sequence of SEQ ID NO: 818.
- the anti-TIM-3 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 824 and a light chain comprising the amino acid sequence of SEQ ID NO: 828.
- the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 809, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 809.
- the antibody molecule comprises a light chain encoded by the nucleotide sequence of SEQ ID NO: 819, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 819.
- the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 825, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 825. In one embodiment, the antibody molecule comprises a light chain encoded by the nucleotide sequence of SEQ ID NO: 829, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 829. In one embodiment, the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 809 and a light chain encoded by the nucleotide sequence of SEQ ID NO: 819. In one embodiment, the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 825 and a light chain encoded by the nucleotide sequence of SEQ ID NO: 829.
- the antibody molecules described herein can be made by vectors, host cells, and methods described in US 2015/0218274, incorporated by reference in its entirety. Table 7. Amino acid and nucleotide sequences of exemplary anti-TIM-3 antibody molecules
- the TIM-3 inhibitor is administered at a dose of about 50 mg to about 100 mg, about 200 mg to about 250 mg, about 500 mg to about 1000 mg, or about 1000 mg to about 1500 mg. In embodiments, the TIM-3 inhibitor is administered once every 4 weeks. In other embodiments, the TIM-3 inhibitor is administered at a dose of about 50 mg to about 100 mg once every four weeks. In other embodiments, the TIM-3 inhibitor is administered at a dose of about 200 mg to about 250 mg once every four weeks. In other embodiments, the TIM-3 inhibitor is administered at a dose of about 500 mg to about 1000 mg once every four weeks. In other embodiments, the TIM-3 inhibitor is administered at a dose of about 1000 mg to about 1500 mg once every four weeks. Other Exemplary TIM-3 Inhibitors
- the anti-TIM-3 antibody molecule is TSR-022 (AnaptysBio/Tesaro). In one embodiment, the anti-TIM-3 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of TSR-022. In one embodiment, the anti-TIM-3 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of APE5137 or APE5121, e.g., as disclosed in Table 8. APE5137, APE5121, and other anti-TIM-3 antibodies are disclosed in WO 2016/161270, incorporated by reference in its entirety.
- the anti-TIM-3 antibody molecule is the antibody clone F38-2E2. In one embodiment, the anti-TIM-3 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of F38-2E2.
- anti-TIM-3 antibodies include those described, e.g., in WO 2016/111947, WO 2016/071448, WO 2016/144803, US 8,552,156, US 8,841,418, and US 9,163,087, incorporated by reference in their entirety.
- the anti-TIM-3 antibody is an antibody that competes for binding with, and/or binds to the same epitope on TIM-3 as, one of the anti-TIM-3 antibodies described herein.
- Table 8 Amino acid sequences of other exemplary anti-TIM-3 antibody molecules
- a combination described herein comprises a GITR agonist.
- the GITR agonist is chosen from GWN323 (NVS), BMS-986156, MK-4166 or MK-1248 (Merck), TRX518 (Leap Therapeutics), INCAGN1876 (Incyte/Agenus), AMG 228 (Amgen) or INBRX- 110 (Inhibrx).
- the GITR agonist is an anti-GITR antibody molecule. In one embodiment, the GITR agonist is an anti-GITR antibody molecule as described in WO 2016/057846, published on April 14, 2016, entitled“Compositions and Methods of Use for Augmented Immune Response and Cancer Therapy,” incorporated by reference in its entirety.
- the anti-GITR antibody molecule comprises at least one, two, three, four, five or six complementarity determining regions (CDRs) (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 9 (e.g., from the heavy and light chain variable region sequences of MAB7 disclosed in Table 9), or encoded by a nucleotide sequence shown in Table 9.
- CDRs are according to the Rabat definition (e.g., as set out in Table 9).
- the CDRs are according to the Chothia definition (e.g., as set out in Table 9).
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions (e.g., conservative amino acid substitutions) or deletions, relative to an amino acid sequence shown in Table 9, or encoded by a nucleotide sequence shown in Table 9.
- amino acid substitutions e.g., conservative amino acid substitutions
- deletions e.g., conservative amino acid substitutions
- the anti-GITR antibody molecule comprises a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 909, a VHCDR2 amino acid sequence of SEQ ID NO: 911, and a VHCDR3 amino acid sequence of SEQ ID NO: 913; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 914, a VLCDR2 amino acid sequence of SEQ ID NO: 916, and a VLCDR3 amino acid sequence of SEQ ID NO: 918, each disclosed in Table 9.
- VH heavy chain variable region
- VL light chain variable region
- the anti-GITR antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 901, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 901.
- the anti-GITR antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 902, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 902.
- the anti-GITR antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 901 and a VL comprising the amino acid sequence of SEQ ID NO: 902.
- the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 905, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 905. In one embodiment, the antibody molecule comprises a VL encoded by the nucleotide sequence of SEQ ID NO: 906, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 906. In one embodiment, the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 905 and a VL encoded by the nucleotide sequence of SEQ ID NO: 906.
- the anti-GITR antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 903, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 903. In one embodiment, the anti-GITR antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 904, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 904. In one embodiment, the anti-GITR antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 903 and a light chain comprising the amino acid sequence of SEQ ID NO: 904.
- the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 907, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 907. In one embodiment, the antibody molecule comprises a light chain encoded by the nucleotide sequence of SEQ ID NO: 908, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 908. In one embodiment, the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 907 and a light chain encoded by the nucleotide sequence of SEQ ID NO: 908.
- the antibody molecules described herein can be made by vectors, host cells, and methods described in WO 2016/057846, incorporated by reference in its entirety.
- Table 9 Amino acid and nucleotide sequences of exemplary anti-GITR antibody molecule
- the GITR agonist is administered at a dose of about 2 mg to about 600 mg (e.g., about 5 mg to about 500 mg). In some embodiments, the GITR agonist is administered once every week. In other embodiments, the GITR agonist is administered once every three weeks. In other embodiments, the GITR agonist is administered once every six weeks.
- the GITR agonist is administered at a dose of about 2 mg to about 10 mg (e.g., about 5 mg), about 5 mg to about 20 mg (e.g., about 10 mg), about 20 mg to about 40 mg (e.g., about 30 mg), about 50 mg to about 100 mg (e.g., about 60 mg), about 100 mg to about 200 mg (e.g., about 150 mg), about 200 mg to about 400 mg (e.g., about 300 mg), or about 400 mg to about 600 mg (e.g., about 500 mg), once every week.
- about 2 mg to about 10 mg e.g., about 5 mg
- about 5 mg to about 20 mg e.g., about 10 mg
- about 20 mg to about 40 mg e.g., about 30 mg
- about 50 mg to about 100 mg e.g., about 60 mg
- about 100 mg to about 200 mg e.g., about 150 mg
- about 200 mg to about 400 mg e.g., about 300 mg
- about 400 mg to about 600 mg
- the GITR agonist is administered at a dose of about 2 mg to about 10 mg (e.g., about 5 mg), about 5 mg to about 20 mg (e.g., about 10 mg), about 20 mg to about 40 mg (e.g., about 30 mg), about 50 mg to about 100 mg (e.g., about 60 mg), about 100 mg to about 200 mg (e.g., about 150 mg), about 200 mg to about 400 mg (e.g., about 300 mg), or about 400 mg to about 600 mg (e.g., about 500 mg), once every three weeks.
- about 2 mg to about 10 mg e.g., about 5 mg
- about 5 mg to about 20 mg e.g., about 10 mg
- about 20 mg to about 40 mg e.g., about 30 mg
- about 50 mg to about 100 mg e.g., about 60 mg
- about 100 mg to about 200 mg e.g., about 150 mg
- about 200 mg to about 400 mg e.g., about 300 mg
- the GITR agonist is administered at a dose of about 2 mg to about 10 mg (e.g., about 5 mg), about 5 mg to about 20 mg (e.g., about 10 mg), about 20 mg to about 40 mg (e.g., about 30 mg), about 50 mg to about 100 mg (e.g., about 60 mg), about 100 mg to about 200 mg (e.g., about 150 mg), about 200 mg to about 400 mg (e.g., about 300 mg), or about 400 mg to about 600 mg (e.g., about 500 mg), once every six weeks.
- about 2 mg to about 10 mg e.g., about 5 mg
- about 5 mg to about 20 mg e.g., about 10 mg
- about 20 mg to about 40 mg e.g., about 30 mg
- about 50 mg to about 100 mg e.g., about 60 mg
- about 100 mg to about 200 mg e.g., about 150 mg
- about 200 mg to about 400 mg e.g., about 300 mg
- three doses of the GITR agonist are administered over a period of three weeks followed by a nine-week pause. In some embodiments, four doses of the GITR agonist are administered over a period of twelve weeks followed by a nine-week pause. In some embodiments, four doses of the GITR agonists are administered over a period of twenty-one or twenty-four weeks followed by a nine-week pause.
- the anti-GITR antibody molecule is BMS-986156 (Bristol-Myers Squibb), also known as BMS 986156 or BMS986156.
- BMS-986156 and other anti-GITR antibodies are disclosed, e.g. , in US 9,228,016 and WO 2016/196792, incorporated by reference in their entirety.
- the anti-GITR antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of BMS-986156, e.g., as disclosed in Table 10.
- the anti-GITR antibody molecule is MK-4166 or MK-1248 (Merck).
- MK- 4166, MK-1248, and other anti-GITR antibodies are disclosed, e.g., in US 8,709,424, WO 2011/028683, WO 2015/026684, and Mahne et al. Cancer Res. 2017; 77(5): 1108-1118, incorporated by reference in their entirety.
- the anti-GITR antibody molecule comprises one or more of the CDR sequences (or collectively ah of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of MK-4166 or MK-1248.
- the anti-GITR antibody molecule is TRX518 (Leap Therapeutics).
- TRX518 and other anti-GITR antibodies are disclosed, e.g., in US 7,812,135, US 8,388,967, US 9,028,823, WO 2006/105021, and Ponte J et al. (2010) Clinical Immunology, l35:S96, incorporated by reference in their entirety.
- the anti-GITR antibody molecule comprises one or more of the CDR sequences (or collectively ah of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of TRX518.
- the anti-GITR antibody molecule is INCAGN1876 (Incyte/Agenus).
- INCAGN1876 and other anti-GITR antibodies are disclosed, e.g., in US 2015/0368349 and WO
- the anti-GITR antibody molecule comprises one or more of the CDR sequences (or collectively ah of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of INCAGN1876.
- the anti-GITR antibody molecule is AMG 228 (Amgen).
- AMG 228 and other anti-GITR antibodies are disclosed, e.g., in US 9,464,139 and WO 2015/031667, incorporated by reference in their entirety.
- the anti-GITR antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of AMG 228.
- the anti-GITR antibody molecule is INBRX-l 10 (Inhibrx).
- INBRX-l 10 and other anti-GITR antibodies are disclosed, e.g., in US 2017/0022284 and WO 2017/015623, incorporated by reference in their entirety.
- the GITR agonist comprises one or more of the CDR sequences (or collectively ah of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of INBRX-l 10.
- the GITR agonist (e.g., a fusion protein) is MEDI 1873 (Medlmmune), also known as MEDI1873.
- MEDI 1873 and other GITR agonists are disclosed, e.g., in US 2017/0073386, WO 2017/025610, and Ross et al. Cancer Res 2016; 76(14 Suppl): Abstract nr 561, incorporated by reference in their entirety.
- the GITR agonist comprises one or more of an IgG Fc domain, a functional multimerization domain, and a receptor binding domain of a glucocorticoid-induced TNF receptor ligand (GITRL) of MEDI 1873.
- GITRL glucocorticoid-induced TNF receptor ligand
- the anti-GITR antibody molecule is an anti-GITR antibody molecule disclosed in WO 2013/039954, herein incorporated by reference in its entirety. In an embodiment, the anti-GITR antibody molecule is an anti-GITR antibody molecule disclosed in US 2014/0072566, herein incorporated by reference in its entirety.
- GITR agonists include those described, e.g., in WO 2016/054638, incorporated by reference in its entirety.
- the anti-GITR antibody is an antibody that competes for binding with, and/or binds to the same epitope on GITR as, one of the anti-GITR antibodies described herein.
- the GITR agonist is a peptide that activates the GITR signaling pathway.
- the GITR agonist is an immunoadhesin binding fragment (e.g., an immunoadhesin binding fragment comprising an extracellular or GITR binding portion of GITRL) fused to a constant region (e.g., an Fc region of an immunoglobulin sequence).
- Table 10 Amino acid sequence of other exemplary anti-GITR antibody molecules
- a combination described herein comprises an estrogen receptor (ER) antagonist.
- the estrogen receptor antagonist is used in combination with a PD-1 inhibitor, a CDK4/6 inhibitor, or both.
- the combination is used to treat an ER positive (ER+) cancer or a breast cancer (e.g., an ER+ breast cancer).
- the estrogen receptor antagonist is a selective estrogen receptor degrader (SERD).
- SESDs are estrogen receptor antagonists which bind to the receptor and result in e.g., degradation or down-regulation of the receptor (Boer K. et al., (2017) Therapeutic Advances in Medical Oncology 9(7): 465-479).
- ER is a hormone-activated transcription factor important for e.g., the growth, development and physiology of the human reproductive system. ER is activated by, e.g., the hormone estrogen (17beta estradiol).
- ER expression and signaling is implicated in cancers (e.g., breast cancer), e.g., ER positive (ER+) breast cancer.
- the SERD is chosen from LSZ102, fulvestrant, brilanestrant, or elacestrant.
- the SERD comprises a compound disclosed in International Application Publication No. WO 2014/130310, which is hereby incorporated by reference in its entirety.
- the SERD comprises a compound of formula I:
- n is selected from 0, 1 and 2;
- n 0, 1 and 2;
- X is selected from O and NR 6 ; wherein R 6 is C 1-4 alkyl;
- Y 1 is selected from N and CR 7 ; wherein R 7 is selected from hydrogen and C 1-4 alkyl;
- R 1 is hydrogen
- R 2 is selected from hydrogen and halo
- R 3 is selected from—CH 2 CH 2 R 8b and—CR 8a ⁇ CR 8a R 8b ; wherein each R 8a is independently selected from hydrogen, fluoro and C 1-4 alkyl; and R 8b is selected from—C(O)OR 9a ,—C(O)NR 9a R 9b ,— C(O)NHOR9a,—C(O)X2R9a and a 5-6 member heteroaryl selected from:
- R9a and R9b are independently selected from hydrogen, C 1-4 alkyl, hydroxy-substituted-C 1-4 alkyl and halo-substituted-C 1-4 alkyl; wherein said heteroaryl of R 8b is unsubstituted or substituted with a group selected from C 1-4 alkyl and C 3-8 cycloalkyl;
- R 4 is selected from hydrogen, C 1-4 alkyl, halo and C 1-3 alkoxy;
- R 5 is selected from C 6-10 aryl and a 5-6 member heteroaryl selected from:
- R 5 wherein the dotted line indicates the point of attachment with the benzothiophene core; wherein said C 6-10 aryl or heteroaryl of R 5 is substituted with 1 to 3 R 5a groups independently selected from hydroxy, amino, C 1-4 alkyl, halo, nitro, cyano, halo-substituted-C 1-4 alkyl, cyano-substituted-C 1-4 alkyl, hydroxy-substituted-C 1-4 alkyl, halo-substituted-C 1-4 alkoxy, C 1-4 alkoxy,—SF 5 ,—NR 11a R 11b ,—
- the SERD comprises LSZ102.
- LSZ102 has the chemical name: (E)-3-(4- ((2-(2-(1,1-difluoroethyl)-4-fluorophenyl)-6-hydroxybenzo[b]thiophen-3-yl)oxy)phenyl)acrylic acid.
- the SERD comprises fulvestrant (CAS Registry Number: 129453-61-8), or a compound disclosed in International Application Publication No. WO 2001/051056, which is hereby incorporated by reference in its entirety.
- Fulvestrant is also known as ICI 182780, ZM 182780, FASLODEX®, or (7 ⁇ ,17 ⁇ )-7- ⁇ 9- [(4,4,5,5,5-pentafluoropentyl)sulfinyl]nonyl ⁇ estra-1,3,5(10)-triene-3,17-diol. Fulvestrant is a high affinity estrogen receptor antagonist with an IC50 of 0.29 nM. In some embodiments, fulvestrant is administered at a dose of about 250 mg to about 500 mg. In some embodiments, fulvestrant is administered at a dose of about 500 mg via intramuscular injection every 14 days for three
- administrations e.g., a dose of about 500 mg is administered on days 1, 15 and 29.
- a dose of about 500 mg is administered on days 1, 15 and 29.
- a dose of about 500 mg of fulvestrant is administered once a month, e.g., once every 28-31 days.
- the SERD comprises elacestrant (CAS Registry Number: 722533-56-4), or a compound disclosed in U.S. Patent No.7,612,114, which is incorporated by reference in its entirety.
- Elacestrant is also known as RAD1901, ER-306323 or (6R)-6- ⁇ 2-[Ethyl( ⁇ 4-[2- (ethylamino)ethyl]phenyl ⁇ methyl)amino]-4-methoxyphenyl ⁇ -5,6,7,8-tetrahydronaphthalen-2-ol.
- Elacestrant is an orally bioavailable, non-steroidal combined selective estrogens receptor modulator (SERM) and a SERD. Elacestrant is also disclosed, e.g., in Garner F et al., (2015) Anticancer Drugs 26(9):948-56.
- SERM selective estrogens receptor modulator
- the SERD is brilanestrant (CAS Registry Number: 1365888-06-7), or a compound disclosed in International Application Publication No. WO 2015/136017, which is incorporated by reference in its entirety.
- Brilanestrant is also known as GDC-0810, ARN810, RG-6046, RO-7056118 or (2E)-3- ⁇ 4-[(1E)- 2-(2-chloro-4-fluorophenyl)-1-(1H-indazol-5-yl)but-1-en-1-yl]phenyl ⁇ prop-2-enoic acid.
- Brilanestrant is a next-generation, orally bioavailable selective SERD with an IC50 of 0.7 nM. Brilanestrant is also disclosed, e.g., in Lai A. et al. (2015) Journal of Medicinal Chemistry 58 (12): 4888–4904.
- the SERD is chosen from RU 58668, GW7604, AZD9496, apeledoxifene, pipendoxifene, arzoxifene, OP-1074, or acolbifene, e.g., as disclosed in McDonell et al. (2015) Journal of Medicinal Chemistry 58(12) 4883-4887.
- a combination described herein comprises an inhibitor of Cyclin- Dependent Kinases 4 or 6 (CDK4/6).
- CDK4/6 inhibitor is used in combination with a PD-1 inhibitor, an estrogen receptor (ER) antagonist, or both.
- the combination is used to treat an ER positive (ER+) cancer or a breast cancer (e.g., an ER+ breast cancer).
- the CDK4/6 inhibitor is chosen from ribociclib, abemaciclib (Eli Lilly), or palbociclib.
- the CDK4/6 inhibitor comprises ribociclib (CAS Registry Number:
- the CDK4/6 inhibitor comprises a compound disclosed in International Application Publication No. WO 2010/020675 and U.S. Patent Nos.8,415,355 and 8,685,980, which are incorporated by reference in their entirety.
- the CDK4/6 inhibitor comprises a compound of formula I:
- X is CR 9 ;
- R 1 is CONR 5 R 6 , and R 5 and R 6 are C 1-8 alkyl;
- R 2 is C 3-14 cycloalkyl
- L is a bond, C 1-8 alkylene, C(O), or C(O)NH, and wherein L may be substituted or unsubstituted;
- Y is H, R 11 , NR 12 R 13 , OH, or Y is part of the following group
- Y is CR 9 or N
- R 8 is C 1-8 alkyl, oxo, halogen, or two or more R 8 may form a bridged alkyl group;
- W is CR 9 , or N
- R 3 is H, C 1-8 alkyl, C 1-8 alkylR 14 , C 3-14 cycloalkyl, C(O)C 1-8 alkyl, C 1-8 haloalkyl, C 1-8 alkylOH, C(O)NR 14 R 15 , C 1-8 cyanoalkyl, C(O)R 14 , C 0-8 alkylC(O)C 0-8 alkylNR 14 R 15 , C 0-8 alkylC(O)OR 14 , NR 14 R 15 , SO2C 1-8 alkyl, C 1-8 alkylC 3-14 cycloalkyl, C(O)C 1-8 alkylC 3-14 cycloalkyl, C 1-8 alkoxy, or OH which may be substituted or unsubstituted when R 3 is not H;
- R 9 is H or halogen
- R 11 , R 12 , R 13 , R 14 , and R 15 are each independently selected from H, C 1-8 alkyl, C 3-14 cycloalkyl, a 3- 14 membered cycloheteroalkyl group, a C6-14 aryl group, a 5-14 membered heteroaryl group, alkoxy, C(O)H, C(NH)OH, C(NH)OCH3, C(O)C1-3alkyl, C 1-8 alkylNH2, and C 1-6 alkylOH, and wherein R 11 , R 12 , and R 13 , R 14 , and R 15 when not H may be substituted or unsubstituted;
- n and n are independently 0-2;
- L, R 3 , R 11 , R 12 , and R 13 , R 14 , and R 15 may be substituted with one or more of C 1-8 alkyl, C2-8alkenyl, C2-8alkynyl, C 3-14 cycloalkyl, 5-14 membered heteroaryl group, C6-14aryl group, a 3-14 membered cycloheteroalkyl group, OH, (O), CN, alkoxy, halogen, or NH 2 .
- the CDK4/6 inhibitor comprises a compound chosen from:
- the CDK4/6 inhibitor comprises ribociclib (CAS Registry Number:
- Ribociclib is also known as LEE011, KISQALI®, or 7-cyclopentyl-N,N-dimethyl-2-((5- (piperazin-1-yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide.
- the CDK4/6 inhibitor comprises a compound 7-Cyclopentyl-2-(5- piperazin-1-yl-pyridin-2-ylamino)-7H-pyrrolo[2,3-d]pyrimidine-6-carboxylic acid dimethylamide of the formula
- the CDK4/6 inhibitor e.g., ribociclib
- the CDK4/6 inhibitor is administered once daily at a dose of about 200 to about 600 mg, e.g., per day.
- the CDK4/6 inhibitor e.g., ribociclib
- the CDK4/6 inhibitor is administered once daily at a dose of about 200 mg, about 300 mg, about 400 mg, about 500 mg, or about 600 mg, or about 200 mg to about 300 mg, about 300 mg to about 400 mg, about 400 mg to about 500 mg, or about 500 mg to about 600 mg.
- the CDK4/6 inhibitor (e.g., ribociclib) is administered once daily at a dose of 600 mg per day for e.g., three weeks, e.g., 21 days. In some embodiments, this treatment is followed by one week of no treatment.
- the CDK4/6 inhibitor (e.g., ribociclib) is administered in repeated dosing cycles of 3 weeks on and 1 week off, e.g., the compound is administered daily for 3 weeks, e.g., 21 days, followed by no administration for 1 week (e.g., 7 days), after which the cycle is repeated, e.g., the compound is administered daily for 3 weeks followed by no administration for 1 week.
- the CDK4/6 inhibitor (e.g., ribociclib) is administered orally.
- the CDK4/6 inhibitor comprises abemaciclib (CAS Registry Number: 1231929-97-7).
- Abemaciclib is also known as LY835219 or N-[5-[(4-Ethyl-1-piperazinyl)methyl]-2- pyridinyl]-5-fluoro-4-[4-fluoro-2-methyl-1-(1-methylethyl)-1H-benzimidazol-6-yl]-2-pyrimidinamine.
- Abemaciclib is a CDK inhibitor selective for CDK4 and CDK6 and is disclosed, e.g., in Torres-Guzman R et al. (2017) Oncotarget 10.18632/oncotarget.17778.
- the CDK4/6 inhibitor comprises palbociclib (CAS Registry Number: 571190-30-2).
- Palbociclib is also known as PD-0332991, IBRANCE® or 6-Acetyl-8-cyclopentyl-5- methyl-2- ⁇ [5-(1-piperazinyl)-2-pyridinyl]amino ⁇ pyrido[2,3-d]pyrimidin-7(8H)-one.
- Palbociclib inhibits CDK4 with an IC50 of 11nM, and inhibits CDK6 with an IC50 of 16nM, and is disclosed, e.g., in Finn et al. (2009) Breast Cancer Research 11(5):R77.
- the CDK4/6 inhibitor (e.g., palbociclib) is administered at a dose of about 125 mg per day for e.g., three weeks. In some embodiments, this treatment is followed by one week of no treatment. In some embodiments, the CDK4/6 inhibitor (e.g., palbociclib) is administered in repeated dosing cycles of 3 weeks on and 1 week off, e.g., the compound is administered daily for 3 weeks followed by no administration for 1 week, after which the cycle is repeated, e.g., the compound is administered daily for 3 weeks followed by no administration for 1 week.
- CXCR2 Inhibitors e.g., palbociclib
- a combination described herein comprises an inhibitor of chemokine (C- X-C motif) receptor 2 (CXCR2).
- CXCR2 inhibitor is used in combination with a PD-1 inhibitor, and one or more (e.g., two, three, or all) of a CSF-1/1R binding agent, a TIM-3 inhibitor, a c-MET inhibitor, or an A2aR antagonist.
- the combination is used to treat a pancreatic cancer or a colorectal cancer.
- the CXCR2 inhibitor is chosen from 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide, danirixin, reparixin, or navarixin.
- Exemplary CXCR2 inhibitors are chosen from 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide, danirixin, reparixin, or navarixin.
- the CXCR2 inhibitor comprises a compound disclosed in U.S. Patent Nos. 7989497, 8288588, 8329754, 8722925, 9115087, U.S. Application Publication Nos. US 2010/0152205, US 2011/0251205 and US 2011/0251206, and International Application Publication Nos. WO
- the CXCR2 inhibitor comprises 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2- hydroxy-N-methoxy-N-methylbenzenesulfonamide or a choline salt thereof.
- the CXCR2 inhibitor comprises 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2- hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt.
- the CXCR2 inhibitor is 2-Hydroxy-N,N,N-trimethylethan-1-aminium 3-chloro-6-( ⁇ 3,4-dioxo-2-[(pentan-3- yl)amino]cyclobut-1-en-1-yl ⁇ amino)-2-(N-methoxy-N-methylsulfamoyl)phenolate (i.e., 6-chloro-3-((3,4- dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide choline salt) and has the following chemical structure: .
- the CXCR2 inhibitor is administered at a dose of about 50-1000 mg (e.g., about 50-400 mg, 50-300 mg, 50-200 mg, 50-100 mg, 150-900 mg, 150-600 mg, 200-800 mg, 300-600 mg, 400-500 mg, 300-500 mg, 200-500 mg, 100-500 mg, 100-400 mg, 200-300 mg, 100-200 mg, 250- 350 mg, or about 75 mg, 150 mg, 300 mg, 450 mg, or 600mg).
- the CXCR2 inhibitor is administered daily, e.g., once daily or twice daily.
- the CXCR2 inhibitor is administered for two weeks (e.g., 14 days) in a 4 week cycle (e.g., 28 day cycle). In some embodiments, the CXCR2 inhibitor is administered for the first two weeks (e.g., 14 days) in a 4 week cycle (e.g., 28 day cycle). In some embodiments, the CXCR2 inhibitor is administered for 2 weeks in a 4 week cycle, e.g., 2 weeks of treatment with the CXCR2 inhibitor and 2 weeks of no treatment in a 4 week cycle. In some embodiments, the CXCR2 inhibitor is administered daily, e.g., twice daily, for the first two weeks (e.g., 14 days) in a 4 week cycle (e.g., 28 day cycle).
- the CXCR2 inhibitor is administered daily, e.g., twice daily, for two weeks (e.g., 14 days) in a 4 week cycle (e.g., 28 day cycle). In some embodiments, the CXCR2 inhibitor is administered daily, e.g., twice daily, for 2 weeks in a 4 week cycle, e.g., 2 weeks of treatment with the CXCR2 inhibitor and 2 weeks of no treatment in a 4 week cycle.
- the CXCR2 inhibitor is administered daily, e.g., once daily or twice daily at a total dose of about 50-1000 mg (e.g., about 50-400 mg, 50-300 mg, 50-200 mg, 50-100 mg, 150-900 mg, 150-600 mg, 200-800 mg, 300-600 mg, 400-500 mg, 300-500 mg, 200-500 mg, 100-500 mg, 100-400 mg, 200-300 mg, 100-200 mg, 250-350 mg, or about 75 mg, 150 mg, 300 mg, 450 mg, or 600mg).
- the CXCR2 is administered once daily. In other embodiments, the CXCR2 inhibitor is administered twice daily.
- the CXCR2 inhibitor is administered twice daily and each dose, e.g., the first and second dose, comprises about 25-400 mg (e.g., 25-100 mg, 50-200 mg, 75-150, or 100-400 mg) of the CXCR2 inhibitor. In some embodiments, the CXCR2 inhibitor is administered once daily and the dose comprises about 50-600 mg (e.g., 50-150 mg, 100-400 mg, 200-300, or 300-500 mg) of the CXCR2 inhibitor. In some embodiments, the CXCR2 inhibitor is administered orally.
- the CXCR2 inhibitor is administered orally twice daily at a dose of 75 mg for two weeks (e.g., 14 days) in a 4 week cycle (e.g., 28 day cycle). In some embodiments, the CXCR2 inhibitor is administered orally twice daily at a does of 150 mg for two weeks (e.g., 14 days) in a 4 week cycle (e.g., 28 day cycle).
- the CXCR2 inhibitor is administered twice daily, e.g., about 12 hours apart. In some embodiments, the CXCR2 inhibitor is administered on an empty stomach at least e.g., 0.5, 1, 1.5, or 2 hours before a meal. In some embodiments, the CXCR2 inhibitor is administered at the same time daily. In some embodiments, if a subject misses a dose of the CXCR2 inhibitor, the subject will be administered the missed dose of the CXCR2 inhibitor within, e.g., 1, 2, 3 or 4 hours of the missed dose.
- the dose provides >60% inhibition of whole blood neutrophil shape change (e.g., over 24 h) in humans, e.g., a dose of 100 mg once daily or 50 mg twice daily. In other embodiments, the dose provides >80% inhibition of whole blood neutrophil shape change (e.g., over 24 h) in humans, e.g., a dose of 150 mg twice daily. In other embodiments, the dose provides >90% inhibition of whole blood neutrophil shape change (e.g., over 24 h) in humans, e.g., a dose of 500 mg once daily. Methods for determing whole blood neutrophil shape change are described, e.g., in Bryan et al.
- CXCR2 inhibitor e.g., 6-chloro-3-((3,4- dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide choline salt
- a CXCR2 inhibitor e.g., 6-chloro-3-((3,4- dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide choline salt
- myeloid cell infiltration e.g., neutrophils and myeloid derived suppressor cells (MDSC)
- myeloid cell infiltration e.g., neutrophils and myeloid derived suppressor cells (MDSC)
- MDSC myeloid derived suppressor cells
- inhibiton of myeloid cell migration into tumors in combination with PD-1 blockade, e.g., by PDR001, can enhance the activity of cyotoxic T cells.
- the immunosuppressive effects of a CXCR2 inhibitor e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3- ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt, on neutrophils or MDSCs can enhance anti-tumor activity induced by a PD-1 inhibitor, e.g., PDR001.
- a PD-1 inhibitor e.g., PDR001.
- the CXCR2 inhibitor e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3- ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt
- a PD-1 inhibitor e.g., PDR001
- the CXCR2 inhibitor is administered immediately after completion of the PDR001 infusion during a clinic visit.
- the CXCR2 inhibitor (e.g., 6-chloro-3- ((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide choline salt) is administered prior to administration of a PD-1 inhibitor, e.g., PDR001.
- a PD-1 inhibitor e.g., PDR001
- the CXCR2 inhibitor is administered immediately before administration of a PD- 1 inhibitor, e.g., PDR001.
- the CXCR2 inhibitor is administered about 1-14 days (e.g., 7 or 14 days) before administration of a PD-1 inhibitor, e.g., PDR001.
- the CXCR2 inhibitor e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1- yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt
- a dose of 25-300 mg e.g., 25-100 mg, 50-200 mg, 75-150 mg, 50 mg, 75 mg, 100 mg, or 150 mg
- two weeks e.g., 14 days
- a 4-week cycle e.g., 28 day cycle
- one week e.g., 7 days
- 3-week or 21-day cycle i.e., 1 week on/ 2 weeks off.
- the CXCR2 inhibitor e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2- hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt
- the CXCR2 inhibitor is administered orally twice daily at a dose of 75 mg 2 weeks on/2 weeks off or 1 week on/2 weeks off.
- the CXCR2 inhibitor e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N- methoxy-N-methylbenzenesulfonamide choline salt
- the CXCR2 inhibitor is administered orally twice daily at a dose of 150 mg 2 weeks on/2 weeks off or 1 week on/2 weeks off.
- neutrophils can promote aspects of tumorigenesis including neo angiogenesis and can also inhibit an effective immune anti-tumor response (see e.g., Raccosta L. et al., (2013) J. Exp. Med. p.1711-1728).
- the CXCR2 inhibitor e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1- yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt
- binds to the CXCR2 receptor expressed on neutrophils and other myeloid cells e.g., inhibits neutrophil shape change, promotes T cell infiltration of tumor and enhances response to PD-1 inhibitors (Steele C. et al., (2016) Cancer Cell 29:6 p.832-845).
- the CXCR2 inhibitor e.g., 6-chloro-3-((3,4-dioxo- 2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt
- the CXCR2 inhibitor reduces neutrophil counts in, e.g., blood and sputum.
- the CXCR2 inhibitor e.g., 6-chloro-3-((3,4-dioxo-2-(pentan-3- ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N-methylbenzenesulfonamide choline salt
- the CXCR2 inhibitor inhibits both GRO ⁇ and IL-8-stimulated [ 35 S]GTPgS binding in membranes prepared from CHO cells expressing the human CXCR2 receptor.
- the CXCR2 inhibitor e.g., 6-chloro-3- ((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide choline salt
- the CXCR2 inhibitor e.g., 6-chloro-3- ((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide choline salt
- the CXCR2 inhibitor e.g., 6-chloro- 3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide choline salt
- CXCR2 inhibitor e.g., 6-chloro- 3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2-hydroxy-N-methoxy-N- methylbenzenesulfonamide choline salt
- the CXCR2 inhibitor comprises danirixin (CAS Registry Number:
- Danirixin is also known as GSK1325756 or 1-(4-chloro-2-hydroxy-3-piperidin-3- ylsulfonylphenyl)-3-(3-fluoro-2-methylphenyl)urea. Danirixin is disclosed, e.g., in Miller et al. Eur J Drug Metab Pharmacokinet (2014) 39:173–181; and Miller et al. BMC Pharmacology and Toxicology (2015), 16:18.
- the CXCR2 inhibitor comprises reparixin (CAS Registry Number:
- Reparixin is also known as repertaxin or (2R)-2-[4-(2-methylpropyl)phenyl]-N- methylsulfonylpropanamide.
- Reparixin is a non-competitive allosteric inhibitor of CXCR1/2. Reparixin is disclosed, e.g., in Zarbock et al. Br J Pharmacol.2008; 155(3):357-64.
- the CXCR2 inhibitor comprises navarixin.
- Navarixin is also known as MK-7123, SCH 527123, PS291822, or 2-hydroxy-N,N-dimethyl-3-[[2-[[(1R)-1-(5-methylfuran-2- yl)propyl]amino]-3,4-dioxocyclobuten-1-yl]amino]benzamide.
- Navarixin is disclosed, e.g., in Ning et al. Mol Cancer Ther.2012; 11(6):1353-64.
- a combination described herein comprises a CSF-1/1R binding agent.
- the CSF-1/1R binding agent is used in combination with a PD-1 inhibitor, and one or more (e.g., two, three, four, or all) of CXCR2 inhibitor, a TIM-3 inhibitor, a c-MET inhibitor, an A2aR antagonist, or an IDO inhibitor.
- the combination is used to treat a pancreatic cancer, colorectal cancer, a gastric cancer, or a melanoma (e.g., a refractory melanoma).
- the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[d]thiazol-6- yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK) (e.g., M-CSF), e.g., a monoclonal antibody or Fab to M-CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[
- the CSF-1/1R inhibitor is BLZ945.
- the CSF-1/1R binding agent is MCS110.
- the CSF-1/1R binding agent is pexidartinib.
- the CSF-1/1R binding agent comprises an inhibitor of macrophage colony-stimulating factor (M-CSF). M-CSF is also sometimes known as CSF-1.
- the CSF-1/1R binding agent is an antibody to CSF-1 (e.g., MCS110).
- the CSF- 1/1R binding agent is an inhibitor of CSF-1R (e.g., BLZ945).
- the CSF-1/1R binding agent comprises a monoclonal antibody or Fab to M-CSF (e.g., MCS110/H-RX1), or a binding agent to CSF-1 disclosed in International Application Publication Nos. WO 2004/045532 and WO 2005/068503, including H-RX1 or 5H4 (e.g., an antibody molecule or Fab fragment against M-CSF) and US9079956, which applications and patent are incorporated by reference in their entirety.
- MCS110/H-RX1 monoclonal antibody or Fab to M-CSF
- H-RX1 or 5H4 e.g., an antibody molecule or Fab fragment against M-CSF
- the CSF-1/1R binding agent e.g., an M-CSF inhibitor, a monoclonal antibody or Fab to M-CSF (e.g., MCS110), or a compound disclosed in PCT Publication No. WO 2004/045532 and WO 2005/068503 and US9079956 (e.g., an antibody molecule or Fab fragment against M-CSF), is administered at an average dose of about 10mg/kg.
- Table 19 Amino acid and nucleotide sequences of an exemplary anti-M-CSF antibody molecule (MCS110)
- the CSF-1/1R binding agent comprises a CSF-1R tyrosine kinase inhibitor, 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide (BLZ945), or a compound disclosed in International Application Publication No. WO 2007/121484, and U.S. Patent Nos.7,553,854, 8,173,689, and 8,710,048, which are incorporated by reference in their entirety.
- the CSF-1/1R binding agent comprises a compound, stereoisomer, tautomer, solvate, oxide, ester, or prodrug of Formula (I) or a pharmaceutically acceptable salt thereof
- X is O, S, or S(O);
- R 1 and R 2 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, acyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heterocyclyl, substituted heterocyclyl, heteroaryl, and substituted heteroaryl; or R and R are taken together to form a group selected from heterocyclyl, substituted heterocyclyl, heteroaryl, or substituted heteroaryl;
- R 3 is selected from the group consisting of hydrogen, halo, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, carbonitrile, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclyl, substituted heterocyclyl, amino, substituted amino, acyl, acylamino, alkoxy, substituted alkoxy, carboxyl, carboxyl ester, substituted sulfonyl, aminosulfonyl, and aminocarbonyl; each R 6 is independently alkyl, substituted alkyl, alkoxy, substituted alkoxy, amino, substituted amino, or halo; n is 0, 1, or 2; and when X is O, R 4 is hydrogen, substituted alkyl, alkenyl, substituted alkenyl, alky
- R 4 and R 5 are taken together to form a group selected from heterocyclyl, substituted heterocyclyl, cycloalkyl, substituted cycloalkyl, aryl, substituted aryl, heteroaryl, and substituted heteroaryl; and when X is S or S(O), R 4 is hydrogen, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, or substituted alkynyl, and R 5 is hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aminocarbonyl, halo, heteroaryl, substituted heteroaryl, cycloalkyl, or substituted cycloalkyl.
- the CSF-1/1R binding agent comprises a compound of the formula:
- the CSF-1/1R binding agent (e.g., BLZ945) is administered at a dose between 50 mg and 1500 mg, e.g., between 75 mg and 1000 mg, between 100 mg and 900 mg, between 200 mg and 800 mg, between 300 mg and 700 mg, between 400 mg and 600 mg, between 100 mg and 700 mg, between 100 mg and 500 mg, between 100 mg and 300 mg, between 700 mg and 900 mg, between 500 mg and 900 mg, between 300 mg and 900 mg, between 75 mg and 150 mg, between 100 mg and 200 mg, between 200 mg and 400 mg, between 500 mg and 700 mg, or between 800 mg and 1000 mg, e.g., at a dose of 50 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, 400 mg, 450 mg, 500 mg, 550 mg, 600 mg, 650 mg, 700 mg, 750 mg, 800 mg, 850 mg, 900 mg, 950 mg, or 1000 mg.
- a dose between 50 mg and 1500 mg, e.g., between 75
- the CSF-1/1R binding agent e.g., BLZ945
- the CSF-1/1R binding agent e.g., BLZ945
- the CSF-1/1R binding agent (e.g., BLZ945) is administered at a dose of between 50 mg and 150 mg, e.g., about 100 mg, e.g., daily, e.g., according to a 7 days on/7days off schedule. In other embodiments, the CSF-1/1R binding agent (e.g., BLZ945) is administered at a dose of between 100 mg and 200 mg, e.g., about 150 mg, e.g., daily, e.g., according to a 7 days on/7days off schedule.
- the CSF-1/1R binding agent (e.g., BLZ945) is administered at a dose of between 200 mg and 400 mg, e.g., about 300 mg, e.g., daily, e.g., according to a 7 days on/7days off schedule. In other embodiments, the CSF-1/1R binding agent (e.g., BLZ945) is administered at a dose of between 500 mg and 700 mg, e.g., about 600 mg, e.g., daily, e.g., according to a 7 days on/7days off schedule.
- the CSF-1/1R binding agent e.g., BLZ945
- the CSF-1/1R binding agent is administered at a dose of between 800 mg and 1000 mg, e.g., about 900 mg, e.g., daily, e.g., according to a 7 days on/7days off schedule.
- the CSF-1/1R binding agent (e.g., BLZ945) is administered at a dose of between 50 mg and 150 mg, e.g., about 100 mg, once a week. In other embodiments, the CSF-1/1R binding agent (e.g., BLZ945) is administered at a dose of between 100 mg and 200 mg, e.g., about 150 mg, once a week. In other embodiments, the CSF-1/1R binding agent (e.g., BLZ945) is administered at a dose of between 200 mg and 400 mg, e.g., about 300 mg, once a week.
- the CSF- 1/1R binding agent e.g., BLZ945
- the CSF-1/1R binding agent is administered at a dose of between 800 mg and 1000 mg, e.g., about 900 mg, once a week.
- the CSF-1/1R binding agent e.g., BLZ945
- the CSF-1/1R binding agent is administered orally.
- the CSF-1/1R binding agent (e.g., BLZ945) is administered in combination with a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule).
- a PD-1 inhibitor e.g., an anti-PD-1 antibody molecule.
- the CSF- 1/1R binding agent (e.g., BLZ945) is administered at a dose between 50 mg and 150 mg (e.g., about 100 mg), e.g., daily (e.g., according to a 7 days on/7days off schedule) or once a week, e.g., orally
- the PD-1 inhibitor e.g., the anti-PD-1 antibody molecule
- the PD-1 inhibitor is administered at a dose between 300 mg and 500 mg (e.g., at a dose of 400 mg), e.g., once every 4 weeks, or at a dose between 200 mg and 400 mg (e.g., at a dose of 300 mg), e.g., once every 3 weeks,
- the CSF-1/1R binding agent e.g., BLZ945
- a dose between 100 mg and 200 mg e.g., about 150 mg
- daily e.g., according to a 7 days on/7days off schedule
- the PD-1 inhibitor e.g., the anti-PD-1 antibody molecule
- the PD-1 inhibitor is administered at a dose between 300 mg and 500 mg (e.g., at a dose of 400 mg), e.g., once every 4 weeks, or at a dose between 200 mg and 400 mg (e.g., at a dose of 300 mg), e.g., once every 3 weeks, e.g., by intravenous infusion.
- the CSF-1/1R binding agent e.g., BLZ945
- a dose between 200 mg and 400 mg e.g., about 300 mg
- daily e.g., according to a 7 days on/7days off schedule
- the PD-1 inhibitor e.g., the anti-PD-1 antibody molecule
- the PD-1 inhibitor is administered at a dose between 300 mg and 500 mg (e.g., at a dose of 400 mg), e.g., once every 4 weeks, or at a dose between 200 mg and 400 mg (e.g., at a dose of 300 mg), e.g., once every 3 weeks, e.g., by intravenous infusion.
- the CSF-1/1R binding agent e.g., BLZ945
- the CSF-1/1R binding agent is administered at a dose between 500 mg and 700 mg (e.g., about 600 mg), e.g., daily (e.g., according to a 7 days on/7days off schedule) or once a week, e.g., orally
- the PD-1 inhibitor e.g., the anti-PD-1 antibody molecule
- the PD-1 inhibitor is administered at a dose between 300 mg and 500 mg (e.g., at a dose of 400 mg), e.g., once every 4 weeks, or at a dose between 200 mg and 400 mg (e.g., at a dose of 300 mg), e.g., once every 3 weeks, e.g., by intravenous infusion.
- the CSF-1/1R binding agent e.g., BLZ945
- a dose between 800 mg and 1000 mg e.g., about 900 mg
- daily e.g., according to a 7 days on/7days off schedule
- a week e.g., orally
- the PD-1 inhibitor e.g., the anti-PD-1 antibody molecule
- the PD-1 inhibitor is administered at a dose between 300 mg and 500 mg (e.g., at a dose of 400 mg), e.g., once every 4 weeks, or at a dose between 200 mg and 400 mg (e.g., at a dose of 300 mg), e.g., once every 3 weeks, e.g., by intravenous infusion.
- the CSF-1/1R binding agent (e.g., MCS110) is administered at a dose of between 1-20 mg/kg, e.g., about 2-4 mg/kg, 4-6 mg/kg or 6-10 mg/kg, e.g., about 3 mg/kg, 5 mg/kg or 7.5 mg/kg. In some embodiments, the CSF-1/1R binding agent (e.g., MCS110) is administered at a dose of about 5mg/kg. In other embodiments, the CSF-1/1R binding agent (e.g., MCS110) is administered twice a week, once a week, once every two weeks, once every three weeks, or once every four weeks.
- the CSF-1/1R binding agent (e.g., MCS110) is administered at a dose of between 1- 20mg/kg, e.g., about 2-4 mg/kg, 4-6 mg/kg or 6-10 mg/kg, e.g., about 3 mg/kg, 5 mg/kg or 7.5 mg/kg twice a week, once a week, once every two weeks, once every three weeks, or once every four weeks.
- the CSF-1/1R binding agent e.g., MCS110
- the CSF-1/1R binding agent e.g., MCS110
- MCS110 is administered
- intravenously e.g., by intravenous infusion.
- the CSF-1/1R binding agent (e.g., MCS110) is administered in combination with a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule).
- a PD-1 inhibitor e.g., an anti-PD-1 antibody molecule.
- the CSF- 1/1R binding agent (e.g., MCS110) is administered at a dose of between 1-20 mg/kg, e.g., about 2-4 mg/kg, 4-6 mg/kg or 6-10 mg/kg, e.g., about 3 mg/kg, 5 mg/kg or 7.5 mg/kg (e.g., about 4-6 mg/kg, e.g., 5 mg/kg) once every four weeks, e.g., intravenously, e.g., by intravenous infusion, and the PD-1 inhibitor (e.g., the anti-PD-1 antibody molecule) is administered at a dose between 300 mg and 500 mg (e.g., at a dose of 400 mg), e.g.,
- the CSF-1/1R binding agent e.g., MCS110
- a PD-1 inhibitor e.g., an anti-PD-1 antibody molecule
- a LAG-3 inhibitor e.g., an anti-LAG3 antibody molecule
- the CSF-1/1R binding agent (e.g., MCS110) is administered at a dose of between 1-20 mg/kg, e.g., about 2-4 mg/kg, 4-6 mg/kg or 6-10 mg/kg, e.g., about 3 mg/kg, 5 mg/kg or 7.5 mg/kg (e.g., about 4-6 mg/kg, e.g., 5 mg/kg) once every four weeks, e.g., intravenously, e.g., by intravenous infusion, the PD-1 inhibitor (e.g., the anti-PD-1 antibody molecule) is administered at a dose between 300 mg and 500 mg (e.g., at a dose of 400 mg), e.g., once every 4 weeks, or at a dose between 200 mg and 400 mg (e.g., at a dose of 300 mg), e.g., once every 3 weeks, e.g., by intravenous infusion, and the LAG-3 inhibitor (e.g., the antimony gallate
- the combination comprising a CSF-1/1R binding agent e.g., a CSF-1-1R binding agent described herein, is administered in a therapeutically effective amount to a subject with a solid tumor, e.g., a breast cancer (e.g., a triple negative breast cancer (TNBC)), a pancreatic cancer, a gastroesophageal cancer or a CRC (e.g., a MSS CRC).
- a solid tumor e.g., a breast cancer (e.g., a triple negative breast cancer (TNBC)), a pancreatic cancer, a gastroesophageal cancer or a CRC (e.g., a MSS CRC).
- TNBC triple negative breast cancer
- CRC e.g., a MSS CRC
- the tumor associated macrophages can contribute to an immunosuppressive microenvironment (e.g., as described in Wiliams et al., (2016) Breast Cancer).
- the combination comprising a CSF-1/1R binding agent, e.g., BLZ945 or MCS110 has an improved efficacy compared to either agent alone in a CRC mouse model.
- TNBCs have a low T cell:myeloid cell ratio which presents as a poor prognostic factor, e.g., worse prognosis.
- bone marrow cells express more CSF-1R which can contribute to a pro-tumorigenic environment in TNBC.
- the combination comprising a CSF-1/1R binding agent, e.g., a CSF-1-1R binding agent described herein, and a PD-1 inhibitor, e.g., PDR001 is administered in a therapeutically effective amount to a subject with a solid tumor, e.g., a breast cancer (e.g., a triple negative breast cancer (TNBC).
- a combination comprising a CSF-1/1R binding agent, e.g., a CSF-1-1R binding agent described herein, and a PD-1 inhibitor, e.g., PDR001 can result in, e.g., anti-tumor activity and/or tumor regression.
- the combination comprising a CSF-1/1R binding agent, e.g., a CSF-1-1R binding agent described herein, and a PD-1 inhibitor, e.g., PDR001 has improved activity compared to administration of, e.g., a PD-1 inhibitor alone.
- a pancreatic cancer or a gastric cancer has high CD68 expression and high or mid CSF-1R expression.
- a combination comprising a CSF-1/1R binding agent e.g., BLZ945 or MCS110, is administered in a therapeutically effective amount to a subject with a pancreatic cancer or a gastric cancer with high CD68 expression and high or mid CSF-1R expression.
- a CSF-1/1R binding agent e.g., BLZ945 or MCS110
- the CSF-1/1R binding agent comprises pexidartinib (CAS Registry Number 1029044-16-3).
- Pexidrtinib is also known as PLX3397 or 5-((5-chloro-1H-pyrrolo[2,3- b]pyridin-3-yl)methyl)-N-((6-(trifluoromethyl)pyridin-3-yl)methyl)pyridin-2-amine.
- Pexidartinib is a small-molecule receptor tyrosine kinase (RTK) inhibitor of KIT, CSF1R and FLT3.
- RTK receptor tyrosine kinase
- FLT3, CSF1R and FLT3 are overexpressed or mutated in many cancer cell types and play major roles in tumor cell proliferation and metastasis.
- PLX3397 can bind to and inhibit phosphorylation of stem cell factor receptor (KIT), colony-stimulating factor-1 receptor (CSF1R) and FMS-like tyrosine kinase 3 (FLT3), which may result in the inhibition of tumor cell proliferation and down-modulation of macrophages, osteoclasts and mast cells involved in the osteolytic metastatic disease.
- KIT stem cell factor receptor
- CSF1R colony-stimulating factor-1 receptor
- FLT3 FMS-like tyrosine kinase 3
- the CSF-1/1R binding agent is emactuzumab.
- Emactuzumab is also known as RG7155 or RO5509554.
- Emactuzumab is a humanized IgG1 mAb targeting CSF1R.
- the CSF-1/1R binding agent is FPA008.
- FPA008 is a humanized mAb that inhibits CSF1R.
- a combination described herein comprises a c-MET inhibitor.
- c-MET a receptor tyrosine kinase overexpressed or mutated in many tumor cell types, plays key roles in tumor cell proliferation, survival, invasion, metastasis, and tumor angiogenesis. Inhibition of c-MET may induce cell death in tumor cells overexpressing c-MET protein or expressing constitutively activated c-MET protein.
- the c-MET inhibitor is used in combination with a PD-1 inhibitor, and one or more (e.g., two, three, four, five, six, or all) of CXCR2 inhibitor, a CSF-1/1R binding agent, a LAG-3 inhibitor, a GITR agonist, a TGF- ⁇ inhibitor, an A2aR antagonist, or an IDO inhibitor.
- the combination is used to treat a pancreatic cancer, a colorectal cancer, a gastric cancer, or a melanoma (e.g., a refractory melanoma).
- the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
- capmatinib IRC280
- JNJ-3887605 JNJ-3887605
- AMG 337 LY2801653
- MSC2156119J crizotinib
- tivantinib tivantinib
- golvatinib golvatinib.
- the c-MET inhibitor comprises capmatinib (INC280), or a compound described in U.S. Patent Nos.7,767,675, and US 8,461,330, which are incorporated by reference in their entirety.
- the c-MET inhibitor comprises a compound of Formula I:
- A is N;
- Cy 1 is aryl, heteroaryl, cycloalkyl, or heterocycloalkyl, each optionally substituted by 1, 2, 3, 4, or 5-W-X-Y-Z groups;
- Cy 2 is aryl, heteroaryl, cycloalkyl, or heterocycloalkyl, each optionally substituted by 1, 2, 3, 4, or 5-W′-X′-Y′-Z′ groups;
- L 1 is CH 2 , CH 2 CH 2 , cycloalkylene, (CR 4 R 5 ) p O(CR 4 R 5 ) q or (CR 4 R 5 ) p S(CR 4 R 5 ) q wherein said cycloalkylene is optionally substituted with 1, 2, or 3 substituents independently selected from Cy 3 , halo, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 haloalkyl, halosulfanyl, CN, NO 2 , N 3 , OR a , SR a , C(O)R b , C(O)NR c R d , C(O)OR a , OC(O)R b , OC(O)NR c R d , NR c R d , NR c C(O)R b , NR c C(O)NR c R d , NR c C(O)
- L 2 is (CR 7 R 8 ) r , (CR 7 R 8 ) s -(cycloalkylene)-(CR 7 R 8 ) t , (CR 7 R 8 ) s -(arylene)-(CR 7 R 8 ) t , (CR 7 R 8 ) s - (heterocycloalkylene)-(CR 7 R 8 ) t , (CR 7 R 8 ) s -(heteroarylene)-(CR 7 R 8 ) t , (CR 7 R 8 ) s O(CR 7 R 8 ) t ,
- R 1 is H or -W′′-X′′-Y′′-Z′′
- R 2 is H, halo, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 haloalkyl, CN, NO 2 , OR A , SR A , C(O)R B , C(O)NR C R D , C(O)OR A , OC(O)R B , OC(O)NR C R D , NR C R D , NR C C(O)R B , NR C C(O)NR C R D ,
- R 2 and -L 2 -Cy 2 are linked together to form a group of formula:
- ring B is a fused aryl or fused heteroaryl ring, each optionally substituted with 1, 2, or 3- W′-X′-Y′-Z′ groups;
- R 4 and R 5 are independently selected from H, halo, OH, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1- 6 alkoxy, alkoxyalkyl, cyanoalkyl, heterocycloalkyl, cycloalkyl, C 1-6 haloalkyl, CN, and NO 2 ;
- R 4 and R 5 together with the C atom to which they are attached form a 3, 4, 5, 6, or 7-membered cycloalkyl or heterocycloalkyl ring, each optionally substituted by 1, 2, or 3 substituents independently selected from halo, OH, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 alkoxy, alkoxyalkyl, cyanoalkyl, heterocycloalkyl, cycloalkyl, C 1-6 haloalkyl, CN, and NO 2 ;
- R 7 and R 8 are independently selected from H, halo, OH, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1- 6 alkoxy, C 1-6 haloalkyl, CN, and NO2;
- R 7 and R 8 together with the C atom to which they are attached form a 3, 4, 5, 6, or 7-membered cycloalkyl or heterocycloalkyl ring, each optionally substituted by 1, 2, or 3 substituent independently selected from halo, OH, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 alkoxy, C 1-6 haloalkyl, CN, and NO2;
- R 9 is H, C 1-6 alkyl, C 2-6 alkenyl, or C 2-6 alkynyl;
- W, W′, and W′′ are independently absent or independently selected from C 1-6 alkylene, C2- 6 alkenylene, C 2-6 alkynylene, O, S, NR h , CO, COO, CONR h , SO, SO2, SONR h and NR h CONR i , wherein each of the C 1-6 alkylene, C 2-6 alkenylene, and C 2-6 alkynylene is optionally substituted by 1, 2 or 3 substituents independently selected from halo, C 1-6 alkyl, C 1-6 haloalkyl, OH, C 1-6 alkoxy, C 1-6 haloalkoxy, amino, C 1-6 alkylamino, and C2-8dialkylamino;
- X, X′, and X′′ are independently absent or independently selected from C 1-6 alkylene, C2- 6 alkenylene, C 2-6 alkynylene, arylene, cycloalkylene, heteroarylene, and heterocycloalkylene, wherein each of the C 1-6 alkylene, C 2-6 alkenylene, C 2-6 alkynylene, arylene, cyclo alkylene, heteroarylene, and heterocycloalkylene is optionally substituted by 1, 2 or 3 substituents independently selected from halo, CN, NO 2 , OH, C 1-6 alkyl, C 1-6 haloalkyl, C 2-8 alkoxyalkyl, C 1-6 alkoxy, C 1-6 haloalkoxy, C 2-8 alkoxyalkoxy, cycloalkyl, heterocycloalkyl, C(O)OR j , C(O)NR h R i , amino, C 1-6 alkylamino, and C 2-8 dialkylamin
- Y, Y′, and Y′′ are independently absent or independently selected from C 1-6 alkylene, C 2- 6 alkenylene, C 2-6 alkynylene, O, S, NR h , CO, COO, CONR h , SO, SO 2 , SONR h , and NR h CONR i , wherein each of the C 1-6 alkylene, C 2-6 alkenylene, and C 2-6 alkynylene is optionally substituted by 1, 2 or 3 substituents independently selected from halo, C 1-6 alkyl, C 1-6 haloalkyl, OH, C 1-6 alkoxy, C 1-6 haloalkoxy, amino, C 1-6 alkylamino, and C 2-8 dialkylamino;
- Z, Z′, and Z′′ are independently selected from H, halo, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C1- 6 haloalkyl, halosulfanyl, CN, NO2, N3, OR a2 , SR a2 , C(O)R b2 , C(O)NR c2 R d2 , C(O)OR a2 , OC(O)R b2 , OC(O)NR c2 R d2 , NR c2 R d2 , NR c2 C(O)R b2 , NR c2 C(O)NR c2 R d2 , NR c2 C(O)OR d2 , NR c2 C(O)OR a2 , C( ⁇ NR g )NR c2 R d2 ,
- two adjacent -W′-X′-Y′-Z′ groups together with the atoms to which they are attached, optionally form a fused 4-20 membered cycloalkyl ring or a fused 4-20 membered heterocycloalkyl ring, each optionally substituted by 1, 2, or 3 substituents independently selected from halo, C 1-6 alkyl, C 2- 6 alkenyl, C 2-6 alkynyl, C 1-6 haloalkyl, halosulfanyl, CN, NO 2 , OR a3 , SR a3 , C(O)R b3 , C(O)NR c3 R d3 , C(O)OR a3 , OC(O)R b3 , OC(O)NR c3 R d3 , NR c3 R d3 , NR c3 C(O)R b3 , NR c3 C(O)NR c3 R d3 ,
- Cy 3 and Cy 4 are independently selected from aryl, cycloalkyl, heteroaryl, and heterocycloalkyl, each optionally substituted by 1, 2, 3, 4, or 5 substituents independently selected from halo, C 1-6 alkyl, C 2- 6 alkenyl, C 2-6 alkynyl, C 1-6 haloalkyl, halosulfanyl, CN, NO 2 , N 3 , OR a4 , SR a4 , C(O)R b4 , C(O)NR c4 R d4 , C(O)OR a4 , OC(O)R b4 , OC(O)NR c4 R d4 , NR c4 R d4 , NR c4 C(O)R b4 , NR c4 C(O)NR c4 R d4 , NR c4 C(O)OR d4 , NR c4 C(O)OR a4 ,
- R A is H, C 1-4 alkyl, C 2-4 alkenyl, C 2-4 alkynyl, cycloalkyl, heterocycloalkyl, aryl, or heteroaryl wherein said C 1-4 alkyl, C 2-4 alkenyl, C 2-4 alkynyl, cycloalkyl, heterocycloalkyl, aryl or heteroaryl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, and C 1-4 alkyl;
- R B is H, C 1-4 alkyl, C 2-4 alkenyl, C 2-4 alkynyl, cycloalkyl, heterocycloalkyl, aryl, or heteroaryl wherein said C 1-4 alkyl, C 2-4 alkenyl, or C 2-4 alkynyl, cycloalkyl, heterocycloalkyl, aryl, or heteroaryl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, and C 1-4 alkyl;
- R C and R D are independently selected from H, C 1-4 alkyl, C 2-4 alkenyl, or C 2-4 alkynyl, wherein said C 1-4 alkyl, C 2-4 alkenyl, or C 2-4 alkynyl, is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, and C 1-4 alkyl;
- R C and R D together with the N atom to which they are attached form a 4-, 5-, 6- or 7-membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, and C 1-4 alkyl;
- R a , R a1 , R a2 , R a3 , and R a4 are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, and heterocycloalkylalkyl, wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C1- 6 alkyl,
- R b , R b1 , R b2 , R b3 , and R b4 are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, and heterocycloalkylalkyl, wherein said C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1- 6 alkyl, C
- R c and R d are independently selected from H, C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or
- heterocycloalkylalkyl wherein said C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1- 6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R c and R d together with the N atom to which they are attached form a 4-, 5-, 6- or 7-membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C1- 6 haloalkoxy;
- R c1 and R d1 are independently selected from H, C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or
- heterocycloalkylalkyl wherein said C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C1- 6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R c1 and R d1 together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R c2 and R d2 are independently selected from H, C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl,
- heterocycloalkylalkyl arylcycloalkyl, arylheterocycloalkyl, arylheteroaryl, biaryl, heteroarylcycloalkyl, heteroarylheterocycloalkyl, heteroarylaryl, and biheteroaryl, wherein said C 1-10 alkyl, C 1-6 haloalkyl, C2- 6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, heterocycloalkylalkyl, arylcycloalkyl, arylheterocycloalkyl, arylheteroaryl, biaryl, heteroarylcycloalkyl, heteroarylheterocycloalkyl, heteroarylaryl, and biheteroaryl are each optionally substituted with 1, 2, or 3 substituents independently selected from
- R c2 and R d2 together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, C 1- 6 haloalkoxy, hydroxyalkyl, cyanoalkyl, aryl, heteroaryl, C(O)OR a4 , C(O)R b4 , S(O) 2 R b3 , alkoxyalkyl, and alkoxyalkoxy;
- R c3 and R d3 are independently selected from H, C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or
- heterocycloalkylalkyl wherein said C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1- 6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R c3 and R d3 together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R c4 and R d4 are independently selected from H, C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or
- heterocycloalkylalkyl wherein said C 1-10 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl or heterocycloalkylalkyl is optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C1- 6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R c4 and R d4 together with the N atom to which they are attached form a 4-, 5-, 6- or 7- membered heterocycloalkyl group or heteroaryl group, each optionally substituted with 1, 2, or 3 substituents independently selected from OH, CN, amino, halo, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkyl, and C 1-6 haloalkoxy;
- R e , R e1 , R e2 , and R e4 are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, (C1- 6 alkoxy)-C 1-6 alkyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, cycloalkylalkyl, heteroarylalkyl, and heterocycloalkylalkyl;
- R f , R f1 , R f2 , and R f4 are independently selected from H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C2- 6 alkynyl, aryl, cycloalkyl, heteroaryl, and heterocycloalkyl;
- R g is H, CN, and NO2;
- R h and R i are independently selected from H and C 1-6 alkyl
- R j is H, C 1-6 alkyl, C 1-6 haloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, aryl, cycloalkyl, heteroaryl, heterocycloalkyl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, or heterocycloalkylalkyl;
- p 0, 1, 2, 3, or 4;
- q 0, 1, 2, 3, or 4;
- r is 0, 1, 2, 3, 4, 5, or 6;
- s 0, 1, 2, 3, or 4;
- t 0, 1, 2, 3, or 4.
- the c-MET inhibitor comprises a compound chosen from: 2-(4- Fluorophenyl)-7-(4-methoxybenzyl)imidazo[1,2-b][1,2,4]triazine; 2-(4-Fluorophenyl)-7-[1-(4- methoxyphenyl)-cyclopropyl]-imidazo[1,2-b]-[1,2,4]triazine; 6-(1-(2-(4-Fluorophenyl)imidazo[1,2- b][1,2,4]triazin-7-yl)cyclopropyl)quinoline; 2-Fluoro-N-methyl-4-[7-(quinolin-6-ylmethyl)imidazo[1,2- b][1,2,4]triazin-2-yl]benzamide; 2-(4-Bromo-3-fluorophenyl)-7-[(4-methoxyphenyl)thio]-imidazo[1,2- b]
- the c-MET inhibitor comprises 2-fluoro-N-methyl-4-[7-(quinolin-6- ylmethyl)imidazo[1,2-b][1,2,4]triazin-2-yl]benzamide dihydrochloric acid salt, or a hydrate or solvate thereof.
- the c-MET inhibitor comprises a compound of formula:
- the combination comprises a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), a c-MET inhibitor (e.g., a c-MET inhibitor described herein) and one or more of a MEK inhibitor (e.g., a MEK inhibitor described herein), an IL-1b inhibitor (e.g., a IL-1b inhibitor described herein) or an A2aR antagonist (e.g., an A2aR antagonist described herein).
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a c-MET inhibitor e.g., a c-MET inhibitor described herein
- MEK inhibitor e.g., a MEK inhibitor described herein
- an IL-1b inhibitor e.g., a IL-1b inhibitor described herein
- an A2aR antagonist e.g., an A2aR antagonist described herein
- a combination comprising a PD-1 inhibitor (e.g., a PD-1 inhibitor described herein), and a c-MET inhibitor (e.g., a c-MET inhibitor described herein), results in improved tumor control in an MC38 mouse model, compared to either agent alone.
- a PD-1 inhibitor e.g., a PD-1 inhibitor described herein
- a c-MET inhibitor e.g., a c-MET inhibitor described herein
- the c-MET inhibitor (e.g., capmatinib (INC280)) is administered twice a day at a dose of about 100-2000mg, about 200-2000mg, about 200-1000mg, or about 200-800 mg, e.g., about 400mg, about 500mg, or about 600mg.
- the c-MET inhibitor e.g., capmatinib (INC280)
- the c-MET inhibitor is administered twice a day at a dose of about 400mg.
- the c-MET inhibitor (e.g., capmatinib (INC280)) is administered twice a day at a dose of about 600mg.
- the c-MET inhibitor (e.g., capmatinib (INC280) is administered twice a day at a dose of about 200mg, e.g., 200mg per dose.
- the c-MET inhibitor e.g., capmatinib (INC280)
- a PD-1 inhibitor e.g., an anti-PD-1 antibody molecule
- a LAG-3 inhibitor e.g., an anti-LAG3 antibody molecule
- the c-MET inhibitor e.g., capmatinib (INC280)
- the PD-1 inhibitor e.g., the anti-PD-1 antibody molecule
- the PD-1 inhibitor is administered at a dose between 300 mg and 500 mg (e.g., at a dose of 400 mg), e.g., once every 4 weeks, or at a dose between 200 mg and 400 mg (e.g., at a dose of 300 mg), e.g., once every 3 weeks, e.g., by intravenous infusion
- the LAG-3 inhibitor e.g., the anti-LAG-3 antibody molecule
- the LAG-3 inhibitor is administered at a dose of about 400 mg to about 800 mg (e.g., about 600 mg) once every 4 weeks.
- the combination comprises a PD-1 inhibitor, e.g., PDR001, a LAG-3 inhibitor, e.g., LAG525, and a c-MET inhibitor (e.g., a c-MET inhibitor described herein).
- this combination is administered to a subject in a therapeutically effective amount to treat, e.g., a TNBC.
- a combination comprising a PD- 1 inhibitor, e.g., PDR001, a LAG-3 inhibitor, e.g., LAG525, and a c-MET inhibitor (e.g., a c-MET inhibitor described herein) is supported by the role of c-MET in tumorigenesis.
- a PD- 1 inhibitor e.g., PDR001
- a LAG-3 inhibitor e.g., LAG525
- a c-MET inhibitor e.g., a c-MET inhibitor described herein
- the combination comprises a PD-1 inhibitor, e.g., PDR001, a LAG-3 inhibitor, e.g., LAG525, and a c-MET inhibitor (e.g., a c-MET inhibitor described herein).
- LAG525 is administered, e.g., infused, e.g., prior to administration of PDR001.
- PDR001 is administered, e.g., infused, after administration of LAG525.
- both PDR001 and LAG525 are administered, e.g., infused at the same site.
- the c-MET inhibitor administered is on the same day as the adminsitration, e.g., infusion, of LAG525 and PDR001. In some embodiments, when the c-MET inhibitor is administered on the same day as the administration of LAG525 and PDR001, the c-MET inhibitor is administered prior to the administration, e.g., infusion of LAG525 and PDR001.
- the c-MET inhibitor comprises JNJ-38877605.
- JNJ-38877605 is an orally available, small molecule inhibitor of c-Met. JNJ-38877605 selectively binds to c-MET, thereby inhibiting c-MET phosphorylation and disrupting c-Met signal transduction pathways.
- the c-Met inhibitor is AMG 208.
- AMG 208 is a selective small-molecule inhibitor of c-MET. AMG 208 inhibits the ligand-dependent and ligand-independent activation of c-MET, inhibiting its tyrosine kinase activity, which may result in cell growth inhibition in tumors that overexpress c-Met.
- the c-Met inhibitor comprises AMG 337.
- AMG 337 is an orally bioavailable inhibitor of c-Met.
- AMG 337 selectively binds to c-MET, thereby disrupting c-MET signal transduction pathways.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Endocrinology (AREA)
- Oncology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Cell Biology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Neurology (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP18826126.7A EP3710053A1 (en) | 2017-11-16 | 2018-11-16 | Combination therapies |
| MX2020004756A MX2020004756A (es) | 2017-11-16 | 2018-11-16 | Terapias de combinacion. |
| JP2020527114A JP2021503478A (ja) | 2017-11-16 | 2018-11-16 | 組み合わせ治療 |
| CA3081602A CA3081602A1 (en) | 2017-11-16 | 2018-11-16 | Combination therapies |
| AU2018368731A AU2018368731A1 (en) | 2017-11-16 | 2018-11-16 | Combination therapies |
| RU2020119578A RU2020119578A (ru) | 2017-11-16 | 2018-11-16 | Комбинированные терапии |
| US16/764,102 US20200277378A1 (en) | 2017-11-16 | 2018-11-16 | Combination therapies |
| KR1020207016803A KR20200089286A (ko) | 2017-11-16 | 2018-11-16 | 조합 요법 |
| CN201880086491.2A CN111655288A (zh) | 2017-11-16 | 2018-11-16 | 组合疗法 |
| BR112020008888-9A BR112020008888A2 (pt) | 2017-11-16 | 2018-11-16 | terapias de combinação |
| IL274407A IL274407A (en) | 2017-11-16 | 2020-05-03 | Combined treatments |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762587370P | 2017-11-16 | 2017-11-16 | |
| US62/587,370 | 2017-11-16 | ||
| US201862645588P | 2018-03-20 | 2018-03-20 | |
| US62/645,588 | 2018-03-20 | ||
| US201862703736P | 2018-07-26 | 2018-07-26 | |
| US62/703,736 | 2018-07-26 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019099838A1 true WO2019099838A1 (en) | 2019-05-23 |
Family
ID=64870550
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/061534 Ceased WO2019099838A1 (en) | 2017-11-16 | 2018-11-16 | Combination therapies |
Country Status (14)
| Country | Link |
|---|---|
| US (1) | US20200277378A1 (https=) |
| EP (1) | EP3710053A1 (https=) |
| JP (1) | JP2021503478A (https=) |
| KR (1) | KR20200089286A (https=) |
| CN (1) | CN111655288A (https=) |
| AU (1) | AU2018368731A1 (https=) |
| BR (1) | BR112020008888A2 (https=) |
| CA (1) | CA3081602A1 (https=) |
| CL (2) | CL2020001255A1 (https=) |
| IL (1) | IL274407A (https=) |
| MX (1) | MX2020004756A (https=) |
| RU (1) | RU2020119578A (https=) |
| TW (1) | TW201922291A (https=) |
| WO (1) | WO2019099838A1 (https=) |
Cited By (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10472419B2 (en) | 2014-01-31 | 2019-11-12 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US10570204B2 (en) | 2013-09-26 | 2020-02-25 | The Medical College Of Wisconsin, Inc. | Methods for treating hematologic cancers |
| US10752687B2 (en) | 2014-01-24 | 2020-08-25 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| WO2020239558A1 (en) * | 2019-05-24 | 2020-12-03 | Pfizer Inc. | Combination therapies using cdk inhibitors |
| WO2021003194A1 (en) * | 2019-07-02 | 2021-01-07 | Effector Therapeutics, Inc. | Eif4e inhibitors for use as immune checkpoint modulators and related methods |
| WO2021214623A1 (en) * | 2020-04-21 | 2021-10-28 | Novartis Ag | Dosing regimen for treating a disease modulated by csf-1r |
| US20210393779A1 (en) * | 2020-06-18 | 2021-12-23 | Regeneron Pharmaceuticals, Inc. | Activin a antibody formulations and methods of use thereof |
| US11344620B2 (en) | 2014-09-13 | 2022-05-31 | Novartis Ag | Combination therapies |
| WO2022147092A1 (en) * | 2020-12-29 | 2022-07-07 | Incyte Corporation | Combination therapy comprising a2a/a2b inhibitors, pd-1/pd-l1 inhibitors, and anti-cd73 antibodies |
| US11591392B2 (en) | 2016-07-14 | 2023-02-28 | Bristol-Myers Squibb Company | Antibodies against TIM3 and uses thereof |
| US11673894B2 (en) | 2018-02-27 | 2023-06-13 | Incyte Corporation | Imidazopyrimidines and triazolopyrimidines as A2A / A2B inhibitors |
| WO2023164638A1 (en) * | 2022-02-25 | 2023-08-31 | Bristol-Myers Squibb Company | Combination therapy for colorectal carcinoma |
| US11873304B2 (en) | 2018-05-18 | 2024-01-16 | Incyte Corporation | Fused pyrimidine derivatives as A2A/A2B inhibitors |
| US11878015B2 (en) | 2017-02-14 | 2024-01-23 | Effector Therapeutics Inc. | Piperidine-substituted Mnk inhibitors and methods related thereto |
| US11884665B2 (en) | 2019-01-29 | 2024-01-30 | Incyte Corporation | Pyrazolopyridines and triazolopyridines as A2A / A2B inhibitors |
| US11952375B2 (en) | 2018-10-24 | 2024-04-09 | Effector Therapeutics Inc. | Crystalline forms of Mnk inhibitors |
| US11999740B2 (en) | 2018-07-05 | 2024-06-04 | Incyte Corporation | Fused pyrazine derivatives as A2A / A2B inhibitors |
| US12129297B2 (en) | 2018-01-12 | 2024-10-29 | Bristol-Myers Squibb Company | Antibodies against TIM3 and uses thereof |
| RU2835316C1 (ru) * | 2020-04-21 | 2025-02-24 | Новартис Аг | Режим введения доз для лечения заболевания, модулируемого csf-1r |
| US12252535B2 (en) | 2014-03-14 | 2025-03-18 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| EP4378460A4 (en) * | 2021-07-28 | 2025-08-06 | Tiumbio Co Ltd | PHARMACEUTICAL COMPOSITION FOR THE PREVENTION OR TREATMENT OF A TUMOR AND CORRESPONDING USE |
| WO2025235276A1 (en) * | 2024-05-06 | 2025-11-13 | Icahn School Of Medicine At Mount Sinai | Combination of il-1 receptor inhibitors, anti pd-1, and il-4 inhibitors in the treatment of cancer |
| US12565528B2 (en) | 2020-10-23 | 2026-03-03 | Bristol-Myers Squibb Company | LAG-3 antagonist therapy for lung cancer |
| US12600777B2 (en) | 2015-07-29 | 2026-04-14 | Novartis Ag | Combination therapies comprising antibody molecules to LAG-3 |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MA44075A (fr) | 2015-12-17 | 2021-05-19 | Incyte Corp | Dérivés de n-phényl-pyridine-2-carboxamide et leur utilisation en tant que modulateurs des interactions protéine/protéine pd-1/pd-l1 |
| AU2016379372A1 (en) * | 2015-12-22 | 2018-08-02 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| US20180179202A1 (en) | 2016-12-22 | 2018-06-28 | Incyte Corporation | Heterocyclic compounds as immunomodulators |
| EP4107279A4 (en) * | 2020-02-18 | 2024-07-17 | Endocyte, Inc. | METHOD FOR TREATING CANCERS EXPRESSING PSMA |
| US20240254230A1 (en) * | 2021-03-19 | 2024-08-01 | Shanghai Junshi Biosciences Co., Ltd. | Method of treating urothelial carcinoma |
| CN116407526B (zh) * | 2022-03-11 | 2024-07-05 | 复旦大学附属肿瘤医院 | 乳腺癌治疗药物、辅助治疗药物、抗肿瘤免疫激活剂及氧化三甲胺和其前体产物胆碱的用途 |
| WO2024073010A1 (en) * | 2022-09-28 | 2024-04-04 | University Of Cincinnati | Inhibition of natural killer cell cytoxocity |
| US20240101718A1 (en) * | 2022-09-28 | 2024-03-28 | Incyte Corporation | Anti-pd-1/lag-3 bispecific antibodies and uses thereof |
| CN118662490A (zh) * | 2023-03-15 | 2024-09-20 | 山东第一医科大学附属肿瘤医院(山东省肿瘤防治研究院、山东省肿瘤医院) | 瑞帕利辛单药或联合抗pd-1抗体用于治疗疾病的方法 |
| WO2025107242A1 (zh) | 2023-11-23 | 2025-05-30 | 成都福实生物科技有限公司 | 机械力响应型巨噬细胞亚群在胰腺癌诊断或预后评估中的应用 |
Citations (240)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2779780A (en) | 1955-03-01 | 1957-01-29 | Du Pont | 1, 4-diamino-2, 3-dicyano-1, 4-bis (substituted mercapto) butadienes and their preparation |
| US4433059A (en) | 1981-09-08 | 1984-02-21 | Ortho Diagnostic Systems Inc. | Double antibody conjugate |
| US4444878A (en) | 1981-12-21 | 1984-04-24 | Boston Biomedical Research Institute, Inc. | Bispecific antibody determinants |
| EP0125023A1 (en) | 1983-04-08 | 1984-11-14 | Genentech, Inc. | Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor |
| EP0171496A2 (en) | 1984-08-15 | 1986-02-19 | Research Development Corporation of Japan | Process for the production of a chimera monoclonal antibody |
| EP0173494A2 (en) | 1984-08-27 | 1986-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by DNA splicing and expression |
| WO1986001533A1 (en) | 1984-09-03 | 1986-03-13 | Celltech Limited | Production of chimeric antibodies |
| EP0184187A2 (en) | 1984-12-04 | 1986-06-11 | Teijin Limited | Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it |
| GB2188638A (en) | 1986-03-27 | 1987-10-07 | Gregory Paul Winter | Chimeric antibodies |
| EP0346087A2 (en) | 1988-06-09 | 1989-12-13 | Snow Brand Milk Products Co., Ltd. | Hybrid antibody and process for the production thereof |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| EP0388151A1 (en) | 1989-03-13 | 1990-09-19 | Celltech Limited | Modified antibodies |
| WO1991000906A1 (en) | 1989-07-12 | 1991-01-24 | Genetics Institute, Inc. | Chimeric and transgenic animals capable of producing human antibodies |
| WO1991003493A1 (en) | 1989-08-29 | 1991-03-21 | The University Of Southampton | Bi-or trispecific (fab)3 or (fab)4 conjugates |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1992003917A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International | Homologous recombination in mammalian cells |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| WO1992015679A1 (en) | 1991-03-01 | 1992-09-17 | Protein Engineering Corporation | Improved epitode displaying phage |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1993001288A1 (de) | 1991-07-08 | 1993-01-21 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Phagemid zum screenen von antikörpern |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1993023537A1 (en) | 1992-05-08 | 1993-11-25 | Creative Biomolecules | Chimeric multivalent protein analogues and methods of use thereof |
| US5273743A (en) | 1990-03-09 | 1993-12-28 | Hybritech Incorporated | Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| WO1994009131A1 (en) | 1992-10-15 | 1994-04-28 | Scotgen Limited | Recombinant specific binding protein |
| WO1994012625A2 (en) | 1992-11-23 | 1994-06-09 | Zeneca Limited | LIGAND BINDING VARIABLE DOMAIN (V-MIN) COMPRISING A FRAMEWORK REGION WITH A CYCLICALLY PERMUTED CENTRAL β-BARREL |
| WO1995009917A1 (en) | 1993-10-07 | 1995-04-13 | The Regents Of The University Of California | Genetically engineered bispecific tetravalent antibodies |
| US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
| US5534254A (en) | 1992-02-06 | 1996-07-09 | Chiron Corporation | Biosynthetic binding proteins for immuno-targeting |
| WO1996037621A2 (en) | 1995-05-23 | 1996-11-28 | Morphosys Gesellschaft Für Proteinoptimierung Mbh | Multimeric proteins |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5591828A (en) | 1989-06-22 | 1997-01-07 | Behringwerke Aktiengesellschaft | Bispecific and oligospecific mono-and oligovalent receptors, the preparation and use thereof |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5635602A (en) | 1993-08-13 | 1997-06-03 | The Regents Of The University Of California | Design and synthesis of bispecific DNA-antibody conjugates |
| US5637481A (en) | 1993-02-01 | 1997-06-10 | Bristol-Myers Squibb Company | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5837242A (en) | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5837821A (en) | 1992-11-04 | 1998-11-17 | City Of Hope | Antibody construct |
| US5844094A (en) | 1992-09-25 | 1998-12-01 | Commonwealth Scientific And Industrial Research Organization | Target binding polypeptide |
| US5864019A (en) | 1990-06-11 | 1999-01-26 | Celltech Limited | Multivalent antigen-binding proteins |
| US5869620A (en) | 1986-09-02 | 1999-02-09 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US5910573A (en) | 1992-01-23 | 1999-06-08 | Merck Patent Gesellschaft Mit Beschrankter Haftung | Monomeric and dimeric antibody-fragment fusion proteins |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| US5959083A (en) | 1991-06-03 | 1999-09-28 | Behringwerke Aktiengellschaft | Tetravalent bispecific receptors, the preparation and use thereof |
| US5989830A (en) | 1995-10-16 | 1999-11-23 | Unilever Patent Holdings Bv | Bifunctional or bivalent antibody fragment analogue |
| WO1999064460A1 (en) | 1998-06-10 | 1999-12-16 | Celltech Therapeutics Limited | Divalent antibody fragments |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| WO2000006605A2 (en) | 1998-07-28 | 2000-02-10 | Micromet Ag | Heterominibodies |
| WO2000035436A2 (en) | 1998-12-16 | 2000-06-22 | Warner-Lambert Company | Treatment of arthritis with mek inhibitors |
| US6239259B1 (en) | 1996-04-04 | 2001-05-29 | Unilever Patent Holdings B.V. | Multivalent and multispecific antigen-binding protein |
| WO2001051056A1 (en) | 2000-01-10 | 2001-07-19 | Astrazeneca Ab | Fulvestrant formulation |
| US6294353B1 (en) | 1994-10-20 | 2001-09-25 | Morphosys Ag | Targeted hetero-association of recombinant proteins to multi-functional complexes |
| US6333396B1 (en) | 1998-10-20 | 2001-12-25 | Enzon, Inc. | Method for targeted delivery of nucleic acids |
| US20020004587A1 (en) | 2000-04-11 | 2002-01-10 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| WO2002006213A2 (en) | 2000-07-19 | 2002-01-24 | Warner-Lambert Company | Oxygenated esters of 4-iodo phenylamino benzhydroxamic acids |
| WO2002016436A2 (en) | 2000-08-22 | 2002-02-28 | Novartis Ag | ANTIBODIES TO HUMAN IL-1$g(b) |
| US20020076406A1 (en) | 2000-07-25 | 2002-06-20 | Leung Shui-On | Multivalent target binding protein |
| US20020103345A1 (en) | 2000-05-24 | 2002-08-01 | Zhenping Zhu | Bispecific immunoglobulin-like antigen binding proteins and method of production |
| WO2002072635A2 (en) | 2001-03-13 | 2002-09-19 | University College London | Specific binding members |
| US6476198B1 (en) | 1993-07-13 | 2002-11-05 | The Scripps Research Institute | Multispecific and multivalent antigen-binding polypeptide molecules |
| US6511663B1 (en) | 1991-06-11 | 2003-01-28 | Celltech R&D Limited | Tri- and tetra-valent monospecific antigen-binding proteins |
| WO2003076424A1 (en) | 2002-03-08 | 2003-09-18 | Eisai Co. Ltd. | Macrocyclic compounds useful as pharmaceuticals |
| WO2003077914A1 (en) | 2002-03-13 | 2003-09-25 | Array Biopharma, Inc | N3 alkylated benzimidazole derivatives as mek inhibitors |
| US20030207346A1 (en) | 1997-05-02 | 2003-11-06 | William R. Arathoon | Method for making multispecific antibodies having heteromultimeric and common components |
| US20030211078A1 (en) | 2001-12-07 | 2003-11-13 | Heavner George A. | Pseudo-antibody constructs |
| US6670453B2 (en) | 1997-10-27 | 2003-12-30 | Unilever Patent Holdings B.V. | Multivalent antigen-binding proteins |
| US6743896B2 (en) | 1997-04-30 | 2004-06-01 | Enzon, Inc. | Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof |
| WO2004045532A2 (en) | 2002-11-15 | 2004-06-03 | Chiron Corporation | Methods for preventing and treating cancer metastasis and bone loss associated with cancer metastasis |
| US6770622B2 (en) | 2001-06-08 | 2004-08-03 | Gary A. Jarvis | N-terminally truncated galectin-3 for use in treating cancer |
| WO2004081051A1 (en) | 2003-03-12 | 2004-09-23 | The University Of Birmingham | Bispecific antibodies |
| US6809185B1 (en) | 1998-01-23 | 2004-10-26 | Vlaams Interuniversitair Instituut Voor Biotechnologie | Multipurpose antibody derivatives |
| US20040220388A1 (en) | 2000-06-30 | 2004-11-04 | Nico Mertens | Novel heterodimeric fusion proteins |
| US20040219643A1 (en) | 2001-06-28 | 2004-11-04 | Greg Winter | Dual-specific ligand |
| US20040242847A1 (en) | 2000-10-20 | 2004-12-02 | Naoshi Fukushima | Degraded agonist antibody |
| US6833441B2 (en) | 2001-08-01 | 2004-12-21 | Abmaxis, Inc. | Compositions and methods for generating chimeric heteromultimers |
| US20050003403A1 (en) | 2003-04-22 | 2005-01-06 | Rossi Edmund A. | Polyvalent protein complex |
| US20050004352A1 (en) | 1998-04-09 | 2005-01-06 | Roland Kontermann | Single-chain multiple antigen-binding molecule, its preparation and use |
| US20050069552A1 (en) | 2003-07-28 | 2005-03-31 | Bleck Gregory T. | Fusion antibodies |
| US20050079170A1 (en) | 2001-09-14 | 2005-04-14 | Fabrice Le Gall | Dimeric and multimeric antigen binding structure |
| US20050100543A1 (en) | 2003-07-01 | 2005-05-12 | Immunomedics, Inc. | Multivalent carriers of bi-specific antibodies |
| US20050136049A1 (en) | 2001-01-17 | 2005-06-23 | Ledbetter Jeffrey A. | Binding constructs and methods for use thereof |
| US20050136051A1 (en) | 2003-12-22 | 2005-06-23 | Bernard Scallon | Methods for generating multimeric molecules |
| US20050163782A1 (en) | 2003-06-27 | 2005-07-28 | Biogen Idec Ma Inc. | Modified binding molecules comprising connecting peptides |
| WO2005068503A2 (en) | 2004-01-07 | 2005-07-28 | Chiron Corporation | M-csf-specific monoclonal antibody and uses thereof |
| US20050266425A1 (en) | 2003-12-31 | 2005-12-01 | Vaccinex, Inc. | Methods for producing and identifying multispecific antibodies |
| WO2005121142A1 (en) | 2004-06-11 | 2005-12-22 | Japan Tobacco Inc. | 5-amino-2,4,7-trioxo-3,4,7,8-tetrahydro-2h-pyrido’2,3-d! pyrimidine derivatives and related compounds for the treatment of cancer |
| WO2006020258A2 (en) | 2004-07-17 | 2006-02-23 | Imclone Systems Incorporated | Novel tetravalent bispecific antibody |
| US20060083747A1 (en) | 2002-12-27 | 2006-04-20 | Domantis Limited | Fc fusion |
| US20060120960A1 (en) | 2004-01-30 | 2006-06-08 | Sergey Deyev | Multivalent complexes, their production and method of use |
| WO2006086469A2 (en) | 2005-02-08 | 2006-08-17 | Genzyme Corporation | Antibodies to tgfbeta |
| US20060204493A1 (en) | 2004-09-02 | 2006-09-14 | Genentech, Inc. | Heteromultimeric molecules |
| WO2006105021A2 (en) | 2005-03-25 | 2006-10-05 | Tolerrx, Inc. | Gitr binding molecules and uses therefor |
| WO2006106905A1 (ja) | 2005-03-31 | 2006-10-12 | Chugai Seiyaku Kabushiki Kaisha | 会合制御によるポリペプチド製造方法 |
| US7129330B1 (en) | 1998-05-05 | 2006-10-31 | Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts | Multivalent antibody constructs |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| US20060263367A1 (en) | 2005-05-23 | 2006-11-23 | Fey Georg H | Bispecific antibody devoid of Fc region and method of treatment using same |
| US20070004909A1 (en) | 2005-04-15 | 2007-01-04 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2007002261A2 (en) | 2005-06-21 | 2007-01-04 | Xoma Technology Ltd. | IL-1β BINDING ANTIBODIES AND FRAGMENTS THEREOF |
| WO2007004606A1 (ja) | 2005-07-04 | 2007-01-11 | Nikon Vision Co., Ltd. | 測距装置 |
| WO2007004415A1 (ja) | 2005-07-01 | 2007-01-11 | Murata Manufacturing Co., Ltd. | 多層セラミック基板およびその製造方法ならびに多層セラミック基板作製用複合グリーンシート |
| US7183076B2 (en) | 1997-05-02 | 2007-02-27 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US20070087381A1 (en) | 2002-04-15 | 2007-04-19 | Tetsuo Kojima | Methods for constructing scdb libraries |
| WO2007044887A2 (en) | 2005-10-11 | 2007-04-19 | Transtarget, Inc. | Method for producing a population of homogenous tetravalent bispecific antibodies |
| US20070128150A1 (en) | 2003-12-23 | 2007-06-07 | Norman Timothy J | Branched molecular scaffolds for linking polymer residues to biologically active moieties |
| US20070141049A1 (en) | 2005-08-26 | 2007-06-21 | Reinhard Bredehorst | Bivalent IgY antibody constructs for diagnostic and therapeutic applications |
| US20070154901A1 (en) | 1997-06-11 | 2007-07-05 | Protein Engineering Technology Aps | Trimerising module |
| WO2007084342A2 (en) | 2006-01-13 | 2007-07-26 | The Government Of The United States, As Represented By The Secretary Of The Department Of Health And Human Services, National Institutes Of Health | Codon optimi zed il- 15 and il- 15r-alpha genes for expression in mammalian cells |
| WO2007095338A2 (en) | 2006-02-15 | 2007-08-23 | Imclone Systems Incorporated | Functional antibodies |
| WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| WO2007121484A2 (en) | 2006-04-19 | 2007-10-25 | Novartis Ag | 6-o-substituted benzoxazole and benzothiazole compounds and methods of inhibiting csf-1r signaling |
| US20070274985A1 (en) | 2006-05-26 | 2007-11-29 | Stefan Dubel | Antibody |
| WO2007137760A2 (en) | 2006-05-25 | 2007-12-06 | Bayer Schering Pharma Aktiengesellschaft | Dimeric molecular complexes |
| WO2008016893A1 (en) | 2006-08-02 | 2008-02-07 | Novartis Ag | Smac peptidomimetics useful as iap inhibitors |
| US7332582B2 (en) | 2002-05-23 | 2008-02-19 | Curetech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| US20080050370A1 (en) | 2006-03-17 | 2008-02-28 | Scott Glaser | Stabilized polypeptide compositions |
| WO2008024725A1 (en) | 2006-08-21 | 2008-02-28 | Genentech, Inc. | Aza-benzofuranyl compounds and methods of use |
| US20080069820A1 (en) | 2006-08-30 | 2008-03-20 | Genentech, Inc. | Multispecific antibodies |
| WO2008061741A1 (en) | 2006-11-23 | 2008-05-29 | Novartis Ag | 5-sulfanylmethyl-[1,2,4] triazol[1, 5-a] pyrimidin-7-ol derivatives as cxcr2 antagonists |
| WO2008062026A1 (en) | 2006-11-23 | 2008-05-29 | Novartis Ag | 5-sulfanylmethyl-pyrazolo [1,5-a] pyrimidin-7-ol derivatives as cxcr2 antagonists |
| WO2008061740A1 (en) | 2006-11-23 | 2008-05-29 | Novartis Ag | Pyrimidines and their use as cxcr2 receptor antagonists |
| US20080152645A1 (en) | 2006-08-18 | 2008-06-26 | Armagen Technologies, Inc. | Genetically Encoded Multifunctional Compositions Bidrectionally Transported Between Peripheral Blood and the CNS |
| US20080241884A1 (en) | 2003-10-08 | 2008-10-02 | Kenya Shitara | Fused Protein Composition |
| WO2008119353A1 (en) | 2007-03-29 | 2008-10-09 | Genmab A/S | Bispecific antibodies and methods for production thereof |
| US20080254512A1 (en) | 2006-11-02 | 2008-10-16 | Capon Daniel J | Hybrid immunoglobulins with moving parts |
| US20080260738A1 (en) | 2007-04-18 | 2008-10-23 | Moore Margaret D | Single chain fc, methods of making and methods of treatment |
| WO2008132601A1 (en) | 2007-04-30 | 2008-11-06 | Immutep | Cytotoxic anti-lag-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| WO2008143794A1 (en) | 2007-05-11 | 2008-11-27 | Altor Bioscience Corporation | Fusion molecules and il-15 variants |
| US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
| WO2009021754A2 (en) | 2007-08-15 | 2009-02-19 | Bayer Schering Pharma Aktiengesellschaft | Monospecific and multispecific antibodies and method of use |
| WO2009044273A2 (en) | 2007-10-05 | 2009-04-09 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| US7521056B2 (en) | 2005-04-06 | 2009-04-21 | Ibc Pharmaceuticals, Inc. | Stably tethered structures of defined compositions with multiple functions or binding specificities |
| US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
| US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
| US20090130106A1 (en) | 2005-11-29 | 2009-05-21 | The University Of Sydney | Demibodies: dimerization-activated therapeutic agents |
| WO2009068630A1 (en) | 2007-11-27 | 2009-06-04 | Ablynx N.V. | Immunoglobulin constructs |
| US20090148905A1 (en) | 2007-11-30 | 2009-06-11 | Claire Ashman | Antigen-binding constructs |
| US20090155275A1 (en) | 2007-07-31 | 2009-06-18 | Medimmune, Llc | Multispecific epitope binding proteins and uses thereof |
| US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| US20090162360A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| US20090175867A1 (en) | 2006-06-12 | 2009-07-09 | Trubion Pharmaceuticals, Inc. | Single-Chain Multivalent Binding Proteins with Effector Function |
| US20090175851A1 (en) | 2007-12-21 | 2009-07-09 | Christian Klein | Bivalent, bispecific antibodies |
| WO2009085983A1 (en) | 2007-12-19 | 2009-07-09 | Genentech, Inc. | 5-anilinoimidazopyridines and methods of use |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2009106539A1 (en) | 2008-02-26 | 2009-09-03 | Novartis Ag | Heterocyclic compounds as inhibitors of cxcr2 |
| US20090234105A1 (en) | 2006-03-24 | 2009-09-17 | The Regents Of The University Of California | Construction of a Multivalent SCFV Through Alkyne-Azide 1,3-Dipolar Cycloaddition |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| US20090232811A1 (en) | 2007-12-21 | 2009-09-17 | Christian Klein | Bivalent, bispecific antibodies |
| US20090263392A1 (en) | 2006-03-31 | 2009-10-22 | Chugai Seiyaku Kabushiki Kaisha | Methods of modifying antibodies for purification of bispecific antibodies |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| US7612114B2 (en) | 2002-12-26 | 2009-11-03 | Eisai R&D Management Co., Ltd. | Selective estrogen receptor modulator |
| US20090274649A1 (en) | 2002-03-01 | 2009-11-05 | Immunomedics, Inc. | Bispecific Antibody Point Mutations for Enhancing Rate of Clearance |
| WO2009156737A1 (en) | 2008-06-25 | 2009-12-30 | Vernalis (R&D) Limited | Triazolo [4, 5-d] pyramidine derivatives and their use as purine receptor antagonists |
| WO2010015613A1 (en) | 2008-08-04 | 2010-02-11 | Novartis Ag | Organic compounds |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2010020675A1 (en) | 2008-08-22 | 2010-02-25 | Novartis Ag | Pyrrolopyrimidine compounds as cdk inhibitors |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| US7695715B2 (en) | 1999-03-31 | 2010-04-13 | Mor Research Applications Ltd. | Monoclonal antibodies, antigens and diagnosis and therapy of malignant diseases |
| WO2010063802A1 (en) | 2008-12-05 | 2010-06-10 | Novartis Ag | 3, 4-di-substituted cyclobutene- 1, 2 -diones as cxcr2 receptor antagonists |
| US7767675B2 (en) | 2006-11-22 | 2010-08-03 | Incyte Corporation | Imidazotriazines and imidazopyrimidines as kinase inhibitors |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2011076786A1 (en) | 2009-12-22 | 2011-06-30 | Novartis Ag | Substituted isoquinolinones and quinazolinones |
| WO2011095625A1 (en) | 2010-02-05 | 2011-08-11 | Heptares Therapeutics Limited | 1,2,4-triazine-4-amine derivatives |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2011156518A2 (en) | 2010-06-10 | 2011-12-15 | Aragon Pharmaceuticals, Inc. | Estrogen receptor modulators and uses thereof |
| WO2011159769A2 (en) | 2010-06-17 | 2011-12-22 | Aragon Pharmaceuticals, Inc. | Indane estrogen receptor modulators and uses thereof |
| US8114845B2 (en) | 2008-08-25 | 2012-02-14 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
| US20120071535A1 (en) | 2010-09-16 | 2012-03-22 | Aragon Pharmaceuticals, Inc. | Estrogen receptor modulators and uses thereof |
| WO2012062713A1 (en) | 2010-11-08 | 2012-05-18 | Novartis Ag | Cxcr2 binding polypeptides |
| US8207228B2 (en) | 2004-10-04 | 2012-06-26 | Regents Of The University Of Minnesota | Calixarene-based peptide conformation mimetics, methods of use, and methods of making |
| US8236780B2 (en) | 2006-05-16 | 2012-08-07 | Galectin Therapeutics | Galactose—pronged polysaccharides in a formulation for antifibrotic therapies |
| WO2012145493A1 (en) | 2011-04-20 | 2012-10-26 | Amplimmune, Inc. | Antibodies and other molecules that bind b7-h1 and pd-1 |
| WO2012167143A1 (en) | 2011-06-03 | 2012-12-06 | Xoma Technology Ltd. | Antibodies specific for tgf-beta |
| WO2012175222A1 (en) | 2011-06-24 | 2012-12-27 | Cytune | AN IL-15 AND IL-15Rα SUSHI DOMAIN BASED IMMUNOCYTOKINES |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| WO2013019906A1 (en) | 2011-08-01 | 2013-02-07 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and mek inhibitors |
| WO2013030803A1 (en) | 2011-09-02 | 2013-03-07 | Novartis Ag | Choline salt of an anti - inflammatory substituted cyclobutenedione compound |
| WO2013039954A1 (en) | 2011-09-14 | 2013-03-21 | Sanofi | Anti-gitr antibodies |
| WO2013060867A2 (en) | 2011-10-27 | 2013-05-02 | Genmab A/S | Production of heterodimeric proteins |
| WO2013111105A1 (en) | 2012-01-26 | 2013-08-01 | Novartis Ag | Imidazopyrrolidinone compounds |
| US8552156B2 (en) | 2010-06-11 | 2013-10-08 | Kyowa Hakko Kirin Co., Ltd | Anti-TIM-3 antibody |
| WO2013168108A2 (en) | 2012-05-09 | 2013-11-14 | Novartis Ag | Chemokine receptor binding polypeptides |
| US8602269B2 (en) | 2009-09-14 | 2013-12-10 | Guala Dispensing S.P.A. | Trigger sprayer |
| US20140072566A1 (en) | 2012-06-08 | 2014-03-13 | National Cancer Center | Novel epitope for switching to th2 cell and use thereof |
| US20140086932A1 (en) | 2012-09-17 | 2014-03-27 | Peter G. Traber | Method for enhancing specific immunotherapies in cancer treatment |
| US8686119B2 (en) | 2011-07-24 | 2014-04-01 | Curetech Ltd. | Variants of humanized immunomodulatory monoclonal antibodies |
| US8735553B1 (en) | 2013-09-13 | 2014-05-27 | Beigene, Ltd. | Anti-PD1 antibodies and their use as therapeutics and diagnostics |
| US8796284B2 (en) | 2010-03-31 | 2014-08-05 | Palobiofarma, S.L. | 4-aminopyrimidine derivatives and their as as adenosine A2a receptor antagonists |
| WO2014130310A1 (en) | 2013-02-19 | 2014-08-28 | Novartis Ag | Benzothiophene derivatives and compositions thereof as selective estrogen receptor degraders |
| WO2014140180A1 (en) | 2013-03-15 | 2014-09-18 | Glaxosmithkline Intellectual Property Development Limited | Anti-lag-3 binding proteins |
| US8841418B2 (en) | 2011-07-01 | 2014-09-23 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to TIM3 |
| WO2014179664A2 (en) | 2013-05-02 | 2014-11-06 | Anaptysbio, Inc. | Antibodies directed against programmed death-1 (pd-1) |
| WO2014194302A2 (en) | 2013-05-31 | 2014-12-04 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind pd-1 |
| US8907053B2 (en) | 2010-06-25 | 2014-12-09 | Aurigene Discovery Technologies Limited | Immunosuppression modulating compounds |
| WO2014209804A1 (en) | 2013-06-24 | 2014-12-31 | Biomed Valley Discoveries, Inc. | Bispecific antibodies |
| US8927697B2 (en) | 2008-09-12 | 2015-01-06 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| WO2015026684A1 (en) | 2013-08-20 | 2015-02-26 | Merck Sharp & Dohme Corp. | Modulation of tumor immunity |
| WO2015031667A2 (en) | 2013-08-30 | 2015-03-05 | Amgen Inc. | Gitr antigen binding proteins |
| US8993731B2 (en) | 2010-03-11 | 2015-03-31 | Ucb Biopharma Sprl | PD-1 antibody |
| US9029393B2 (en) | 2009-01-26 | 2015-05-12 | Kaldi Pharma, Sas | Adenosine receptor ligands and uses thereof |
| WO2015085847A1 (zh) | 2013-12-12 | 2015-06-18 | 上海恒瑞医药有限公司 | Pd-1抗体、其抗原结合片段及其医药用途 |
| US20150210769A1 (en) | 2014-01-24 | 2015-07-30 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
| WO2015112800A1 (en) | 2014-01-23 | 2015-07-30 | Regeneron Pharmaceuticals, Inc. | Human antibodies to pd-1 |
| US20150218274A1 (en) | 2014-01-31 | 2015-08-06 | Novartis Ag | Antibody molecules to tim-3 and uses thereof |
| WO2015116539A1 (en) | 2014-01-28 | 2015-08-06 | Bristol-Myers Squibb Company | Anti-lag-3 antibodies to treat hematological malignancies |
| US9102727B2 (en) | 2008-09-26 | 2015-08-11 | Emory University | Human anti-PD-1 antibodies and uses therefor |
| US9133197B2 (en) | 2009-03-20 | 2015-09-15 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Oxidated derivatives of triazolylpurines useful as ligands of the adenosine A2A receptor and their use as medicaments |
| WO2015136017A1 (en) | 2014-03-13 | 2015-09-17 | F. Hoffmann-La Roche Ag | Methods and compositions for modulating estrogen receptor mutants |
| US20150259420A1 (en) | 2014-03-14 | 2015-09-17 | Novartis Ag | Antibody molecules to lag-3 and uses thereof |
| US9163087B2 (en) | 2010-06-18 | 2015-10-20 | The Brigham And Women's Hospital, Inc. | Bi-specific antibodies against TIM-3 and PD-1 for immunotherapy in chronic immune conditions |
| WO2015184099A1 (en) | 2014-05-28 | 2015-12-03 | 4-Antibody Ag | Anti-gitr antibodies and methods of use thereof |
| WO2015200119A1 (en) | 2014-06-26 | 2015-12-30 | Macrogenics, Inc. | Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof |
| US9228016B2 (en) | 2014-06-06 | 2016-01-05 | Bristol-Myers Squibb Company | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (GITR) and uses thereof |
| US9244059B2 (en) | 2007-04-30 | 2016-01-26 | Immutep Parc Club Orsay | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| WO2016028672A1 (en) | 2014-08-19 | 2016-02-25 | Merck Sharp & Dohme Corp. | Anti-lag3 antibodies and antigen-binding fragments |
| WO2016054638A1 (en) | 2014-10-03 | 2016-04-07 | Dana-Farber Cancer Institute, Inc. | Glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof |
| WO2016057846A1 (en) | 2014-10-08 | 2016-04-14 | Novartis Ag | Compositions and methods of use for augmented immune response and cancer therapy |
| WO2016069727A1 (en) * | 2014-10-29 | 2016-05-06 | Five Prime Therapeutics, Inc. | Combination therapy for cancer |
| US20160129108A1 (en) | 2014-11-11 | 2016-05-12 | Medimmune Limited | Therapeutic combinations comprising anti-cd73 antibodies and uses thereof |
| WO2016071448A1 (en) | 2014-11-06 | 2016-05-12 | F. Hoffmann-La Roche Ag | Anti-tim3 antibodies and methods of use |
| WO2016079049A1 (en) * | 2014-11-17 | 2016-05-26 | Medimmune Limited | Therapeutic combinations and methods for treating neoplasia |
| WO2016092419A1 (en) | 2014-12-09 | 2016-06-16 | Rinat Neuroscience Corp. | Anti-pd-1 antibodies and methods of use thereof |
| WO2016111947A2 (en) | 2015-01-05 | 2016-07-14 | Jounce Therapeutics, Inc. | Antibodies that inhibit tim-3:lilrb2 interactions and uses thereof |
| WO2016144803A2 (en) | 2015-03-06 | 2016-09-15 | Sorrento Therapeutics, Inc. | Antibody therapeutics that bind tim3 |
| WO2016161270A1 (en) | 2015-04-01 | 2016-10-06 | Anaptysbio, Inc. | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
| US9505839B2 (en) | 2012-07-02 | 2016-11-29 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (LAG-3), and uses thereof |
| WO2016196792A1 (en) | 2015-06-03 | 2016-12-08 | Bristol-Myers Squibb Company | Anti-gitr antibodies for cancer diagnostics |
| US20170015758A1 (en) | 2014-01-21 | 2017-01-19 | Medimmune, Llc | Compositions And Methods For Modulating And Redirecting Immune Responses |
| US20170022284A1 (en) | 2015-07-23 | 2017-01-26 | Inhibrx Lp | Multivalent and multispecific gitr-binding fusion proteins |
| WO2017025918A1 (en) | 2015-08-11 | 2017-02-16 | Novartis Ag | 5-bromo-2,6-di-(lh-pyrazol-l-yl)pyrimidin-4-amine for use in the treatment of cancer |
| WO2017025610A1 (en) | 2015-08-12 | 2017-02-16 | Medimmune Limited | Gitrl fusion proteins and uses thereof |
-
2018
- 2018-11-16 CN CN201880086491.2A patent/CN111655288A/zh active Pending
- 2018-11-16 EP EP18826126.7A patent/EP3710053A1/en not_active Withdrawn
- 2018-11-16 AU AU2018368731A patent/AU2018368731A1/en not_active Abandoned
- 2018-11-16 BR BR112020008888-9A patent/BR112020008888A2/pt not_active IP Right Cessation
- 2018-11-16 MX MX2020004756A patent/MX2020004756A/es unknown
- 2018-11-16 TW TW107140803A patent/TW201922291A/zh unknown
- 2018-11-16 WO PCT/US2018/061534 patent/WO2019099838A1/en not_active Ceased
- 2018-11-16 RU RU2020119578A patent/RU2020119578A/ru unknown
- 2018-11-16 US US16/764,102 patent/US20200277378A1/en not_active Abandoned
- 2018-11-16 KR KR1020207016803A patent/KR20200089286A/ko not_active Ceased
- 2018-11-16 JP JP2020527114A patent/JP2021503478A/ja active Pending
- 2018-11-16 CA CA3081602A patent/CA3081602A1/en active Pending
-
2020
- 2020-05-03 IL IL274407A patent/IL274407A/en unknown
- 2020-05-12 CL CL2020001255A patent/CL2020001255A1/es unknown
- 2020-11-25 CL CL2020003059A patent/CL2020003059A1/es unknown
Patent Citations (278)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2779780A (en) | 1955-03-01 | 1957-01-29 | Du Pont | 1, 4-diamino-2, 3-dicyano-1, 4-bis (substituted mercapto) butadienes and their preparation |
| US4433059A (en) | 1981-09-08 | 1984-02-21 | Ortho Diagnostic Systems Inc. | Double antibody conjugate |
| US4444878A (en) | 1981-12-21 | 1984-04-24 | Boston Biomedical Research Institute, Inc. | Bispecific antibody determinants |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0125023A1 (en) | 1983-04-08 | 1984-11-14 | Genentech, Inc. | Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor |
| EP0171496A2 (en) | 1984-08-15 | 1986-02-19 | Research Development Corporation of Japan | Process for the production of a chimera monoclonal antibody |
| EP0173494A2 (en) | 1984-08-27 | 1986-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by DNA splicing and expression |
| WO1986001533A1 (en) | 1984-09-03 | 1986-03-13 | Celltech Limited | Production of chimeric antibodies |
| EP0184187A2 (en) | 1984-12-04 | 1986-06-11 | Teijin Limited | Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it |
| GB2188638A (en) | 1986-03-27 | 1987-10-07 | Gregory Paul Winter | Chimeric antibodies |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5869620A (en) | 1986-09-02 | 1999-02-09 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| EP0346087A2 (en) | 1988-06-09 | 1989-12-13 | Snow Brand Milk Products Co., Ltd. | Hybrid antibody and process for the production thereof |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| EP0388151A1 (en) | 1989-03-13 | 1990-09-19 | Celltech Limited | Modified antibodies |
| US5591828A (en) | 1989-06-22 | 1997-01-07 | Behringwerke Aktiengesellschaft | Bispecific and oligospecific mono-and oligovalent receptors, the preparation and use thereof |
| WO1991000906A1 (en) | 1989-07-12 | 1991-01-24 | Genetics Institute, Inc. | Chimeric and transgenic animals capable of producing human antibodies |
| WO1991003493A1 (en) | 1989-08-29 | 1991-03-21 | The University Of Southampton | Bi-or trispecific (fab)3 or (fab)4 conjugates |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5273743A (en) | 1990-03-09 | 1993-12-28 | Hybritech Incorporated | Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5864019A (en) | 1990-06-11 | 1999-01-26 | Celltech Limited | Multivalent antigen-binding proteins |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1992003917A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International | Homologous recombination in mammalian cells |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| WO1992015679A1 (en) | 1991-03-01 | 1992-09-17 | Protein Engineering Corporation | Improved epitode displaying phage |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US5959083A (en) | 1991-06-03 | 1999-09-28 | Behringwerke Aktiengellschaft | Tetravalent bispecific receptors, the preparation and use thereof |
| US6511663B1 (en) | 1991-06-11 | 2003-01-28 | Celltech R&D Limited | Tri- and tetra-valent monospecific antigen-binding proteins |
| WO1993001288A1 (de) | 1991-07-08 | 1993-01-21 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Phagemid zum screenen von antikörpern |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| US5910573A (en) | 1992-01-23 | 1999-06-08 | Merck Patent Gesellschaft Mit Beschrankter Haftung | Monomeric and dimeric antibody-fragment fusion proteins |
| US5534254A (en) | 1992-02-06 | 1996-07-09 | Chiron Corporation | Biosynthetic binding proteins for immuno-targeting |
| US5846545A (en) | 1992-03-25 | 1998-12-08 | Immunogen, Inc. | Targeted delivery of cyclopropylbenzindole-containing cytotoxic drugs |
| US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
| US5585499A (en) | 1992-03-25 | 1996-12-17 | Immunogen Inc. | Cyclopropylbenzindole-containing cytotoxic drugs |
| WO1993023537A1 (en) | 1992-05-08 | 1993-11-25 | Creative Biomolecules | Chimeric multivalent protein analogues and methods of use thereof |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| US5844094A (en) | 1992-09-25 | 1998-12-01 | Commonwealth Scientific And Industrial Research Organization | Target binding polypeptide |
| WO1994009131A1 (en) | 1992-10-15 | 1994-04-28 | Scotgen Limited | Recombinant specific binding protein |
| US5837821A (en) | 1992-11-04 | 1998-11-17 | City Of Hope | Antibody construct |
| WO1994012625A2 (en) | 1992-11-23 | 1994-06-09 | Zeneca Limited | LIGAND BINDING VARIABLE DOMAIN (V-MIN) COMPRISING A FRAMEWORK REGION WITH A CYCLICALLY PERMUTED CENTRAL β-BARREL |
| US5837242A (en) | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5637481A (en) | 1993-02-01 | 1997-06-10 | Bristol-Myers Squibb Company | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| US6476198B1 (en) | 1993-07-13 | 2002-11-05 | The Scripps Research Institute | Multispecific and multivalent antigen-binding polypeptide molecules |
| US5635602A (en) | 1993-08-13 | 1997-06-03 | The Regents Of The University Of California | Design and synthesis of bispecific DNA-antibody conjugates |
| WO1995009917A1 (en) | 1993-10-07 | 1995-04-13 | The Regents Of The University Of California | Genetically engineered bispecific tetravalent antibodies |
| US6294353B1 (en) | 1994-10-20 | 2001-09-25 | Morphosys Ag | Targeted hetero-association of recombinant proteins to multi-functional complexes |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| WO1996037621A2 (en) | 1995-05-23 | 1996-11-28 | Morphosys Gesellschaft Für Proteinoptimierung Mbh | Multimeric proteins |
| US5989830A (en) | 1995-10-16 | 1999-11-23 | Unilever Patent Holdings Bv | Bifunctional or bivalent antibody fragment analogue |
| US6239259B1 (en) | 1996-04-04 | 2001-05-29 | Unilever Patent Holdings B.V. | Multivalent and multispecific antigen-binding protein |
| US6743896B2 (en) | 1997-04-30 | 2004-06-01 | Enzon, Inc. | Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof |
| US7183076B2 (en) | 1997-05-02 | 2007-02-27 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US20030207346A1 (en) | 1997-05-02 | 2003-11-06 | William R. Arathoon | Method for making multispecific antibodies having heteromultimeric and common components |
| US20070154901A1 (en) | 1997-06-11 | 2007-07-05 | Protein Engineering Technology Aps | Trimerising module |
| US6670453B2 (en) | 1997-10-27 | 2003-12-30 | Unilever Patent Holdings B.V. | Multivalent antigen-binding proteins |
| US6809185B1 (en) | 1998-01-23 | 2004-10-26 | Vlaams Interuniversitair Instituut Voor Biotechnologie | Multipurpose antibody derivatives |
| US20050004352A1 (en) | 1998-04-09 | 2005-01-06 | Roland Kontermann | Single-chain multiple antigen-binding molecule, its preparation and use |
| US7129330B1 (en) | 1998-05-05 | 2006-10-31 | Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts | Multivalent antibody constructs |
| WO1999064460A1 (en) | 1998-06-10 | 1999-12-16 | Celltech Therapeutics Limited | Divalent antibody fragments |
| WO2000006605A2 (en) | 1998-07-28 | 2000-02-10 | Micromet Ag | Heterominibodies |
| US6333396B1 (en) | 1998-10-20 | 2001-12-25 | Enzon, Inc. | Method for targeted delivery of nucleic acids |
| WO2000035436A2 (en) | 1998-12-16 | 2000-06-22 | Warner-Lambert Company | Treatment of arthritis with mek inhibitors |
| US7695715B2 (en) | 1999-03-31 | 2010-04-13 | Mor Research Applications Ltd. | Monoclonal antibodies, antigens and diagnosis and therapy of malignant diseases |
| WO2001051056A1 (en) | 2000-01-10 | 2001-07-19 | Astrazeneca Ab | Fulvestrant formulation |
| US20020004587A1 (en) | 2000-04-11 | 2002-01-10 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| US20020103345A1 (en) | 2000-05-24 | 2002-08-01 | Zhenping Zhu | Bispecific immunoglobulin-like antigen binding proteins and method of production |
| US20040220388A1 (en) | 2000-06-30 | 2004-11-04 | Nico Mertens | Novel heterodimeric fusion proteins |
| WO2002006213A2 (en) | 2000-07-19 | 2002-01-24 | Warner-Lambert Company | Oxygenated esters of 4-iodo phenylamino benzhydroxamic acids |
| US20020076406A1 (en) | 2000-07-25 | 2002-06-20 | Leung Shui-On | Multivalent target binding protein |
| WO2002016436A2 (en) | 2000-08-22 | 2002-02-28 | Novartis Ag | ANTIBODIES TO HUMAN IL-1$g(b) |
| US7446175B2 (en) | 2000-08-22 | 2008-11-04 | Novartis Ag | Antibodies to human IL-1β |
| EP1313769A2 (en) | 2000-08-22 | 2003-05-28 | Novartis AG | Antibodies to human il-1 beta |
| US20040242847A1 (en) | 2000-10-20 | 2004-12-02 | Naoshi Fukushima | Degraded agonist antibody |
| US20050136049A1 (en) | 2001-01-17 | 2005-06-23 | Ledbetter Jeffrey A. | Binding constructs and methods for use thereof |
| WO2002072635A2 (en) | 2001-03-13 | 2002-09-19 | University College London | Specific binding members |
| US6770622B2 (en) | 2001-06-08 | 2004-08-03 | Gary A. Jarvis | N-terminally truncated galectin-3 for use in treating cancer |
| US20040219643A1 (en) | 2001-06-28 | 2004-11-04 | Greg Winter | Dual-specific ligand |
| US6833441B2 (en) | 2001-08-01 | 2004-12-21 | Abmaxis, Inc. | Compositions and methods for generating chimeric heteromultimers |
| US20050079170A1 (en) | 2001-09-14 | 2005-04-14 | Fabrice Le Gall | Dimeric and multimeric antigen binding structure |
| US20030211078A1 (en) | 2001-12-07 | 2003-11-13 | Heavner George A. | Pseudo-antibody constructs |
| US20090274649A1 (en) | 2002-03-01 | 2009-11-05 | Immunomedics, Inc. | Bispecific Antibody Point Mutations for Enhancing Rate of Clearance |
| WO2003076424A1 (en) | 2002-03-08 | 2003-09-18 | Eisai Co. Ltd. | Macrocyclic compounds useful as pharmaceuticals |
| WO2003077914A1 (en) | 2002-03-13 | 2003-09-25 | Array Biopharma, Inc | N3 alkylated benzimidazole derivatives as mek inhibitors |
| US20070087381A1 (en) | 2002-04-15 | 2007-04-19 | Tetsuo Kojima | Methods for constructing scdb libraries |
| US7332582B2 (en) | 2002-05-23 | 2008-02-19 | Curetech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| WO2004045532A2 (en) | 2002-11-15 | 2004-06-03 | Chiron Corporation | Methods for preventing and treating cancer metastasis and bone loss associated with cancer metastasis |
| US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
| US7612114B2 (en) | 2002-12-26 | 2009-11-03 | Eisai R&D Management Co., Ltd. | Selective estrogen receptor modulator |
| US20060083747A1 (en) | 2002-12-27 | 2006-04-20 | Domantis Limited | Fc fusion |
| WO2004081051A1 (en) | 2003-03-12 | 2004-09-23 | The University Of Birmingham | Bispecific antibodies |
| US20050003403A1 (en) | 2003-04-22 | 2005-01-06 | Rossi Edmund A. | Polyvalent protein complex |
| US20080171855A1 (en) | 2003-04-22 | 2008-07-17 | Ibc Pharmaceuticals, Inc. | Polyvalent protein complex |
| US20050163782A1 (en) | 2003-06-27 | 2005-07-28 | Biogen Idec Ma Inc. | Modified binding molecules comprising connecting peptides |
| US20050100543A1 (en) | 2003-07-01 | 2005-05-12 | Immunomedics, Inc. | Multivalent carriers of bi-specific antibodies |
| US20050069552A1 (en) | 2003-07-28 | 2005-03-31 | Bleck Gregory T. | Fusion antibodies |
| US20080241884A1 (en) | 2003-10-08 | 2008-10-02 | Kenya Shitara | Fused Protein Composition |
| US20050136051A1 (en) | 2003-12-22 | 2005-06-23 | Bernard Scallon | Methods for generating multimeric molecules |
| US20070128150A1 (en) | 2003-12-23 | 2007-06-07 | Norman Timothy J | Branched molecular scaffolds for linking polymer residues to biologically active moieties |
| US20050266425A1 (en) | 2003-12-31 | 2005-12-01 | Vaccinex, Inc. | Methods for producing and identifying multispecific antibodies |
| US9079956B2 (en) | 2004-01-07 | 2015-07-14 | Novartis Vaccines And Diagnostics Inc. | M-CSF specific monoclonal antibody and uses thereof |
| WO2005068503A2 (en) | 2004-01-07 | 2005-07-28 | Chiron Corporation | M-csf-specific monoclonal antibody and uses thereof |
| US20060120960A1 (en) | 2004-01-30 | 2006-06-08 | Sergey Deyev | Multivalent complexes, their production and method of use |
| WO2005121142A1 (en) | 2004-06-11 | 2005-12-22 | Japan Tobacco Inc. | 5-amino-2,4,7-trioxo-3,4,7,8-tetrahydro-2h-pyrido’2,3-d! pyrimidine derivatives and related compounds for the treatment of cancer |
| WO2006020258A2 (en) | 2004-07-17 | 2006-02-23 | Imclone Systems Incorporated | Novel tetravalent bispecific antibody |
| US20060204493A1 (en) | 2004-09-02 | 2006-09-14 | Genentech, Inc. | Heteromultimeric molecules |
| US8207228B2 (en) | 2004-10-04 | 2012-06-26 | Regents Of The University Of Minnesota | Calixarene-based peptide conformation mimetics, methods of use, and methods of making |
| US8383780B2 (en) | 2005-02-08 | 2013-02-26 | Genzyme Corporation | Antibodies to TGFβ |
| US8591901B2 (en) | 2005-02-08 | 2013-11-26 | Genzyme Corporation | Antibodies to TGF-β |
| WO2006086469A2 (en) | 2005-02-08 | 2006-08-17 | Genzyme Corporation | Antibodies to tgfbeta |
| US8388967B2 (en) | 2005-03-25 | 2013-03-05 | Gitr, Inc. | Methods for inducing or enhancing an immune response by administering agonistic GITR-binding antibodies |
| US7812135B2 (en) | 2005-03-25 | 2010-10-12 | Tolerrx, Inc. | GITR-binding antibodies |
| US9028823B2 (en) | 2005-03-25 | 2015-05-12 | Gitr, Inc. | Methods of inducing or enhancing an immune response in a subject by administering agonistic GITR binding antibodies |
| WO2006105021A2 (en) | 2005-03-25 | 2006-10-05 | Tolerrx, Inc. | Gitr binding molecules and uses therefor |
| WO2006106905A1 (ja) | 2005-03-31 | 2006-10-12 | Chugai Seiyaku Kabushiki Kaisha | 会合制御によるポリペプチド製造方法 |
| US7521056B2 (en) | 2005-04-06 | 2009-04-21 | Ibc Pharmaceuticals, Inc. | Stably tethered structures of defined compositions with multiple functions or binding specificities |
| US20070004909A1 (en) | 2005-04-15 | 2007-01-04 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| US20060263367A1 (en) | 2005-05-23 | 2006-11-23 | Fey Georg H | Bispecific antibody devoid of Fc region and method of treatment using same |
| WO2007002261A2 (en) | 2005-06-21 | 2007-01-04 | Xoma Technology Ltd. | IL-1β BINDING ANTIBODIES AND FRAGMENTS THEREOF |
| WO2007004415A1 (ja) | 2005-07-01 | 2007-01-11 | Murata Manufacturing Co., Ltd. | 多層セラミック基板およびその製造方法ならびに多層セラミック基板作製用複合グリーンシート |
| WO2007004606A1 (ja) | 2005-07-04 | 2007-01-11 | Nikon Vision Co., Ltd. | 測距装置 |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| US20070141049A1 (en) | 2005-08-26 | 2007-06-21 | Reinhard Bredehorst | Bivalent IgY antibody constructs for diagnostic and therapeutic applications |
| WO2007044887A2 (en) | 2005-10-11 | 2007-04-19 | Transtarget, Inc. | Method for producing a population of homogenous tetravalent bispecific antibodies |
| US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
| US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
| US20090130106A1 (en) | 2005-11-29 | 2009-05-21 | The University Of Sydney | Demibodies: dimerization-activated therapeutic agents |
| WO2007084342A2 (en) | 2006-01-13 | 2007-07-26 | The Government Of The United States, As Represented By The Secretary Of The Department Of Health And Human Services, National Institutes Of Health | Codon optimi zed il- 15 and il- 15r-alpha genes for expression in mammalian cells |
| WO2007095338A2 (en) | 2006-02-15 | 2007-08-23 | Imclone Systems Incorporated | Functional antibodies |
| US20080050370A1 (en) | 2006-03-17 | 2008-02-28 | Scott Glaser | Stabilized polypeptide compositions |
| US20090234105A1 (en) | 2006-03-24 | 2009-09-17 | The Regents Of The University Of California | Construction of a Multivalent SCFV Through Alkyne-Azide 1,3-Dipolar Cycloaddition |
| WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| US20090263392A1 (en) | 2006-03-31 | 2009-10-22 | Chugai Seiyaku Kabushiki Kaisha | Methods of modifying antibodies for purification of bispecific antibodies |
| WO2007121484A2 (en) | 2006-04-19 | 2007-10-25 | Novartis Ag | 6-o-substituted benzoxazole and benzothiazole compounds and methods of inhibiting csf-1r signaling |
| US8710048B2 (en) | 2006-04-19 | 2014-04-29 | Novartis Ag | 6-O-substituted benzoxazole and benzothiazole compounds and methods of inhibiting CSF-1R signaling |
| US7553854B2 (en) | 2006-04-19 | 2009-06-30 | Novartis Vaccines And Diagnostics, Inc. | 6-O-substituted benzoxazole and benzothiazole compounds and methods of inhibiting CSF-1R signaling |
| US8173689B2 (en) | 2006-04-19 | 2012-05-08 | Novartis Ag | 6-O-substituted benzoxazole and benzothiazole compounds and methods of inhibiting CSF-1R signaling |
| US8236780B2 (en) | 2006-05-16 | 2012-08-07 | Galectin Therapeutics | Galactose—pronged polysaccharides in a formulation for antifibrotic therapies |
| WO2007137760A2 (en) | 2006-05-25 | 2007-12-06 | Bayer Schering Pharma Aktiengesellschaft | Dimeric molecular complexes |
| US20070274985A1 (en) | 2006-05-26 | 2007-11-29 | Stefan Dubel | Antibody |
| US20090175867A1 (en) | 2006-06-12 | 2009-07-09 | Trubion Pharmaceuticals, Inc. | Single-Chain Multivalent Binding Proteins with Effector Function |
| WO2008016893A1 (en) | 2006-08-02 | 2008-02-07 | Novartis Ag | Smac peptidomimetics useful as iap inhibitors |
| US20080152645A1 (en) | 2006-08-18 | 2008-06-26 | Armagen Technologies, Inc. | Genetically Encoded Multifunctional Compositions Bidrectionally Transported Between Peripheral Blood and the CNS |
| WO2008024725A1 (en) | 2006-08-21 | 2008-02-28 | Genentech, Inc. | Aza-benzofuranyl compounds and methods of use |
| US20080069820A1 (en) | 2006-08-30 | 2008-03-20 | Genentech, Inc. | Multispecific antibodies |
| US20080254512A1 (en) | 2006-11-02 | 2008-10-16 | Capon Daniel J | Hybrid immunoglobulins with moving parts |
| US7767675B2 (en) | 2006-11-22 | 2010-08-03 | Incyte Corporation | Imidazotriazines and imidazopyrimidines as kinase inhibitors |
| US8461330B2 (en) | 2006-11-22 | 2013-06-11 | Incyte Corporation | Imidazotriazines and imidazopyrimidines as kinase inhibitors |
| WO2008061740A1 (en) | 2006-11-23 | 2008-05-29 | Novartis Ag | Pyrimidines and their use as cxcr2 receptor antagonists |
| WO2008062026A1 (en) | 2006-11-23 | 2008-05-29 | Novartis Ag | 5-sulfanylmethyl-pyrazolo [1,5-a] pyrimidin-7-ol derivatives as cxcr2 antagonists |
| WO2008061741A1 (en) | 2006-11-23 | 2008-05-29 | Novartis Ag | 5-sulfanylmethyl-[1,2,4] triazol[1, 5-a] pyrimidin-7-ol derivatives as cxcr2 antagonists |
| US20100152205A1 (en) | 2006-11-23 | 2010-06-17 | Novartis Ag | Cxcr2 inhibitors |
| WO2008119353A1 (en) | 2007-03-29 | 2008-10-09 | Genmab A/S | Bispecific antibodies and methods for production thereof |
| US20080260738A1 (en) | 2007-04-18 | 2008-10-23 | Moore Margaret D | Single chain fc, methods of making and methods of treatment |
| US9244059B2 (en) | 2007-04-30 | 2016-01-26 | Immutep Parc Club Orsay | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| WO2008132601A1 (en) | 2007-04-30 | 2008-11-06 | Immutep | Cytotoxic anti-lag-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| WO2008143794A1 (en) | 2007-05-11 | 2008-11-27 | Altor Bioscience Corporation | Fusion molecules and il-15 variants |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| US20090155275A1 (en) | 2007-07-31 | 2009-06-18 | Medimmune, Llc | Multispecific epitope binding proteins and uses thereof |
| WO2009021754A2 (en) | 2007-08-15 | 2009-02-19 | Bayer Schering Pharma Aktiengesellschaft | Monospecific and multispecific antibodies and method of use |
| WO2009044273A2 (en) | 2007-10-05 | 2009-04-09 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| WO2009068630A1 (en) | 2007-11-27 | 2009-06-04 | Ablynx N.V. | Immunoglobulin constructs |
| US20090148905A1 (en) | 2007-11-30 | 2009-06-11 | Claire Ashman | Antigen-binding constructs |
| WO2009085983A1 (en) | 2007-12-19 | 2009-07-09 | Genentech, Inc. | 5-anilinoimidazopyridines and methods of use |
| US20090175851A1 (en) | 2007-12-21 | 2009-07-09 | Christian Klein | Bivalent, bispecific antibodies |
| US20090162360A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| US20090232811A1 (en) | 2007-12-21 | 2009-09-17 | Christian Klein | Bivalent, bispecific antibodies |
| US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2009106539A1 (en) | 2008-02-26 | 2009-09-03 | Novartis Ag | Heterocyclic compounds as inhibitors of cxcr2 |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| WO2009156737A1 (en) | 2008-06-25 | 2009-12-30 | Vernalis (R&D) Limited | Triazolo [4, 5-d] pyramidine derivatives and their use as purine receptor antagonists |
| US20110251205A1 (en) | 2008-08-04 | 2011-10-13 | Novartis Ag | Squaramide derivatives as cxcr2 antagonist |
| WO2010015613A1 (en) | 2008-08-04 | 2010-02-11 | Novartis Ag | Organic compounds |
| US8329754B2 (en) | 2008-08-04 | 2012-12-11 | Novartis Ag | Squaramide derivatives as CXCR2 antagonist |
| US8722925B2 (en) | 2008-08-04 | 2014-05-13 | Novartis Ag | Squaramide derivatives as CXCR2 antagonist |
| US20110251206A1 (en) | 2008-08-04 | 2011-10-13 | Novartis Ag | Squaramide derivatives as CXCR2 antagonist |
| US8288588B2 (en) | 2008-08-04 | 2012-10-16 | Novartis Ag | Squaramide derivatives as CXCR2 antagonist |
| US9115087B2 (en) | 2008-08-04 | 2015-08-25 | Novartis Ag | Squaramide derivatives as CXCR2 antagonist |
| US7989497B2 (en) | 2008-08-04 | 2011-08-02 | Novartis Ag | Squaramide derivatives as CXCR2 antagonist |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US8415355B2 (en) | 2008-08-22 | 2013-04-09 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
| US8685980B2 (en) | 2008-08-22 | 2014-04-01 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
| WO2010020675A1 (en) | 2008-08-22 | 2010-02-25 | Novartis Ag | Pyrrolopyrimidine compounds as cdk inhibitors |
| US8114845B2 (en) | 2008-08-25 | 2012-02-14 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| US8927697B2 (en) | 2008-09-12 | 2015-01-06 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| US9102727B2 (en) | 2008-09-26 | 2015-08-11 | Emory University | Human anti-PD-1 antibodies and uses therefor |
| WO2010063802A1 (en) | 2008-12-05 | 2010-06-10 | Novartis Ag | 3, 4-di-substituted cyclobutene- 1, 2 -diones as cxcr2 receptor antagonists |
| US9029393B2 (en) | 2009-01-26 | 2015-05-12 | Kaldi Pharma, Sas | Adenosine receptor ligands and uses thereof |
| US9133197B2 (en) | 2009-03-20 | 2015-09-15 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Oxidated derivatives of triazolylpurines useful as ligands of the adenosine A2A receptor and their use as medicaments |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| US8709424B2 (en) | 2009-09-03 | 2014-04-29 | Merck Sharp & Dohme Corp. | Anti-GITR antibodies |
| US8602269B2 (en) | 2009-09-14 | 2013-12-10 | Guala Dispensing S.P.A. | Trigger sprayer |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2011076786A1 (en) | 2009-12-22 | 2011-06-30 | Novartis Ag | Substituted isoquinolinones and quinazolinones |
| WO2011095625A1 (en) | 2010-02-05 | 2011-08-11 | Heptares Therapeutics Limited | 1,2,4-triazine-4-amine derivatives |
| US8993731B2 (en) | 2010-03-11 | 2015-03-31 | Ucb Biopharma Sprl | PD-1 antibody |
| US8796284B2 (en) | 2010-03-31 | 2014-08-05 | Palobiofarma, S.L. | 4-aminopyrimidine derivatives and their as as adenosine A2a receptor antagonists |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2011156518A2 (en) | 2010-06-10 | 2011-12-15 | Aragon Pharmaceuticals, Inc. | Estrogen receptor modulators and uses thereof |
| US8552156B2 (en) | 2010-06-11 | 2013-10-08 | Kyowa Hakko Kirin Co., Ltd | Anti-TIM-3 antibody |
| WO2011159769A2 (en) | 2010-06-17 | 2011-12-22 | Aragon Pharmaceuticals, Inc. | Indane estrogen receptor modulators and uses thereof |
| US9163087B2 (en) | 2010-06-18 | 2015-10-20 | The Brigham And Women's Hospital, Inc. | Bi-specific antibodies against TIM-3 and PD-1 for immunotherapy in chronic immune conditions |
| US8907053B2 (en) | 2010-06-25 | 2014-12-09 | Aurigene Discovery Technologies Limited | Immunosuppression modulating compounds |
| WO2012037410A2 (en) | 2010-09-16 | 2012-03-22 | Aragon Pharmaceuticals, Inc. | Estrogen receptor modulators and uses thereof |
| US20120071535A1 (en) | 2010-09-16 | 2012-03-22 | Aragon Pharmaceuticals, Inc. | Estrogen receptor modulators and uses thereof |
| WO2012037411A2 (en) | 2010-09-16 | 2012-03-22 | Aragon Pharmaceuticals, Inc. | Estrogen receptor modulators and uses thereof |
| WO2012062713A1 (en) | 2010-11-08 | 2012-05-18 | Novartis Ag | Cxcr2 binding polypeptides |
| WO2012145493A1 (en) | 2011-04-20 | 2012-10-26 | Amplimmune, Inc. | Antibodies and other molecules that bind b7-h1 and pd-1 |
| US9205148B2 (en) | 2011-04-20 | 2015-12-08 | Medimmune, Llc | Antibodies and other molecules that bind B7-H1 and PD-1 |
| WO2012167143A1 (en) | 2011-06-03 | 2012-12-06 | Xoma Technology Ltd. | Antibodies specific for tgf-beta |
| WO2012175222A1 (en) | 2011-06-24 | 2012-12-27 | Cytune | AN IL-15 AND IL-15Rα SUSHI DOMAIN BASED IMMUNOCYTOKINES |
| US8841418B2 (en) | 2011-07-01 | 2014-09-23 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to TIM3 |
| US8686119B2 (en) | 2011-07-24 | 2014-04-01 | Curetech Ltd. | Variants of humanized immunomodulatory monoclonal antibodies |
| WO2013019906A1 (en) | 2011-08-01 | 2013-02-07 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and mek inhibitors |
| WO2013030803A1 (en) | 2011-09-02 | 2013-03-07 | Novartis Ag | Choline salt of an anti - inflammatory substituted cyclobutenedione compound |
| WO2013039954A1 (en) | 2011-09-14 | 2013-03-21 | Sanofi | Anti-gitr antibodies |
| WO2013060867A2 (en) | 2011-10-27 | 2013-05-02 | Genmab A/S | Production of heterodimeric proteins |
| WO2013111105A1 (en) | 2012-01-26 | 2013-08-01 | Novartis Ag | Imidazopyrrolidinone compounds |
| WO2013168108A2 (en) | 2012-05-09 | 2013-11-14 | Novartis Ag | Chemokine receptor binding polypeptides |
| US20140072566A1 (en) | 2012-06-08 | 2014-03-13 | National Cancer Center | Novel epitope for switching to th2 cell and use thereof |
| US9505839B2 (en) | 2012-07-02 | 2016-11-29 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (LAG-3), and uses thereof |
| US20140086932A1 (en) | 2012-09-17 | 2014-03-27 | Peter G. Traber | Method for enhancing specific immunotherapies in cancer treatment |
| WO2014130310A1 (en) | 2013-02-19 | 2014-08-28 | Novartis Ag | Benzothiophene derivatives and compositions thereof as selective estrogen receptor degraders |
| WO2014140180A1 (en) | 2013-03-15 | 2014-09-18 | Glaxosmithkline Intellectual Property Development Limited | Anti-lag-3 binding proteins |
| WO2014179664A2 (en) | 2013-05-02 | 2014-11-06 | Anaptysbio, Inc. | Antibodies directed against programmed death-1 (pd-1) |
| WO2014194302A2 (en) | 2013-05-31 | 2014-12-04 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind pd-1 |
| WO2014209804A1 (en) | 2013-06-24 | 2014-12-31 | Biomed Valley Discoveries, Inc. | Bispecific antibodies |
| WO2015026684A1 (en) | 2013-08-20 | 2015-02-26 | Merck Sharp & Dohme Corp. | Modulation of tumor immunity |
| WO2015031667A2 (en) | 2013-08-30 | 2015-03-05 | Amgen Inc. | Gitr antigen binding proteins |
| US9464139B2 (en) | 2013-08-30 | 2016-10-11 | Amgen Inc. | GITR antigen binding proteins and methods of use thereof |
| US8735553B1 (en) | 2013-09-13 | 2014-05-27 | Beigene, Ltd. | Anti-PD1 antibodies and their use as therapeutics and diagnostics |
| WO2015085847A1 (zh) | 2013-12-12 | 2015-06-18 | 上海恒瑞医药有限公司 | Pd-1抗体、其抗原结合片段及其医药用途 |
| US20170015758A1 (en) | 2014-01-21 | 2017-01-19 | Medimmune, Llc | Compositions And Methods For Modulating And Redirecting Immune Responses |
| WO2015112800A1 (en) | 2014-01-23 | 2015-07-30 | Regeneron Pharmaceuticals, Inc. | Human antibodies to pd-1 |
| US20150210769A1 (en) | 2014-01-24 | 2015-07-30 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
| WO2015116539A1 (en) | 2014-01-28 | 2015-08-06 | Bristol-Myers Squibb Company | Anti-lag-3 antibodies to treat hematological malignancies |
| US20150218274A1 (en) | 2014-01-31 | 2015-08-06 | Novartis Ag | Antibody molecules to tim-3 and uses thereof |
| WO2015136017A1 (en) | 2014-03-13 | 2015-09-17 | F. Hoffmann-La Roche Ag | Methods and compositions for modulating estrogen receptor mutants |
| US20150259420A1 (en) | 2014-03-14 | 2015-09-17 | Novartis Ag | Antibody molecules to lag-3 and uses thereof |
| WO2015184099A1 (en) | 2014-05-28 | 2015-12-03 | 4-Antibody Ag | Anti-gitr antibodies and methods of use thereof |
| US20150368349A1 (en) | 2014-05-28 | 2015-12-24 | 4-Antibody Ag | Anti-GITR Antibodies and Methods of Use Thereof |
| US9228016B2 (en) | 2014-06-06 | 2016-01-05 | Bristol-Myers Squibb Company | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (GITR) and uses thereof |
| WO2015200119A1 (en) | 2014-06-26 | 2015-12-30 | Macrogenics, Inc. | Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof |
| WO2016028672A1 (en) | 2014-08-19 | 2016-02-25 | Merck Sharp & Dohme Corp. | Anti-lag3 antibodies and antigen-binding fragments |
| WO2016054638A1 (en) | 2014-10-03 | 2016-04-07 | Dana-Farber Cancer Institute, Inc. | Glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof |
| WO2016057846A1 (en) | 2014-10-08 | 2016-04-14 | Novartis Ag | Compositions and methods of use for augmented immune response and cancer therapy |
| WO2016069727A1 (en) * | 2014-10-29 | 2016-05-06 | Five Prime Therapeutics, Inc. | Combination therapy for cancer |
| WO2016071448A1 (en) | 2014-11-06 | 2016-05-12 | F. Hoffmann-La Roche Ag | Anti-tim3 antibodies and methods of use |
| US20160129108A1 (en) | 2014-11-11 | 2016-05-12 | Medimmune Limited | Therapeutic combinations comprising anti-cd73 antibodies and uses thereof |
| WO2016079049A1 (en) * | 2014-11-17 | 2016-05-26 | Medimmune Limited | Therapeutic combinations and methods for treating neoplasia |
| WO2016092419A1 (en) | 2014-12-09 | 2016-06-16 | Rinat Neuroscience Corp. | Anti-pd-1 antibodies and methods of use thereof |
| WO2016111947A2 (en) | 2015-01-05 | 2016-07-14 | Jounce Therapeutics, Inc. | Antibodies that inhibit tim-3:lilrb2 interactions and uses thereof |
| WO2016144803A2 (en) | 2015-03-06 | 2016-09-15 | Sorrento Therapeutics, Inc. | Antibody therapeutics that bind tim3 |
| WO2016161270A1 (en) | 2015-04-01 | 2016-10-06 | Anaptysbio, Inc. | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
| WO2016196792A1 (en) | 2015-06-03 | 2016-12-08 | Bristol-Myers Squibb Company | Anti-gitr antibodies for cancer diagnostics |
| US20170022284A1 (en) | 2015-07-23 | 2017-01-26 | Inhibrx Lp | Multivalent and multispecific gitr-binding fusion proteins |
| WO2017015623A2 (en) | 2015-07-23 | 2017-01-26 | Inhibrx Lp | Multivalent and multispecific gitr-binding fusion proteins |
| WO2017025918A1 (en) | 2015-08-11 | 2017-02-16 | Novartis Ag | 5-bromo-2,6-di-(lh-pyrazol-l-yl)pyrimidin-4-amine for use in the treatment of cancer |
| WO2017025610A1 (en) | 2015-08-12 | 2017-02-16 | Medimmune Limited | Gitrl fusion proteins and uses thereof |
| US20170073386A1 (en) | 2015-08-12 | 2017-03-16 | Medimmune Limited | Gitrl fusion proteins and uses thereof |
Non-Patent Citations (127)
| Title |
|---|
| "Antibody Engineering Lab Manual", SPRINGER-VERLAG |
| "Current Protocols in Molecular Biology", 1989, JOHN WILEY & SONS |
| "The Cancer Genome Atlas Pan-Cancer analysis project", NATURE GENETICS, vol. 45, 2013, pages 1113 - 1120 |
| ACHYUT ET AL., GASTROENTEROLOGY, vol. 141, no. 4, 2011, pages 1167 - 78 |
| ALEXANDROV L.B. ET AL., NATURE, vol. 500, 2013, pages 415 - 421 |
| AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| APTE ET AL., ADV. EXP. MED. BIOL., 2000, pages 277 - 88 |
| APTE ET AL., CANCER METASTASIS REV., 2006, pages 387 - 408 |
| BARBAS ET AL., PNAS, vol. 88, 1991, pages 7978 - 7982 |
| BEIDLER ET AL., J. IMMUNOL., vol. 141, 1988, pages 4053 - 4060 |
| BENNETT ET AL., J. IMMUNOL., vol. 170, 2003, pages 711 - 8 |
| BETTER ET AL., SCIENCE, vol. 240, 1988, pages 1041 - 1043 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BLANK ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 54, 2005, pages 307 - 314 |
| BLANK, C. ET AL., IMMUNOL. IMMUNOTHER., vol. 56, no. 5, 29 December 2006 (2006-12-29), pages 739 - 745 |
| BLOBE ET AL., N ENGL J MED., vol. 342, no. 18, 2000, pages 1350 - 8 |
| BOER K. ET AL., THERAPEUTIC ADVANCES IN MEDICAL ONCOLOGY, vol. 9, no. 7, 2017, pages 465 - 479 |
| BROWN ET AL., J. IMMUNOL., vol. 170, 2003, pages 1257 - 66 |
| BRUGGEMAN ET AL., EUR J IMMUNOL, vol. 21, 1991, pages 1323 - 1326 |
| BRUGGEMAN ET AL., YEAR IMMUNOL, vol. 7, 1993, pages 33 - 40 |
| BRYAN ET AL., AM J RESPIR CRIT CARE MED., vol. 165, no. 12, 2002, pages 1602 - 9 |
| CARTER ET AL., EUR. J. IMMUNOL., vol. 32, 2002, pages 634 - 43 |
| CHALMERS Z.R. ET AL., GENOME MEDICINE, vol. 9, 2017, pages 34 |
| CHEMICAL ABSTRACTS, Columbus, Ohio, US; abstract no. 1029872-29-4 |
| CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHOU ET AL., J IMMUNOL., vol. 189, no. 8, 2012, pages 3936 - 46 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| COLCHER, D. ET AL., ANN N Y ACAD SCI, vol. 880, 1999, pages 263 - 80 |
| COLLINS ET AL., GENOME BIOL., vol. 6, 2005, pages 223.1 - 223.7 |
| COYLE ET AL., NATURE IMMUNOL., vol. 2, no. 3, 2001, pages 203 - 209 |
| DIENER ET AL., LAB INVEST., vol. 89, no. 2, 2009, pages 142 - 51 |
| DIETMAIER; HOFSTADTER, LAB INVEST, vol. 81, 2001, pages 1453 - 1456 |
| DINARELLO, EUR. J. IMMUNOL., 2010, pages 599 - 606 |
| DONG ET AL., IMMUNOLOG. RES., vol. 28, no. 1, 2003, pages 39 - 48 |
| DONG ET AL., J. MOL. MED., vol. 81, 2003, pages 281 - 7 |
| DONG ET AL., NAT. MED., vol. 8, 2002, pages 787 - 9 |
| DONKOR ET AL., IMMUNITY., vol. 35, no. 1, 2011, pages 123 - 34 |
| E. MEYERS; W. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| FINN ET AL., BREAST CANCER RESEARCH, vol. 11, no. 5, 2009, pages R77 |
| FREEMAN ET AL., J. EXP. MED., vol. 192, 2000, pages 1027 - 34 |
| FUCHS ET AL., BIO/TECHNOLOGY, vol. 9, 1991, pages 1370 - 1372 |
| GARNER F ET AL., ANTICANCER DRUGS, vol. 26, no. 9, 2015, pages 948 - 56 |
| GARRAD ET AL., BIO/TECHNOLOGY, vol. 9, 1991, pages 1373 - 1377 |
| GRAM ET AL., PNAS, vol. 89, 1992, pages 3576 - 3580 |
| GREEN, L.L. ET AL., NATURE GENET, vol. 7, 1994, pages 13 - 21 |
| GREENWALD ET AL., ANN. REV. IMMUNOL., vol. 23, 2005, pages 515 - 548 |
| GRIFFTHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734 |
| GROSS ET AL., J. IMMUNOL., vol. 149, pages 380 - 388 |
| HAMID, O. ET AL., NEW ENGLAND JOURNAL OF MEDICINE, vol. 369, no. 2, 2013, pages 134 - 44 |
| HAWKINS ET AL., J MOL BIOL, vol. 226, 1992, pages 889 - 896 |
| HAY ET AL., HUM ANTIBOD HYBRIDOMAS, vol. 3, 1992, pages 81 - 85 |
| HOOGENBOOM ET AL., NUC ACID RES, vol. 19, 1991, pages 4133 - 4137 |
| HUGO ET AL., CELL, vol. 165, no. 1, 2016, pages 35 - 44 |
| HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| ISHIDA, Y. ET AL., EMBO J., vol. 11, 1992, pages 3887 - 3895 |
| IWAI ET AL., PROC. NAT'L. ACAD. SCI. USA, vol. 99, 2002, pages 12293 - 7 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 552 - 525 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", vol. 91, 1991, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES, pages: 3242 |
| KAWAKAMI ET AL., CURR TREAT OPTIONS ONCOL., vol. 16, no. 7, 2015, pages 30 |
| KO ET AL., J. EXP. MED., vol. 202, 2005, pages 885 - 891 |
| KONISHI ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 5094 - 100 |
| KORMAN ET AL., ADV. IMMUNOL., vol. 90, 2007, pages 297 - 339 |
| LAI A. ET AL., JOURNAL OF MEDICINAL CHEMISTRY, vol. 58, no. 12, 2015, pages 4888 - 4904 |
| LEPENIES ET AL., ENDOCRINE, METABOLIC & IMMUNE DISORDERS--DRUG TARGETS, vol. 8, 2008, pages 279 - 288 |
| LEWITT ET AL., ANNALS OF NEUROLOGY, vol. 63, no. 3, 2008, pages 295 - 302 |
| LINDLEY ET AL., IMMUNOL. REV., vol. 229, 2009, pages 307 - 321 |
| LINSLEY ET AL., IMMUNITY, vol. 4, 1996, pages 535 - 543 |
| LIU ET AL., J. IMMUNOL., vol. 139, 1987, pages 3521 - 3526 |
| LIU ET AL., PNAS, vol. 84, 1987, pages 3439 - 3443 |
| LOBUGLIO ET AL., HYBRIDOMA, vol. 5, 1986, pages 5117 - 5123 |
| LONBERG, N. ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| MAHNE ET AL., CANCER RES., vol. 77, no. 5, 2017, pages 1108 - 1118 |
| MCDONELL ET AL., JOURNAL OF MEDICINAL CHEMISTRY, vol. 58, no. 12, pages 4883 - 4887 |
| MILLER ET AL., BMC PHARMACOLOGY AND TOXICOLOGY, vol. 16, 2015, pages 18 |
| MILLER ET AL., EUR J DRUG METAB PHARMACOKINET, vol. 39, 2014, pages 173 - 181 |
| MILLER ET AL., J. IMMUNOL., 2007, pages 6933 - 42 |
| MILLER ET AL., J. IMMUNOL., pages 6933 - 42 |
| MORRISON, S. L., SCIENCE, vol. 229, 1985, pages 1202 - 1207 |
| MORRISON, S.L. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, pages 6851 - 6855 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453 |
| NEUBERT NATALIE J ET AL: "T cell-induced CSF1 promotes melanoma resistance to PD1 blockade.", SCIENCE TRANSLATIONAL MEDICINE 11 APR 2018, vol. 10, no. 436, 11 April 2018 (2018-04-11), XP002788421, ISSN: 1946-6242 * |
| NING ET AL., MOL CANCER THER., vol. 11, no. 6, 2012, pages 1353 - 64 |
| NISHIMURA ET AL., CANC. RES., vol. 47, 1987, pages 999 - 1005 |
| NOCENTINI ET AL., EUR. J. IMMUNOL., vol. 35, 2005, pages 1016 - 1022 |
| OI ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214 |
| OKAZAKI ET AL., CURR OPIN IMMUNOL, vol. 14, 2002, pages 391779 - 82 |
| PONTE J ET AL., CLINICAL IMMUNOLOGY, vol. 135, 2010, pages S96 |
| RACCOSTA L. ET AL., J. EXP. MED., pages 1711 - 1728 |
| REITER, Y., CLIN CANCER RES, vol. 2, 1996, pages 245 - 52 |
| RIELLA ET AL., AM J TRANSPLANT., vol. 12, no. 10, 2012, pages 2575 - 87 |
| ROSENBLATT, J. ET AL., J IMMUNOTHERAPY, vol. 34, no. 5, 2011, pages 409 - 18 |
| ROSS ET AL., CANCER RES, vol. 76, no. 14, 2016 |
| RYAN ET AL., CRIT REV ONCOL HEMATOL., vol. 116, 2017, pages 38 - 57 |
| S. L. HIGHFILL ET AL: "Disruption of CXCR2-Mediated MDSC Tumor Trafficking Enhances Anti-PD1 Efficacy", SCIENCE TRANSLATIONAL MEDICINE, vol. 6, no. 237, 21 May 2014 (2014-05-21), US, pages 237ra67 - 237ra67, XP055247615, ISSN: 1946-6234, DOI: 10.1126/scitranslmed.3007974 * |
| SACHDEV J C ET AL: "Phase 1/2a study of double immune suppression blockade by combining a CSF1R inhibitor (pexidartinib/PLX3397) with an anti-PD-1 antibody (pembrolizumab) to treat advanced melanoma and other solid tumors", GYNECOLOGIC ONCOLOGY, vol. 141, 2016, pages 147 - 148, XP029573344, ISSN: 0090-8258, DOI: 10.1016/J.YGYNO.2016.04.385 * |
| SALEH ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 32, 1990, pages 180 - 190 |
| SALOMONSSON E ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 286, no. 16, 2011, pages 13801 - 13804 |
| SHARPE ET AL., NATURE REV. IMMUNOL., vol. 2, 2002, pages 116 - 126 |
| SHAW ET AL., J. NATL CANCER INST., vol. 80, 1988, pages 1553 - 1559 |
| SHEVACH; STEPHENS, NAT. REV. IMMUNOL., vol. 6, 2006, pages 613 - 618 |
| SIMEONE E ET AL: "Immunomodulating antibodies in the treatment of metastatic melanoma: The experience with anti-CTLA-4, anti-CD137, and anti-PD1", JOURNAL OF IMMUNOTOXICO, TAYLOR AND FRANCIS GROUP, US, vol. 9, no. 3, 1 January 2012 (2012-01-01), pages 241 - 247, XP009181173, ISSN: 1547-691X, DOI: 10.3109/1547691X.2012.678021 * |
| STEELE C. ET AL., CANCER CELL, vol. 29, no. 6, 2016, pages 832 - 845 |
| STEELE COLIN W ET AL: "CXCR2 Inhibition Profoundly Suppresses Metastases and Augments Immunotherapy in Pancreatic Ductal Adenocarcinoma", CANCER CELL, CELL PRESS, US, vol. 29, no. 6, 2 June 2016 (2016-06-02), pages 832 - 845, XP029601429, ISSN: 1535-6108, DOI: 10.1016/J.CCELL.2016.04.014 * |
| STROMNES INGUNN M ET AL: "Pancreatic Cancer: Planning Ahead for Metastatic Spread", CANCER CELL, CELL PRESS, US, vol. 29, no. 6, 13 June 2016 (2016-06-13), pages 774 - 776, XP029601440, ISSN: 1535-6108, DOI: 10.1016/J.CCELL.2016.05.013 * |
| SUN ET AL., PNAS, vol. 84, 1987, pages 214 - 218 |
| TIAN ET AL., CELL SIGNAL., vol. 23, no. 6, 2011, pages 951 - 62 |
| TORRES-GUZMAN R ET AL., ONCOTARGET, 2017 |
| TRUTY; URRUTIA, PANCREATOLOGY, vol. 7, no. 5-6, 2007, pages 423 - 35 |
| TUAILLON ET AL., PNAS, vol. 90, 1993, pages 3720 - 3724 |
| VERHOEYAN ET AL., SCIENCE, vol. 239, 1988, pages 1534 |
| VIGLIETTA ET AL., NEUROTHERAPEUTICS, vol. 4, 2007, pages 666 - 675 |
| VORONOV ET AL., FRONT PHYSIOL., 2014, pages 114 |
| VORONOV ET AL., PROC. NATL. ACAD. SCI. U.S.A., 2003, pages 2645 - 50 |
| WAKEFIELD; HILL, NAT REV CANCER, vol. 13, no. 5, 2013, pages 328 - 41 |
| WAKEFIELD; HILL, NAT REV CANCER., vol. 13, no. 5, 2013, pages 328 - 41 |
| WANG ET AL., J. EXP. MED., vol. 208, no. 3, 2011, pages 577 - 92 |
| WILIAMS ET AL., BREAST CANCER, 2016 |
| WOJTOWICZ-PRAGA, INVEST NEW DRUGS, vol. 21, no. 1, 2003, pages 21 - 32 |
| WOOD ET AL., NATURE, vol. 314, 1985, pages 446 - 449 |
| Y. ZHU ET AL: "CSF1/CSF1R Blockade Reprograms Tumor-Infiltrating Macrophages and Improves Response to T-cell Checkpoint Immunotherapy in Pancreatic Cancer Models", CANCER RESEARCH, vol. 74, no. 18, 31 July 2014 (2014-07-31), US, pages 5057 - 5069, XP055242334, ISSN: 0008-5472, DOI: 10.1158/0008-5472.CAN-13-3723 * |
| YANA G. NAJJAR ET AL: "Myeloid-Derived Suppressor Cell Subset Accumulation in Renal Cell Carcinoma Parenchyma Is Associated with Intratumoral Expression of IL1[beta], IL8, CXCL5, and Mip-1[alpha]", CLINICAL CANCER RESEARCH, vol. 23, no. 9, 1 May 2017 (2017-05-01), US, pages 2346 - 2355, XP055547252, ISSN: 1078-0432, DOI: 10.1158/1078-0432.CCR-15-1823 * |
| YANG ET AL., TRENDS IMMUNOL., vol. 31, no. 6, 2010, pages 220 - 7 |
| ZARBOCK ET AL., BR J PHARMACOL., vol. 155, no. 3, 2008, pages 357 - 64 |
Cited By (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10570204B2 (en) | 2013-09-26 | 2020-02-25 | The Medical College Of Wisconsin, Inc. | Methods for treating hematologic cancers |
| US11708412B2 (en) | 2013-09-26 | 2023-07-25 | Novartis Ag | Methods for treating hematologic cancers |
| US10752687B2 (en) | 2014-01-24 | 2020-08-25 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US11827704B2 (en) | 2014-01-24 | 2023-11-28 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US10981990B2 (en) | 2014-01-31 | 2021-04-20 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US11155620B2 (en) | 2014-01-31 | 2021-10-26 | Novartis Ag | Method of detecting TIM-3 using antibody molecules to TIM-3 |
| US10472419B2 (en) | 2014-01-31 | 2019-11-12 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US12252535B2 (en) | 2014-03-14 | 2025-03-18 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| US11344620B2 (en) | 2014-09-13 | 2022-05-31 | Novartis Ag | Combination therapies |
| US12600777B2 (en) | 2015-07-29 | 2026-04-14 | Novartis Ag | Combination therapies comprising antibody molecules to LAG-3 |
| US11591392B2 (en) | 2016-07-14 | 2023-02-28 | Bristol-Myers Squibb Company | Antibodies against TIM3 and uses thereof |
| US12312403B2 (en) | 2016-07-14 | 2025-05-27 | Bristol-Myers Squibb Company | Antibodies against TIM3 and uses thereof |
| US11878015B2 (en) | 2017-02-14 | 2024-01-23 | Effector Therapeutics Inc. | Piperidine-substituted Mnk inhibitors and methods related thereto |
| US12129297B2 (en) | 2018-01-12 | 2024-10-29 | Bristol-Myers Squibb Company | Antibodies against TIM3 and uses thereof |
| US11673894B2 (en) | 2018-02-27 | 2023-06-13 | Incyte Corporation | Imidazopyrimidines and triazolopyrimidines as A2A / A2B inhibitors |
| US11873304B2 (en) | 2018-05-18 | 2024-01-16 | Incyte Corporation | Fused pyrimidine derivatives as A2A/A2B inhibitors |
| US11999740B2 (en) | 2018-07-05 | 2024-06-04 | Incyte Corporation | Fused pyrazine derivatives as A2A / A2B inhibitors |
| US11952375B2 (en) | 2018-10-24 | 2024-04-09 | Effector Therapeutics Inc. | Crystalline forms of Mnk inhibitors |
| US11884665B2 (en) | 2019-01-29 | 2024-01-30 | Incyte Corporation | Pyrazolopyridines and triazolopyridines as A2A / A2B inhibitors |
| WO2020239558A1 (en) * | 2019-05-24 | 2020-12-03 | Pfizer Inc. | Combination therapies using cdk inhibitors |
| JP2022534889A (ja) * | 2019-05-24 | 2022-08-04 | ファイザー・インコーポレイテッド | Cdk阻害剤を使用した組合せ療法 |
| WO2021003194A1 (en) * | 2019-07-02 | 2021-01-07 | Effector Therapeutics, Inc. | Eif4e inhibitors for use as immune checkpoint modulators and related methods |
| WO2021214623A1 (en) * | 2020-04-21 | 2021-10-28 | Novartis Ag | Dosing regimen for treating a disease modulated by csf-1r |
| RU2835316C1 (ru) * | 2020-04-21 | 2025-02-24 | Новартис Аг | Режим введения доз для лечения заболевания, модулируемого csf-1r |
| US20210393779A1 (en) * | 2020-06-18 | 2021-12-23 | Regeneron Pharmaceuticals, Inc. | Activin a antibody formulations and methods of use thereof |
| CN116322768A (zh) * | 2020-06-18 | 2023-06-23 | 里珍纳龙药品有限公司 | 激活素a抗体调配物和其使用方法 |
| US12472253B2 (en) * | 2020-06-18 | 2025-11-18 | Regeneron Pharmaceuticals, Inc. | Activin a antibody formulations and methods of use thereof |
| US12565528B2 (en) | 2020-10-23 | 2026-03-03 | Bristol-Myers Squibb Company | LAG-3 antagonist therapy for lung cancer |
| WO2022147092A1 (en) * | 2020-12-29 | 2022-07-07 | Incyte Corporation | Combination therapy comprising a2a/a2b inhibitors, pd-1/pd-l1 inhibitors, and anti-cd73 antibodies |
| EP4378460A4 (en) * | 2021-07-28 | 2025-08-06 | Tiumbio Co Ltd | PHARMACEUTICAL COMPOSITION FOR THE PREVENTION OR TREATMENT OF A TUMOR AND CORRESPONDING USE |
| WO2023164638A1 (en) * | 2022-02-25 | 2023-08-31 | Bristol-Myers Squibb Company | Combination therapy for colorectal carcinoma |
| WO2025235276A1 (en) * | 2024-05-06 | 2025-11-13 | Icahn School Of Medicine At Mount Sinai | Combination of il-1 receptor inhibitors, anti pd-1, and il-4 inhibitors in the treatment of cancer |
Also Published As
| Publication number | Publication date |
|---|---|
| TW201922291A (zh) | 2019-06-16 |
| CL2020001255A1 (es) | 2020-09-04 |
| JP2021503478A (ja) | 2021-02-12 |
| RU2020119578A (ru) | 2021-12-17 |
| EP3710053A1 (en) | 2020-09-23 |
| BR112020008888A2 (pt) | 2020-10-20 |
| CL2020003059A1 (es) | 2021-06-18 |
| IL274407A (en) | 2020-06-30 |
| AU2018368731A8 (en) | 2020-06-25 |
| AU2018368731A1 (en) | 2020-05-14 |
| KR20200089286A (ko) | 2020-07-24 |
| US20200277378A1 (en) | 2020-09-03 |
| MX2020004756A (es) | 2020-08-20 |
| CN111655288A (zh) | 2020-09-11 |
| CA3081602A1 (en) | 2019-05-23 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20200277378A1 (en) | Combination therapies | |
| EP3389712B1 (en) | Antibody molecules to pd-1 and uses thereof | |
| ES2878188T3 (es) | Terapias de combinación que comprenden moléculas de anticuerpos contra LAG-3 | |
| US20230056470A1 (en) | Uses of anti-tgf-beta antibodies and checkpoint inhibitors for the treatment of proliferative diseases | |
| US20250025583A1 (en) | Method of treatment of neuroendocrine tumors | |
| CN115380117A (zh) | 治疗表达psma的癌症的方法 | |
| US20220072166A1 (en) | Method of treatment of neuroendocrine tumors | |
| US20230338587A1 (en) | Method of treating psma-expressing cancers | |
| US20230321285A1 (en) | Method of treating psma-expressing cancers | |
| TW202313033A (zh) | 組合療法 | |
| JP2024513123A (ja) | 増殖性疾患を治療するための抗TGFβ抗体及び他の治療薬の使用 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18826126 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3081602 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2018368731 Country of ref document: AU Date of ref document: 20181116 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020527114 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20207016803 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018826126 Country of ref document: EP Effective date: 20200616 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020008888 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112020008888 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200505 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 274407 Country of ref document: IL |