WO2019084418A1 - COMPOSITIONS AND METHODS FOR THE TREATMENT OF LIVER CANCER - Google Patents
COMPOSITIONS AND METHODS FOR THE TREATMENT OF LIVER CANCERInfo
- Publication number
- WO2019084418A1 WO2019084418A1 PCT/US2018/057731 US2018057731W WO2019084418A1 WO 2019084418 A1 WO2019084418 A1 WO 2019084418A1 US 2018057731 W US2018057731 W US 2018057731W WO 2019084418 A1 WO2019084418 A1 WO 2019084418A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- pembrolizumab
- administered
- cancer
- antigen
- talimogene laherparepvec
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/76—Viruses; Subviral particles; Bacteriophages
- A61K35/763—Herpes virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5256—Virus expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/80—Vaccine for a specifically defined cancer
- A61K2039/844—Liver
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the present invention relates to the field of cancer therapeutics.
- the present invention relates to the treatment of primary or secondary hepatic cancer using a combination therapy comprising pembrohzumab, a pembrohzumab variant and/or an antigen-binding fragment thereof and talimogene laherparepvec.
- liver cancers found in the liver are not true liver cancers, but are secondary liver cancers that arose from other sites in the body that have spread to the liver (i.e., metastases). Frequently, the site of origin is the gastrointestinal tract, since the liver is close to many of these metabolically active, blood-rich organs near to blood vessels and lymph nodes (such as pancreatic cancer, stomach cancer, colon cancer and carcinoid tumors mainly of the appendix). Secondary liver cancer may also derive from metastatic cancer of the breast, the ovary, the lung, the kidney and the prostate.
- the present disclosure is based in part on the discovery that combination therapy comprising pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof and talimogene laherparepvec is useful in the treatment of a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung
- the present disclosure is also based in part on the discovery that combination therapy comprising pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof and talimogene laherparepvec is useful in the treatment of cancers such as primary and secondary hepatic cancers.
- a method of treating a cancer in a subject comprising administering to said subject talimogene laherparepvec, and pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof, wherein said cancer is selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma, is provided.
- talimogene laherparepvec is administered to the subject intratumorally, and/or pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof is administered to the subject systemically. In other exemplary embodiments, talimogene laherparepvec is administered to the subject prior to or after the administration of pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof. In other exemplary embodiments, talimogene laherparepvec is administered to the subject prior to the administration of pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses.
- pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof is administered sequentially as an initial dose followed by one or more secondary doses.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses, and wherein pembrolizumab, a pembrolizumab variant or the antigen- binding fragment thereof is administered sequentially and concomitantly with one or more secondary doses of talimogene laherparepvec.
- talimogene laherparepvec is administered intratumorally and wherein pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof is administered systemically. In other exemplary embodiments, talimogene laherparepvec and pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof are administered intratumorally.
- a reduction in size of the injected tumor occurs after administering talimogene laherparepvec and pembrolizumab, a pembrolizumab variant or the antigen- binding fragment thereof.
- a method of treating a primary or a secondary hepatic cancer in a subject comprising administering talimogene laherparepvec to the subject, and administering pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof to the subject, is provided.
- the primary hepatic cancer is a primary hepatocellular carcinoma
- the secondary hepatic cancer is a metastasis of a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- talimogene laherparepvec is administered to the subject intratumorally, and/or pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof is administered to the subject systemically. In other exemplary embodiments, talimogene laherparepvec is administered to the subject prior to or after the administration of pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof. In other exemplary embodiments, talimogene laherparepvec is administered to the subject prior to the administration of pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses.
- pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof is administered sequentially as an initial dose followed by one or more secondary doses.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses, and wherein pembrolizumab, a pembrolizumab variant or the antigen- binding fragment thereof is administered sequentially and concomitantly with one or more secondary doses of talimogene laherparepvec.
- talimogene laherparepvec is administered intratumorally and wherein pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof is administered systemically. In other exemplary embodiments, talimogene laherparepvec and pembrolizumab, a pembrolizumab variant or the antigen-binding fragment thereof are administered intratumorally.
- a reduction in size of the injected tumor occurs after administering talimogene laherparepvec and pembrolizumab, a pembrolizumab variant or the antigen- binding fragment thereof.
- a method of treating a cancer in a subject that is poorly responsive to standard of care systemic anti-cancer therapy comprising administering to said subject talimogene laherparepvec, and pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof, wherein the standard of care systemic anti-cancer therapy does not comprise talimogene laherparepvec / pembrolizumab combination therapy, and wherein said cancer is selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squam
- talimogene laherparepvec is administered to the subject intratumorally and/or the pembrolizumab variant, or the antigen-binding fragment thereof is administered to the subject systemically.
- a method of treating a primary or a secondary hepatic cancer in a subject that is poorly responsive to standard of care systemic anti-cancer therapy comprising administering to said subject talimogene laherparepvec, and pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof, wherein the standard of care systemic anti-cancer therapy does not comprise talimogene laherparepvec / pembrolizumab combination therapy, is provided.
- the primary hepatic cancer is a primary hepatocellular carcinoma
- the secondary hepatic cancer is a metastasis of a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- talimogene laherparepvec is administered to the subject intratumorally and/or the pembrolizumab variant, or the antigen-binding fragment thereof is administered to the subject systemically.
- a method of treating a cancer in a subject that progressed during standard of care systemic anti-cancer therapy comprising administering to said subject talimogene laherparepvec and pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof, wherein the standard of care systemic anti-cancer therapy does not comprise talimogene laherparepvec / pembrolizumab combination therapy, and wherein said cancer is selected from the group consisting of: hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma, is provided.
- talimogene laherparepvec is administered to the subject intratumorally and/or pembrolizumab, the pembrolizumab variant, or the antigen-binding fragment thereof is administered to the subject systemically.
- a method of treating a primary or a secondary hepatic cancer in a subject that progressed during standard of care systemic anti-cancer therapy comprising administering to said subject talimogene laherparepvec, and pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof, wherein the standard of care systemic anti-cancer therapy does not comprise talimogene laherparepvec / pembrolizumab combination therapy, is provided.
- the primary hepatic cancer is a primary hepatocellular carcinoma
- the secondary hepatic cancer is a metastasis of a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- talimogene laherparepvec is administered to the subject intratumorally and/or pembrolizumab, the pembrolizumab variant, or the antigen-binding fragment thereof is administered to the subject systemically.
- a method of treating a cancer in a subject that is resistant to standard of care systemic anti-cancer therapy comprising administering to said subject talimogene laherparepvec, and pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof, wherein standard of care systemic anti-cancer therapy does not comprise talimogene laherparepvec / pembrolizumab combination therapy, and wherein said cancer is selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma, is provided.
- talimogene laherparepvec is administered to the subject intratumorally and/or pembrolizumab, the pembrolizumab variant, or the antigen-binding fragment thereof is administered to the subject systemically.
- a method of treating a primary or a secondary hepatic cancer in a subject that is resistant to standard of care systemic anti-cancer therapy comprising administering to said subject talimogene laherparepvec, and pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof, wherein standard of care systemic anti-cancer therapy does not comprise talimogene laherparepvec / pembrolizumab combination therapy, is provided.
- the primary hepatic cancer is a primary hepatocellular carcinoma
- the secondary hepatic cancer is a metastasis of a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- talimogene laherparepvec is administered to the subject intratumorally and/or pembrolizumab, the pembrolizumab variant, or the antigen-binding fragment thereof is administered to the subject systemically.
- a method of treating a cancer in a subject comprising administering to said subject talimogene laherparepvec intratumorally as an initial dose followed by one or more secondary doses, and pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof systemically as an initial dose followed by one or more secondary doses, is provided.
- the secondary doses are administered every three weeks (Q3W).
- the initial dose of talimogene laherparepvec is administered on day 1 of week 1 and a secondary dose of talimogene laherparepvec is administered on day 1 of week 4, on day 1 of week 7, and Q3W thereafter.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 4 and a secondary dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 7 and Q3W thereafter.
- the initial dose of talimogene laherparepvec is administered at a dose of 10 6 plaque forming units (PFU)/mL and the secondary doses of talimogene laherparepvec are administered at a dose of 10 7 or 10 8 PFU/mL.
- PFU plaque forming units
- the initial dose and the secondary doses are up to about 4 mL or about 8 mL. In certain exemplary embodiments, the initial dose and/or the secondary doses are each up to about 4 mL. In certain exemplary embodiments, the initial dose and/or the secondary doses are each up to about 8 mL.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered at a dose of about 200 mg and the secondary doses of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof are administered at a dose of about 200 mg.
- a method of treating a primary or a secondary hepatic cancer in a subject comprising administering to said subject talimogene laherparepvec intratumorally as an initial dose followed by one or more secondary doses, and pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof systemically as an initial dose followed by one or more secondary doses, is provided.
- the secondary doses are administered every three weeks (Q3W).
- the initial dose of talimogene laherparepvec is administered on day 1 of week 1 and a secondary dose of talimogene laherparepvec is administered on day 1 of week 4, on day 1 of week 7, and Q3W thereafter.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 4 and a secondary dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 7 and Q3W thereafter.
- the initial dose of talimogene laherparepvec is administered at a dose of 10 6 plaque forming units (PFU)/mL and the secondary doses of talimogene laherparepvec are administered at a dose of 10 7 or 10 8 PFU/mL.
- PFU plaque forming units
- the initial dose and the secondary doses are up to about 4 mL or about 8 mL. In certain exemplary embodiments, the initial dose and/or the secondary doses are each up to about 4 mL. In certain exemplary embodiments, the initial dose and/or the secondary doses are each up to about 8 mL.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered at a dose of about 200 mg and the secondary doses of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof are administered at a dose of about 200 mg.
- talimogene laherparepvec for use in treating a cancer in a subject in combination with pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof, wherein said cancer is selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- talimogene laherparepvec is administered to the subject intratumorally.
- pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof is administered to the subject systemically.
- talimogene laherparepvec is administered to the subject prior or after to the administration of pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof.
- talimogene laherparepvec is administered to the subject prior to the administration of pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof.
- a reduction in size of the injected tumor occurs after administering talimogene laherparepvec and pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses.
- pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof is administered sequentially as an initial dose followed by one or more secondary doses.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses, and wherein pembrolizumab, the pembrolizumab variant or the antigen- binding fragment thereof is administered sequentially and concomitantly with one or more secondary doses of talimogene laherparepvec.
- talimogene laherparepvec is administered intratumorally and wherein pembrolizumab, the pembrohzumab variant or the antigen- binding fragment thereof is administered systemically. In certain exemplary embodiments, talimogene laherparepvec and pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof are administered intratumorally.
- the secondary doses are administered Q3W.
- the initial dose of talimogene laherparepvec is administered on day 1 of week 1 and a secondary dose of talimogene laherparepvec is administered on day 1 of week 4, on day 1 of week 7, and Q3W thereafter.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 4 and a secondary dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 7 and Q3W thereafter.
- the initial dose of talimogene laherparepvec is administered at a dose of 10 6 PFU/mL and the secondary doses of talimogene laherparepvec are administered at a dose of 10 7 or 10 8 PFU/mL.
- the initial dose and the secondary doses are up to about 4 niL or about 8 mL.
- the initial dose and/or the secondary doses are each up to about 4 mL.
- the initial dose and/or the secondary doses are each up to about 8 mL.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen- binding fragment thereof is administered at a dose of about 200 mg and the secondary doses of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof are administered at a dose of about 200 mg.
- pembrolizumab for use in treating a cancer in a subject in combination with talimogene laherparepvec, wherein said cancer is selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- said cancer is selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- talimogene laherparepvec is administered to the subject intratumorally.
- pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof is administered to the subject systemically.
- talimogene laherparepvec is administered to the subject prior or after to the administration of pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof.
- talimogene laherparepvec is administered to the subject prior to the administration of pembrohzumab, the pembrohzumab variant or the antigen-binding fragment thereof.
- a reduction in size of the injected tumor occurs after administering talimogene laherparepvec and pembrohzumab, the pembrohzumab variant or the antigen-binding fragment thereof.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses.
- pembrohzumab, the pembrohzumab variant or the antigen-binding fragment thereof is administered sequentially as an initial dose followed by one or more secondary doses.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses, and wherein pembrohzumab, the pembrohzumab variant or the antigen- binding fragment thereof is administered sequentially and concomitantly with one or more secondary doses of talimogene laherparepvec.
- talimogene laherparepvec is administered intratumorally and wherein pembrohzumab, the pembrohzumab variant or the antigen- binding fragment thereof is administered systemically. In certain exemplary embodiments, talimogene laherparepvec and pembrolizumab, the pembrohzumab variant or the antigen-binding fragment thereof are administered intratumorally.
- the secondary doses are administered Q3W.
- the initial dose of talimogene laherparepvec is administered on day 1 of week 1 and a secondary dose of talimogene laherparepvec is administered on day 1 of week 4, on day 1 of week 7, and Q3W thereafter.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 4 and a secondary dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 7 and Q3W thereafter.
- the initial dose of talimogene laherparepvec is administered at a dose of 10 6 PFU/mL and the secondary doses of talimogene laherparepvec are administered at a dose of 10 7 or 10 8 PFU/mL.
- the initial dose and the secondary doses are up to about 4 niL or about 8 mL.
- the initial dose and/or the secondary doses are each up to about 4 mL.
- the initial dose and/or the secondary doses are each up to about 8 mL.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen- binding fragment thereof is administered at a dose of about 200 mg and the secondary doses of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof are administered at a dose of about 200 mg.
- talimogene laherparepvec is provided for use in treating a primary or a secondary hepatic cancer in a subject in combination with pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof.
- the primary hepatic cancer is an HCC or the secondary hepatic cancer is a metastasis of a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- talimogene laherparepvec is administered to the subject intratumorally.
- pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof is administered to the subject systemically.
- talimogene laherparepvec is administered to the subject prior to or after the administration of pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof.
- talimogene laherparepvec is administered to the subject prior to the administration of pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof.
- a reduction in size of the injected tumor occurs after administering talimogene laherparepvec and pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses.
- pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof is administered sequentially as an initial dose followed by one or more secondary doses.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses, and wherein pembrolizumab, the pembrolizumab variant or the antigen- binding fragment thereof is administered sequentially and concomitantly with one or more secondary doses of talimogene laherparepvec.
- talimogene laherparepvec is administered intratumorally and wherein pembrolizumab, the pembrolizumab variant or the antigen- binding fragment thereof is administered systemically. In certain exemplary embodiments, talimogene laherparepvec and pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof are administered intratumorally.
- the secondary doses are administered Q3W.
- the initial dose of talimogene laherparepvec is administered on day 1 of week 1 and a secondary dose of talimogene laherparepvec is administered on day 1 of week 4, on day 1 of week 7, and Q3W thereafter.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 4 and a secondary dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 7 and Q3W thereafter.
- the initial dose of talimogene laherparepvec is administered at a dose of 10 6 PFU/mL and the secondary doses of talimogene laherparepvec are administered at a dose of 10 7 or 10 8 PFU/mL.
- the initial dose and the secondary doses are up to about 4 niL or about 8 mL.
- the initial dose and/or the secondary doses are each up to about 4 mL.
- the initial dose and/or the secondary doses are each up to about 8 mL.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen- binding fragment thereof is administered at a dose of about 200 mg and the secondary doses of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof are administered at a dose of about 200 mg.
- pembrolizumab in another aspect, pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof is provided for use in treating a primary or a secondary hepatic cancer in a subject in combination with talimogene laherparepvec.
- the primary hepatic cancer is an HCC or the secondary hepatic cancer is a metastasis of a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- talimogene laherparepvec is administered to the subject intratumorally.
- pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof is administered to the subject systemically.
- talimogene laherparepvec is administered to the subject prior to or after the administration of pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof.
- talimogene laherparepvec is administered to the subject prior to the administration of pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof.
- a reduction in size of the injected tumor occurs after administering talimogene laherparepvec and pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses.
- pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof is administered sequentially as an initial dose followed by one or more secondary doses.
- talimogene laherparepvec is administered sequentially as an initial dose followed by one or more secondary doses, and wherein pembrolizumab, the pembrolizumab variant or the antigen- binding fragment thereof is administered sequentially and concomitantly with one or more secondary doses of talimogene laherparepvec.
- talimogene laherparepvec is administered intratumorally and wherein pembrolizumab, the pembrolizumab variant or the antigen- binding fragment thereof is administered systemically. In certain exemplary embodiments, talimogene laherparepvec and pembrolizumab, the pembrolizumab variant or the antigen-binding fragment thereof are administered intratumorally.
- the secondary doses are administered Q3W.
- the initial dose of talimogene laherparepvec is administered on day 1 of week 1 and a secondary dose of talimogene laherparepvec is administered on day 1 of week 4, on day 1 of week 7, and Q3W thereafter.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 4 and a secondary dose of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof is administered on day 1 of week 7 and Q3W thereafter.
- the initial dose of talimogene laherparepvec is administered at a dose of 10 6 PFU/mL and the secondary doses of talimogene laherparepvec are administered at a dose of 10 7 or 10 8 PFU/mL.
- the initial dose and the secondary doses are up to about 4 niL or about 8 mL.
- the initial dose and/or the secondary doses are each up to about 4 mL.
- the initial dose and/or the secondary doses are each up to about 8 mL.
- the initial dose of pembrolizumab, pembrolizumab variant or antigen- binding fragment thereof is administered at a dose of about 200 mg and the secondary doses of pembrolizumab, pembrolizumab variant or antigen-binding fragment thereof are administered at a dose of about 200 mg.
- Figure 1 depicts study design and treatment schema for Part 1, Group A, showing talimogene laherparepvec monotherapy cohorts and talimogene laherparepvec plus pembrolizumab combination therapy cohorts.
- DLT dose-limiting toxicity
- HCC hepatocellular carcinoma
- MTC maximum tolerated concentration
- MTV maximum tolerated volume
- PFU plaque forming unit
- T-VEC talimogene laherparepvec.
- a First dose concentration of talimogene laherparepvec is always 10 6 PFU/mL.
- Figure 2 depicts study design and treatment schema for Part 1, Group B, showing talimogene laherparepvec monotherapy cohorts and talimogene laherparepvec plus pembrolizumab combination therapy cohorts.
- DLT dose-limiting toxicity
- HCC hepatocellular carcinoma
- MTC maximum tolerated concentration
- MTV maximum tolerated volume
- PFU plaque forming unit
- T-VEC talimogene laherparepvec.
- a First dose concentration of talimogene laherparepvec is always 10 6 PFU/mL.
- FIG. 3 depicts study design and treatment schema for Part 2 to assess efficacy of combination therapy in seven tumor types: primary hepatocellular carcinoma (HCC); breast adenocarcinoma (BC) with liver metastases; colorectal adenocarcinoma (CRC) with liver metastases; gastroesophageal cancer (GEC) (adenocarcinoma or squamous cell carcinoma) with liver metastases; melanoma with liver metastases; non-small cell lung cancer (NSCLC) with liver metastases; and clear cell renal cell carcinoma (RCC) with liver metastases.
- HCC primary hepatocellular carcinoma
- BC breast adenocarcinoma
- CRC colorectal adenocarcinoma
- GEC gastroesophageal cancer
- NSCLC non-small cell lung cancer
- RCC clear cell renal cell carcinoma
- T-VEC talimogene laherparepvec.
- administering refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid.
- Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell.
- administering and “treatment” also means in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding compound, or by another cell.
- antibody refers to any form of antibody that exhibits the desired biological or binding activity. Thus, it is used in the broadest sense and specifically covers, but is not limited to, monoclonal antibodies (including full-length monoclonal antibodies), polyclonal antibodies, multi-specific antibodies (e.g., bispecific antibodies), humanized antibodies, fully human antibodies, chimeric antibodies and camelized single domain antibodies.
- Monoclonal antibodies including full-length monoclonal antibodies
- polyclonal antibodies include multi-specific antibodies (e.g., bispecific antibodies), humanized antibodies, fully human antibodies, chimeric antibodies and camelized single domain antibodies.
- Parental antibodies are antibodies obtained by exposure of an immune system to an antigen prior to modification of the antibodies for an intended use, such as humanization of an antibody for use as a human therapeutic.
- the basic antibody structural unit comprises a tetramer.
- Each tetramer includes two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy” chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function.
- human light chains are classified as kappa and lambda light chains.
- human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)).
- variable regions of each light/heavy chain pair form the antibody binding site.
- an intact antibody has two binding sites.
- the two binding sites are, in general, the same.
- variable regions or “V region” as used herein means the segment of IgG chains which is variable in sequence between different antibodies. It extends to Kabat residue 109 in the light chain and 113 in the heavy chain.
- variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), which are located within relatively conserved framework regions (FR). The CDRs are usually aligned by the framework regions, enabling binding to a specific epitope.
- CDRs complementarity determining regions
- FR3 relatively conserved framework regions
- hypervariable region refers to the amino acid residues of an antibody that are responsible for antigen-binding.
- the hypervariable region comprises amino acid residues from a CDR (i.e. LCDR1, LCDR2 and LCDR3 in the light chain variable domain and HCDR1, HCDR2 and HCDR3 in the heavy chain variable domain).
- CDR i.e. LCDR1, LCDR2 and LCDR3 in the light chain variable domain
- HCDR1, HCDR2 and HCDR3 in the heavy chain variable domain.
- antibody fragment or "antigen-binding fragment” refers to antigen-binding fragments of antibodies, i.e., antibody fragments that retain the ability to bind specifically to the antigen bound by the full-length antibody, e.g. fragments that retain one or more CDR regions.
- antibody binding fragments include, but are not limited to, Fab, Fab', ⁇ ( ⁇ 2, and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules, e.g., sc-Fv; nanobodies and multi-specific antibodies formed from antibody fragments.
- An antibody that "specifically binds to" a specified target protein is an antibody that exhibits preferential binding to that target as compared to other proteins, but this specificity does not require absolute binding specificity.
- An antibody is considered “specific” for its intended target if its binding is determinative of the presence of the target protein in a sample, e.g., without producing undesired results such as false positives.
- Antibodies, or binding fragments thereof, useful in the present invention will bind to the target protein with an affinity that is at least two-fold greater, preferably at least ten times greater, more preferably at least 20 times greater, and most preferably at least 100 times greater than the affinity with non-target proteins.
- an antibody is said to bind specifically to a polypeptide comprising a given amino acid sequence, e.g. the amino acid sequence of a mature human PD-1 or human PD-L1 molecule, if it binds to polypeptides comprising that sequence but does not bind to proteins lacking that sequence.
- Chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in an antibody derived from a particular species (e.g., human) or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in an antibody derived from another species (e.g., mouse) or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
- a particular species e.g., human
- another species e.g., mouse
- Human antibody refers to an antibody that comprises human immunoglobulin protein sequences only.
- a human antibody may contain murine carbohydrate chains if produced in a mouse, in a mouse cell, or in a hybridoma derived from a mouse cell.
- mouse antibody or rat antibody refer to an antibody that comprises only mouse or rat immunoglobulin sequences, respectively.
- Humanized antibody refers to forms of antibodies that contain sequences from non-human (e.g., murine) antibodies as well as human antibodies. Such antibodies contain minimal sequence derived from non-human immunoglobulin.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
- the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- the prefix "hum,” “hu” or “h” is added to antibody clone designations when necessary to distinguish humanized antibodies from parental rodent antibodies.
- the humanized forms of rodent antibodies will generally comprise the same CDR sequences of the parental rodent antibodies, although certain amino acid substitutions may be included to increase affinity, increase stability of the humanized antibody, or for other reasons.
- Biotherapeutic agent means a biological molecule, such as an antibody, that blocks ligand/receptor signaling in any biological pathway that supports tumor maintenance and/or growth or suppresses the anti-tumor immune response.
- cancer refers to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
- hepatic cancers that are responsive to talimogene laherparepvec / pembrolizumab combination therapy are primary hepatic cancers and secondary hepatic cancers caused by metastasis of a non-primary hepatic cancer.
- Primary hepatic cancers include, but are not limited to, hepatocellular carcinoma (HCC), bile duct cancer, fibrolamellar HCC, hemangiosarcoma, angiosarcoma and hepatoblastoma.
- HCC hepatocellular carcinoma
- bile duct cancer fibrolamellar HCC
- hemangiosarcoma hemangiosarcoma
- angiosarcoma hepatoblastoma
- a primary hepatic tumor is HCC.
- Secondary hepatic cancers are caused by a metastasis of one or more cancer types that include, but are not limited to, hepatocellular carcinoma, breast cancer (e.g., endocrine receptor positive (ER+) breast cancer, HER2 positive (HER2+) breast cancer, triple-negative breast cancer, triple positive breast cancer and the like), colon cancer, colorectal cancer, kidney cancer, esophageal cancer, lung cancer (e.g., non-small cell lung cancer, small cell lung cancer), melanoma (including uveal melanoma), ovarian cancer, uterine cancer, pancreatic cancer and stomach cancer.
- breast cancer e.g., endocrine receptor positive (ER+) breast cancer, HER2 positive (HER2+) breast cancer, triple-negative breast cancer, triple positive breast cancer and the like
- colon cancer colorectal cancer
- kidney cancer e.g., esophageal cancer
- lung cancer e.g., non-small cell lung cancer, small cell lung
- a secondary hepatic tumor is caused by a metastasis of hepatocellular carcinoma, breast adenocarcinoma (BC), colorectal adenocarcinoma (CRC), gastroesophageal (GEC) adenocarcinoma, GEC squamous cell carcinoma (SCC), melanoma (including uveal melanoma), non- small cell lung cancer (NSCLC), or clear cell renal cell carcinoma (RCC).
- BC breast adenocarcinoma
- CRC colorectal adenocarcinoma
- GEC gastroesophageal
- SCC GEC squamous cell carcinoma
- SCC GEC squamous cell carcinoma
- melanoma including uveal melanoma
- NSCLC non- small cell lung cancer
- RRCC clear cell renal cell carcinoma
- CDR or “CDRs” as used herein means complementarity determining region(s) in an immunoglobulin variable region, defined using the Kabat numbering system, unless otherwise indicated.
- “Chemotherapeutic agent” is a chemical compound useful in the treatment of cancer.
- Classes of chemotherapeutic agents include, but are not limited to: alkylating agents, antimetabolites, kinase inhibitors, spindle poison plant alkaloids, cytotoxic/antitumor antibiotics, topoisomerase inhibitors, photosensitizers, anti-estrogens and selective estrogen receptor modulators (SERMs), anti- progesterones, estrogen receptor down-regulators (ERDs), estrogen receptor antagonists, leutinizing hormone-releasing hormone agonists, anti-androgens, aromatase inhibitors, EGFR inhibitors, VEGF inhibitors, anti-sense oligonucleotides that inhibit expression of genes implicated in abnormal cell proliferation or tumor growth.
- Chemotherapeutic agents useful in the treatment methods of the present invention include cytostatic and/or cytotoxic agents.
- Chothia as used herein means an antibody numbering system described in Al-Lazikani et al., JMB 273 :927-948 (1997), incorporated by reference herein.
- Constantly modified variants or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering (or substantially altering) the biological activity or other desired property of the protein, such as antigen affinity and/or specificity.
- Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene, The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.)).
- substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity.
- Framework region or "FR” as used herein means the immunoglobulin variable regions excluding the CDR regions.
- Homology refers to sequence similarity between two polypeptide sequences when they are optimally aligned.
- a position in both of the two compared sequences is occupied by the same amino acid monomer subunit, e.g., if a position in a light chain CDR of two different Abs is occupied by alanine, then the two Abs are homologous at that position.
- the percent of homology is the number of homologous positions shared by the two sequences divided by the total number of positions compared x lOO. For example, if 8 of 10 of the positions in two sequences are matched or homologous when the sequences are optimally aligned then the two sequences are 80% homologous.
- the comparison is made when two sequences are aligned to give maximum percent homology.
- the comparison can be performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences.
- BLAST ALGORITHMS Altschul, S. F., et al., (1990) J. Mol. Biol. 215:403-410; Gish, W., et al., (1993) Nature Genet. 3 :266-272; Madden, T. L., et al., (1996) Meth. Enzymol. 266: 131-141; Altschul, S. F., et al., (1997) Nucleic Acids Res. 25 :3389-3402; Zhang, J., et al., (1997) Genome Res. 7:649- 656; Wootton, J.
- isolated antibody and “isolated antibody fragment” refers to the purification status and in such context means the named molecule is substantially free of other biological molecules such as nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth media. Generally, the term “isolated” is not intended to refer to a complete absence of such material or to an absence of water, buffers, or salts, unless they are present in amounts that substantially interfere with experimental or therapeutic use of the binding compound as described herein.
- Kabat as used herein means an immunoglobulin alignment and numbering system pioneered by Elvin A. Kabat ((1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.).
- conventional (polyclonal) antibody preparations typically include a multitude of different antibodies having different amino acid sequences in their variable domains, particularly their CDRs, which are often specific for different epitopes.
- the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256: 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567).
- the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature 352: 624-628 and Marks et al. (1991) J. Mol. Biol. 222: 581-597, for example. See also Presta (2005) J. Allergy Clin. Immunol. 116:731.
- Interferon gamma and "IFNy” (also called immune or type II interferon), refers to a pleiotropic cytokine involved in the regulation of nearly all phases of immune and inflammatory responses, including the activation, growth and differentiation of T-cells, B-cells, macrophages, NK cells and other cell types such as endothelial cells and fibroblasts. IFNy enhances MHC expression on antigen-presenting cells, and also plays an important role in activating lymphocytes to enhance antitumor effects.
- IFNy can contribute to the containment of tumor progression and growth by increasing tumor antigen presentation to tumor-specific T-cells and increasing susceptibility to NK cytotoxicity. In addition to promoting an immune response to the tumor, IFN ⁇ y can also induce expression of tumor suppressing factors.
- Genetically modified oncolytic virus refers to an oncolytic virus that has been modified as compared to a wild-type version of the virus, typically to remove and/or insert one or more genes.
- HSV-1 (strain JSl) ICP34.5-/ICP47-/hGM-CSF (previously known as OncoVex GM"CSF ), is an intratumorally delivered oncolytic immunotherapy comprising an immune-enhanced HSV-1 that selectively replicates in solid tumors.
- the HSV-1 was derived from Strain JSl as deposited at the European collection of cell cultures (ECAAC) under accession number 01010209.
- the HSV-1 viral genes encoding ICP34.5 have been functionally deleted. Functional deletion of ICP34.5, which acts as a virulence factor during HSV infection, limits replication in non-dividing cells and renders the virus non-pathogenic.
- the HSV-1 viral gene encoding ICP47 (which blocks viral antigen presentation to major histocompatibility complex class I and II molecules) has been functionally deleted. Functional deletion of ICP47 also leads to earlier expression of US 11, a gene that promotes virus growth in tumor cells without decreasing tumor selectivity.
- GM-CSF a cytokine involved in the stimulation of immune responses
- the insertion of the gene encoding human GM-CSF is such that it replaces nearly all of the ICP34.5 gene, ensuring that any potential recombination event between talimogene laherparepvec and wild-type virus could only result in a disabled, non-pathogenic virus and could not result in the generation of wild-type virus carrying the gene for human GM-CSF.
- TK thymidine kinase
- CTLA-4 cytotoxic T-cell associated- antigen 4
- Talimogene laherparepvec (IMLYGIC®) was approved as a monotherapy treatment for metastatic melanoma in the U.S., European Union, and Australia in 2015.
- OPTiM a multicenter, phase 3 clinical trial that enrolled patients with metastatic melanoma that could not be surgically removed, patients who received talimogene laherparepvec were significantly more likely to experience a durable response compared with patients who received the comparator therapy, GM- CSF.
- GM- CSF GM- CSF.
- Talimogene laherparepvec produces a direct oncolytic effect by replication of the virus in the tumor, and induction of an anti-tumor immune response enhanced by the local expression of GM- CSF.
- Intended clinical effects include, but are not limited to, the destruction of injected tumors; the destruction of local, local-regional, and distant uninjected tumors; a reduction in the development of new metastases; a reduction in the rate of overall progression; and prolonged overall survival.
- Talimogene laherparepvec has been tested for efficacy in a variety of in vitro (cell line) and in vivo murine tumor models and has been shown to eradicate tumors or substantially inhibit their growth at doses comparable to those used in clinical studies. Non-clinical evaluation has also confirmed that GM-CSF enhances the immune response generated, enhancing both injected and uninjected tumor responses, and that increased surface levels of MHC class I molecules result from the deletion of ICP47. Talimogene laherparepvec has been injected into normal and tumor-bearing mice to assess its safety. In general, the virus has been well tolerated, and doses up to 1 x 10 8 PFU/dose have given no indication of any safety concerns. (See, for example, Liu et al., Gene Ther 10: 292-303, 2003).
- Talimogene laherparepvec / pembrolizumab combination therapy refers to the use of both talimogene laherparepvec and pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof to treat a cancer, e.g., a primary hepatic cancer and/or a secondary hepatic cancer.
- talimogene laherparepvec and pembrolizumab may occur simultaneously (i.e., in the same medicament), concurrently (i.e., in separate medicaments administered at the same time in any order), or sequentially in any order, as described further herein.
- Oligonucleotide refers to a nucleic acid that is usually between 5 and 100 contiguous bases in length, and most frequently between 10-50, 10-40, 10-30, 10-25, 10-20, 15-50, 15-40, 15-30, 15- 25, 15-20, 20-50, 20-40, 20-30 or 20-25 contiguous bases in length.
- Patient refers to any single subject for which therapy is desired or that is participating in a clinical trial, epidemiological study or used as a control, including humans, non- human primates, mammalian veterinary patients such as cattle, horses, dogs, cats and the like, and research animals such as non-human primates, rats, mice, dogs, rabbits and the like.
- Pembrolizumab is a humanized monoclonal antibody that binds to and blocks PD-1. Pembrolizumab works by increasing the ability of the body's immune system to help detect and fight tumor cells by blocking the interaction between PD-1 and its ligands, PD-Ll and PD-L2, thereby activating T lymphocytes which may affect both tumor cells and healthy cells.
- Pembrolizumab monotherapy is known to treat melanoma, non-small cell lung cancer and squamous cell carcinoma of the head and neck in affected individuals having higher densities of baseline CD8+ T-cell infiltrations, IFNy gene signature and PD-Ll expression than levels found in non-responsive individuals.
- pembrolizumab refers to a commercially available monoclonal antibody under the proprietary name of KEYTRUDA® (Merck Sharp & Dohme Corp., Whitehouse Station, NJ), described in WO2016196173 and U.S. Pat. Nos. 8,354,509 and 8,900,587, incorporated herein by reference in their entireties for all purposes, as well as variants and antigen-binding fragments thereof.
- Pembrolizumab has been approved by the US FDA for the treatment of certain patients having melanoma, non-small cell lung cancer, head and neck squamous cell cancer, classical Hodgkin lymphoma, urothelial carcinoma, microsatellite instability-high cancer, cervical cancer, primary mediastinal B-cell lymphoma, and gastric cancer.
- Pembrolizumab can be characterized by one or any combination of the heavy chain domain, light chain domain, heavy chain variable domain, light chain variable domain, heavy chain complementarity-determining and light chain complementarity- determining sequences described Infra.
- Pembrolizumab can comprise a heavy chain sequence set forth as QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTN FNEKFKNRVTLTTD S STTTAYMELKSLQFDDTA VYYC ARRD YRFDMGFD YWGQGTT VTVS S ASTKGPS PLAPCSRSTSESTAALGCLVKOYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVW SSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP KDTLMISRTPEVTCWVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTV LHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK GFYPSDIAVEWESNGQ
- Pembrolizumab can comprise a heavy chain variable (VH) domain sequence set forth as
- ARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIK (SEQ ID NO:4).
- Pembrolizumab can comprise the following heavy chain complementarity-determining regions (HCDRs): NYYMY (HCDR1, SEQ ID NO:5); GINPSNGGTNFN (HCDR2, SEQ ID NO:6); and RD YRFDMGFD Y (HCDR3, SEQ ID NO:7).
- HCDRs heavy chain complementarity-determining regions
- Pembrolizumab can comprise the following light chain complementarity-determining regions (LCDRs): RASKGVSTSGYSYLH (LCDR1, SEQ ID NO:8); LASYLES (LCDR2, SEQ ID NO:9); and QHSRDLPLT (LCDR3, SEQ ID NO: 10).
- LCDRs light chain complementarity-determining regions
- pembrolizumab a pembrolizumab variant or an antigen-binding fragment thereof is provided comprising heavy chain CDRs SEQ ID NOs: 5, 6 and 7 and light chain CDRs of SEQ ID NOs: 8, 9 and 10.
- pembrolizumab comprising heavy chain and light chain CDR sequences from a VH/VL sequence pair of SEQ ID NO:3 and SEQ ID NO:4.
- pembrolizumab comprising a heavy chain variable region comprising SEQ ID NO:3 or a variant thereof and/or a light chain variable region comprising SEQ ID NO:4 or a variant thereof.
- the pembrolizumab variant or antigen-binding fragment thereof comprises a heavy chain variable region comprising as sequence with at least 80% sequence homology or identity (e.g., 80%, 85%, 90%, 95%, 98% or 99%) to SEQ ID NO:3 and/or a light chain variable region comprising a sequence with at least 80% sequence homology or identity (e.g., 80%, 85%, 90%, 95%, 98% or 99%) to SEQ ID NO:4.
- a "variant of a heavy chain variable region sequence” is a sequence that is identical to the reference sequence, except having up to 17 conservative amino acid substitutions in the framework region (i.e., outside of the CDRs), and preferably having fewer than ten, nine, eight, seven, six or five conservative amino acid substitutions in the framework region.
- a "variant of a light chain variable region sequence” is a sequence that is identical to the reference sequence, except having up to five conservative amino acid substitutions in the framework region (i.e., outside of the CDRs), and preferably having fewer than four, three or two conservative amino acid substitutions in the framework region.
- pembrolizumab comprising a heavy chain comprising SEQ ID NO: l or a variant thereof and/or a light chain comprising SEQ ID NO: 2 or a variant thereof.
- the pembrolizumab variant or antigen-binding fragment thereof comprises a heavy chain comprising a sequence with at least 80% sequence homology or identity (e.g., 80%, 85%, 90%, 95%, 98% or 99%) to SEQ ID NO: 1 and/or a light chain comprising a sequence with at least 80% sequence homology or identity (e.g., 80%, 85%, 90%, 95%, 98% or 99%) to SEQ ID NO:2.
- a “pembrolizumab variant” refers to a monoclonal antibody which comprises heavy chain and light chain sequences that are identical to those of pembrolizumab, except for having up to five conservative amino acid substitutions in the framework region (i.e., outside of the CDRs), and preferably has less than four, three or two conservative amino acid substitution in the framework region, and having up to 17 conservative amino acid substitutions in the framework region (i.e., outside of the CDRs), and preferably has less than ten, nine, eight, seven, six or five conservative amino acid substitutions in the framework region, and preferably has less than four, three or two conservative amino acid substitution in the framework region.
- pembrolizumab and a pembrolizumab variant comprise identical CDR sequences, but differ from each other due to having a conservative amino acid substitution at no more than three or six other positions in their full-length light and heavy chain sequences, respectively.
- a pembrolizumab variant is substantially the same as or better than pembrolizumab with respect to the following properties: binding affinity to PD-1 and neutralizing effect in vivo.
- biosimilars of pembrolizumab are provided.
- the term “biosimilar” is used in a manner that is consistent with the working definition promulgated by the U.S. Food and Drug Administration, which defines a biosimilar product to be one that is "highly similar” to a reference product (despite minor differences in clinically inactive components). In practice, there can be no clinically meaningful differences between the reference product and the biosimilar product in terms of safety, purity, and potency (Public Health Service (PHS) Act ⁇ 262).
- PHS Public Health Service
- PK pharmacokinetic
- the definition of "biosimilar” is consistent with the definition used by a regulatory authority outside of the U.S.
- the term “reference product” is used to refer to commercially available pembrolizumab.
- RECIST 1.1 Response Criteria means the definitions set forth in Eisenhauer et al., E. A. et al., Eur. J Cancer 45:228-247 (2009) for target lesions or non-target lesions, as appropriate, based on the context in which response is being measured.
- sample when referring to a tumor or any other biological material referenced herein, means a sample that has been removed from the subject.
- sustained response means a sustained therapeutic effect after cessation of treatment with a therapeutic agent, or a combination therapy described herein.
- the sustained response has a duration that is at least the same as the treatment duration, or at least 1.5, 2.0, 2.5 or 3 times longer than the treatment duration.
- Standard of care systemic anti-cancer therapy refers to medically-accepted diagnostic and treatment processes that a clinician follows for a particular cancer in a particular patient that may include one or more biological therapies (e.g., immunotherapies) and/or one or more cytotoxic chemotherapies that would be readily known to one of skill in the art.
- standard of care systemic anti-cancer therapy excludes talimogene laherparepvec / pembrolizumab combination therapy.
- tissue Section refers to a single part or piece of a tissue sample, e.g., a thin slice of tissue cut from a sample of a normal tissue or of a tumor.
- Treating" or “treating" a primary or a secondary hepatic cancer as used herein means to administer pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof and talimogene laherparepvec to a subject diagnosed with a primary or a secondary hepatic cancer to achieve at least one positive therapeutic effect, such as for example, reduced number of cancer cells, reduced tumor size, reduced rate of cancer cell infiltration into peripheral organs, or reduced rate of tumor metastasis or tumor growth.
- positive therapeutic effects in cancer can be measured in a number of ways (See, W. A. Weber, J. Null. Med. 50: 1S-10S (2009); Eisenhauer et al., supra).
- response to pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof, and/or talimogene laherparepvec is assessed using RECIST 1.1 criteria.
- the treatment achieved by a therapeutically effective amount is any of a partial response (PR), a complete response (CR), progression free survival (PFS), disease free survival (DFS), objective response (OR) or overall survival (OS).
- the dosage regimen of a therapy described herein that is effective to treat a primary or a secondary hepatic cancer patient may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the therapy to elicit an anti-cancer response in the subject. While an embodiment of the treatment method, medicaments and uses of the present invention may not be effective in achieving a positive therapeutic effect in every subject, it should do so in a statistically significant number of subjects as determined by any statistical test known in the art such as the Student's t-test, the chi 2 -test, the U-test according to Mann and Whitney, the Kruskal- Wallis test (H-test), Jonckheere-Terpstra-test and the Wilcoxon-test.
- any statistical test known in the art such as the Student's t-test, the chi 2 -test, the U-test according to Mann and Whitney, the Kruskal- Wallis test (H-test), Jonckheere-Terpstra-test and the Wilcoxon
- Tumor as it applies to a subject diagnosed with, or suspected of having, a primary or a secondary hepatic cancer, refers to a malignant or potentially malignant neoplasm or tissue mass of any size.
- a solid tumor is an abnormal growth or mass of tissue that usually does not contain cysts or liquid areas. Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors are sarcomas, carcinomas, and lymphomas. Leukemias (cancers of the blood) generally do not form solid tumors (National Cancer Institute, Dictionary of Cancer Terms).
- Tumor burden also referred to as “tumor load,” refers to the total amount of tumor material distributed throughout the body. Tumor burden refers to the total number of cancer cells or the total size of tumor(s) throughout the body, including lymph nodes and bone marrow. Tumor burden can be determined by a variety of methods known in the art, such as, e.g., by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., ultrasound, bone scan, computed tomography (CT) or magnetic resonance imaging (MRI) scans.
- CT computed tomography
- MRI magnetic resonance imaging
- tumor size refers to the total size of the tumor which can be measured as the length and width of a tumor. Tumor size may be determined by a variety of methods known in the art, such as, e.g. by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., bone scan, ultrasound, CT or MRI scans.
- imaging techniques e.g., bone scan, ultrasound, CT or MRI scans.
- the invention relates to a method for treating cancer in an individual comprising administering to the individual a combination therapy which comprises pembrolizumab, a pembrolizumab variant or antigen-binding fragment thereof, and talimogene laherparepvec.
- the combination therapy may also comprise one or more additional therapeutic agents.
- the additional therapeutic agent may be, e.g., a chemotherapeutic agent, a biotherapeutic agent, an immunogenic agent (for example, attenuated cancerous cells, tumor antigens, antigen presenting cells such as dendritic cells pulsed with tumor derived antigen or nucleic acids, immune stimulating cytokines (for example, IL-2, IFNa2, GM-CSF), and cells transfected with genes encoding immune stimulating cytokines such as but not limited to GM-CSF).
- the specific dosage and dosage schedule of the additional therapeutic agent can further vary, and the optimal dose, dosing schedule and route of administration will be determined based upon the specific therapeutic agent that is being used.
- chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziri dines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; cally statin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duo
- calicheamicin especially calicheamicin gammall and calicheamicin phill, see, e.g., Agnew, Chem. Intl. Ed. Engl., 33 : 183-186 (1994); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromomophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6- diazo-5-oxo-L-norleucine, doxorubicin (including mo ⁇ holino- doxorubicin,
- T-2 toxin verracurin A, roridin A and anguidine
- urethan vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide; thiotepa; taxoids, e.g.
- paclitaxel and doxetaxel paclitaxel and doxetaxel; chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylormthine (DMFO); retinoids such as retinoic acid; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide
- anti-hormonal agents that act to regulate or inhibit hormone action on tumors
- SERMs selective estrogen receptor modulators
- tamoxifen raloxifene
- droloxifene 4-hydroxytamoxifen
- trioxifene keoxifene
- aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)- imidazoles, aminoglutethimide, megestrol acetate, exemestane, formestane, fadrozole, vorozole, letrozole, and anastrozole; and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- Each therapeutic agent in a combination therapy of the invention may be administered either alone or in a medicament (also referred to herein as a pharmaceutical composition) which comprises the therapeutic agent and one or more pharmaceutically acceptable carriers, excipients and diluents, according to standard pharmaceutical practice.
- Each therapeutic agent in a combination therapy of the invention may be administered simultaneously (i.e., in the same medicament), concurrently (i.e., in separate medicaments administered one right after the other in any order) or sequentially in any order.
- Sequential administration is particularly useful when the therapeutic agents in the combination therapy are in different dosage forms (one agent is a tablet or capsule and another agent is a sterile liquid) and/or are administered on different dosing schedules, e.g., a chemotherapeutic that is administered at least daily and a biotherapeutic that is administered less frequently, such as once weekly, once every two weeks, or once every three weeks and/or are administered to different parts of the body, e.g., one therapeutic agent is administered intratumorally and one therapeutic agent is administered systemically.
- talimogene laherparepvec is administered before administration of pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof. In other embodiments, talimogene laherparepvec is administered after administration of pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof. In other embodiments, talimogene laherparepvec is administered concurrently with pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof.
- At least one of the therapeutic agents in the combination therapy is administered using the same dosage regimen (dose, frequency and duration of treatment) that is typically employed when the agent is used as monotherapy for treating the same cancer.
- the patient receives a lower total amount of at least one of the therapeutic agents in the combination therapy than when the agent is used as monotherapy, e.g., smaller doses, less frequent doses, and/or shorter treatment duration.
- talimogene laherparepvec is administered intratumo rally.
- pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof is administered parenterally.
- a combination therapy of the invention may be used prior to or following surgery to remove a tumor and may be used prior to, during or after radiation therapy.
- a combination therapy of the invention is administered to a patient who has not been previously treated with a biotherapeutic or chemotherapeutic agent, i.e., is cancer treatment-naive.
- the combination therapy is administered to a patient who failed to achieve a sustained response after prior therapy (e.g., after failed or ineffective therapy with a systemic anti-cancer therapy that is not talimogene laherparepvec / pembrolizumab combination therapy), i.e., is cancer treatment-experienced.
- a combination therapy of the invention is typically used to treat a tumor that is large enough to be found by palpation or by imaging techniques well known in the art, such as MRI, ultrasound, or CAT scan.
- a dosage regimen for a combination therapy of the invention depends on several factors, including the serum or tissue turnover rate of the entity, the level of symptoms, the immunogenicity of the entity, and the accessibility of the target cells, tissue or organ in the individual being treated.
- a dosage regimen maximizes the amount of each therapeutic agent delivered to the patient consistent with an acceptable level of side effects.
- the dose amount and dosing frequency of each biotherapeutic and chemotherapeutic agent in the combination depends in part on the particular therapeutic agent, the severity of the cancer being treated, and patient characteristics. Guidance in selecting appropriate doses of antibodies, cytokines, and small molecules are available.
- Determination of the appropriate dosage regimen may be made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment or predicted to affect treatment, and will depend, for example, the patient's clinical history (e.g., previous therapy), the type and stage of the cancer to be treated and biomarkers of response to one or more of the therapeutic agents in the combination therapy.
- the optimal dose for pembrolizumab in combination with talimogene laherparepvec may be identified by dose escalation or dose de-escalation of one or both of these agents.
- the present invention also provides a medicament which comprises pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof as described above, and a pharmaceutically acceptable excipient for use in combination with talimogene laherparepvec for treating a primary hepatocellular carcinoma, and/or a secondary hepatic cancer such as a metastasis of a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- a secondary hepatic cancer such as a metastasis of a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcino
- a medicament comprising pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof may be provided as a liquid formulation or prepared by reconstituting a lyophilized powder with sterile water for injection prior to use.
- WO 2012/135408 describes the preparation of liquid and lyophilized medicaments comprising pembrolizumab that are suitable for use in the present invention.
- a medicament comprising pembrolizumab is provided in a glass vial which contains about 100 mg of pembrolizumab in 4 mL of solution.
- Each 1 mL of solution contains 25 mg of pembrolizumab and is formulated in: L-histidine (1.55 mg), polysorbate 80 (0.2 mg), sucrose (70 mg), and water for injection, USP.
- L-histidine 1.55 mg
- polysorbate 80 0.2 mg
- sucrose 70 mg
- water for injection USP.
- the solution requires dilution for IV infusion.
- Biotherapeutic agents in a combination therapy of the invention may be administered by continuous infusion, or by doses at intervals of, e.g., daily, every other day, three times per week, or one time each week, two weeks, three weeks, monthly, bimonthly, etc.
- a total weekly dose is generally at least 0.05 ⁇ /13 ⁇ 4, 0.2 ⁇ g/kg, 0.5 ⁇ /kg, 1 ⁇ g/kg, 10 ⁇ g/kg, 100 ⁇ /kg, 0.2 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 10 mg/kg, 25 mg/kg, 50 mg/kg body weight or more. See, e.g., Yang et al. (2003) New Engl. J. Med.
- the dosing regimen will comprise administering pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof at a dose of 1, 2, 3, 5 or 10 mg/kg at intervals of about 14 days ( ⁇ 2 days) or about 21 days ( ⁇ 2 days) or about 30 days ( ⁇ 2 days) throughout the course of treatment.
- pembrolizumab, a pembrolizumab variant or an antigen-binding fragment thereof is used at a dose of 200 mg (fixed) every 3 weeks.
- the dosing regimen will comprise administering pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof at a dose of from about 0.005 mg kg to about 10 mg/kg, with intra-patient dose escalation.
- the interval between doses will be progressively shortened, e.g., about 30 days ( ⁇ 3 days) between the first and second dose, about 21 days ( ⁇ 3 days) between the second and third doses.
- the dosing interval will be about 21 days ( ⁇ 3 days), for doses subsequent to the second dose.
- a subject will be administered a parenteral dosing, e.g., an intravenous (IV) infusion, of a medicament comprising any of pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof.
- a parenteral dosing e.g., an intravenous (IV) infusion
- IV intravenous
- pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof is administered in a liquid medicament at a dose selected from the group consisting of 1 mg/kg every two weeks (Q2W) or every 14 days (Q14D), 2 mg/kg Q2W or Q14D, 3 mg/kg Q2W or Q14D, 5 mg/kg Q2W or Q14D, 10 mg Q2W or Q14D, 1 mg/kg every three weeks (Q3W) or every 21 days (Q21D), 2 mg/kg Q3W or Q21D, 3 mg/kg Q3W or Q21D, 5 mg/kg Q3W or Q21D, 10 mg Q3W or Q21D, and flat-dose equivalents of any of these doses, i.e., such as 200 mg Q3W or Q21D.
- pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof is provided in a dosage of about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg, about 120 mg, about 130 mg, about 140 mg, about 150 mg, about 160 mg, about 170 mg, about 180 mg, about 190 mg, about 200 mg, about 210 mg, about 220 mg, about 230 mg, about 240 mg, about 250 mg, about 260 mg, about 270 mg, about 280 mg, about 290 mg, about 300 mg, about 310 mg, about 320 mg, about 330 mg, about 340 mg, about 350 mg, about 360 mg, about 370 mg, about 380 mg, about 390 mg or about 400 mg.
- pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof is provided in a dosage of about 200 mg.
- pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof is provided as a liquid medicament which comprises 25 mg/ml pembrolizumab, 7% (w/v) sucrose, 0.02% (w/v) polysorbate 80 in 10 niM histidine buffer pH 5.5.
- the selected dose of pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof is administered by IV infusion. In one embodiment, the selected dose of pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof is administered by IV infusion over a time period of between 25 and 40 minutes, or about 30 minutes.
- the present invention also provides a medicament which comprises talimogene laherparepvec and a pharmaceutically acceptable excipient for use in combination with pembrolizumab for treating a primary hepatocellular carcinoma, and or a secondary hepatic cancer such as a metastasis of a cancer selected from the group consisting of hepatocellular carcinoma, breast adenocarcinoma, colorectal adenocarcinoma, gastroesophageal adenocarcinoma, gastroesophageal squamous cell carcinoma, melanoma (including uveal melanoma), non-small cell lung cancer and clear cell renal cell carcinoma.
- Talimogene laherparepvec may be suspended in a physiological buffer for intratumoral injection.
- talimogene laherparepvec is provided at a concentration of about 10 3 plaque forming units/mL (PFU/mL), about 10 4 PFU/mL, about 10 5 PFU/mL, about 10 6 PFU/mL, about 10 7 PFU/mL, about 10 8 PFU/mL, about 10 9 PFU/mL or about 10 10 PFU/mL.
- talimogene laherparepvec is provided at a concentration of about 10 6 PFU/mL, about 10 7 PFU/mL or about 10 8 PFU/mL.
- talimogene laherparepvec is administered by intratumoral injection into injectable tumors at a dose of up to about 4.0 mL, of about 5.0 mL, of about 6.0 mL, of about 7.0 mL or of about 8 mL of 10 6 PFU/mL at day 1 of week 1, followed by a dose of up to about 4.0 mL, of about 5.0 mL, of about 6.0 mL, of about 7.0 mL or of about 8 mL of 10 7 or 10 8 PFU/mL at day 1 of weeks 4 and 7, and every 3 weeks ( ⁇ 3 days) thereafter.
- the recommended volume of talimogene laherparepvec to be injected into the tumor(s) is dependent on the size of the tumor(s) and would be readily apparent to one of ordinary skill in the art based on the disclosure provided herein in view of the knowledge in the art.
- compositions may comprise one or more substances selected from the group consisting of a buffer, an antioxidant such as ascorbic acid, a low molecular weight polypeptide (such as those having fewer than 10 amino acids), a protein, an amino acid, a carbohydrate such as glucose, sucrose or dextrins, a chelating agent such as EDTA, glutathione, a stabilizer, and an excipient.
- Neutral buffered saline or saline mixed with specific serum albumin are examples of appropriate diluents.
- preservatives such as benzyl alcohol may also be added.
- the composition may be formulated as a lyophilizate using appropriate excipient solutions (e.g., sucrose) as diluents. Suitable components are nontoxic to recipients at the dosages and concentrations employed.
- the patient is selected for treatment with the combination therapy of the invention if the patient: (1) has histologically or cytologically confirmed BC, CRC, GEC (adenocarcinoma or SCC), melanoma (including uveal melanoma), NSCLC, or RCC with liver metastases; (2) has received at least one prior standard of care systemic anti-cancer therapy for their locally advanced or metastatic disease; and (3) has measurable liver tumors that are suitable for injection.
- the patient is selected for treatment with the combination therapy of the invention if the patient: (1) has HCC with known disease progression; and (2) has measurable liver tumors that are suitable for injection.
- the medicaments described herein may be provided as a kit which comprises a first container and a second container and a package insert.
- the first container contains at least one dose of a medicament comprising a pembrolizumab, a pembrolizumab variant and/or an antigen-binding fragment thereof, and the second container contains at least one dose of talimogene laherparepvec.
- the kit can optionally comprise a package insert, or label, which includes instructions for treating a patient for cancer using the medicaments.
- the first and second containers may be comprised of the same or different shapes (e.g., vials, syringes and bottles) and/or materials (e.g., plastic or glass).
- the kit may further comprise other materials that may be useful in administering the medicaments, such as diluents, filters, IV bags and lines, needles and syringes.
- the instructions state that the medicaments are intended for use in treating a patient having a primary or secondary hepatic cancer.
- pembrolizumab, the pembrolizumab variant and/or the antigen-binding fragment thereof and/or talimogene laherparepvec of the present invention can be incorporated into pharmaceutical compositions suitable for administration.
- Such compositions typically comprise pembrolizumab, the pembrolizumab variant and/or the antigen-binding fragment thereof or talimogene laherparepvec and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration.
- the use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
- a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration.
- routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, intraperitoneal, intramuscular, transdermal (topical), and transmucosal administration.
- Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
- the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
- compositions can be included in a container, pack or dispenser together with optional instructions for administration.
- compositions of the present invention may be administered in a number of ways depending upon whether local or systemic treatment is desired and upon the area to be treated. Administration may be intratumoral or parenteral. Parenteral administration includes intravenous drip, subcutaneous, intraperitoneal or intramuscular injection, intrathecal, or intraventricular administration.
- bases such as sodium citrate, sodium ascorbate, and the like; sodium citrate is preferred.
- unit doses or measured doses of a composition that include pembrolizumab, a pembrolizumab variant and/or antigen-binding fragment thereof or talimogene laherparepvec are dispensed by an implanted device.
- the device can include a sensor that monitors a parameter within a subject.
- the device can include a pump, such as an osmotic pump and, optionally, associated electronics.
- Example 1 Multicenter, Open-label Trial to Evaluate the Safety of Intrahepatic Injection of Talimogene Laherparepvec Into Liver Tumors In Combination with Systemic Pembrolizumab
- a phase lb/2 trial was designed in patients with primary hepatocellular carcinoma (HCC) or liver metastases (non-HCC) combining intratumoral injection of talimogene laherparepvec with systemic administration of the anti-PD-1 antibody pembrolizumab.
- HCC primary hepatocellular carcinoma
- non-HCC liver metastases
- the Part 1 Primary objective is to evaluate the maximum tolerated volume and concentration, as assessed by incidence of dose limiting toxicities (DLTs), of intrahepatic injection of talimogene laherparepvec into liver tumors alone and the maximum tolerated concentration of intrahepatic injection of talimogene laherparepvec into liver tumors in combination with systemic intravenous (IV) administration of pembrolizumab, separately, in subjects with liver metastases (non-HCC) and in subjects with primary HCC.
- DLTs dose limiting toxicities
- the Part 2 Primary objectives are to evaluate the efficacy and safety, as assessed by objective response rate (ORR) and subject incidence of DLT, respectively, of intrahepatic injection of talimogene laherparepvec in combination with systemic IV administration of pembrolizumab, separately, for each non-HCC tumor type (breast adenocarcinoma (BC), colorectal adenocarcinoma (CRC), gastroesophageal cancer (GEC; adenocarcinoma or squamous cell carcinoma (SCC)), melanoma (such a skin or uveal melanoma), non-small cell lung cancer (NSCLC), and clear cell renal cell carcinoma (RCC)) with liver metastases as well as primary HCC.
- BC non-HCC tumor type
- CRC colorectal adenocarcinoma
- GEC gastroesophageal cancer
- SCC gastroesophageal cancer
- SCC adenocarcino
- ORR best overall response
- DCR disease control rate
- PFS progression-free survival
- OS overall survival
- ORR, BOR, DRR, DOR, responses are assessed in injected and in uninjected lesions.
- DCR, PFS and OS are assessed separately for non-HCC and HCC tumors in subjects receiving talimogene laherparepvec monotherapy or talimogene laherparepvec / pembrolizumab combination therapy.
- BOR, DRR, DOR, response in injected and uninjected lesions, DCR, PFS, and OS by primary tumor type BC, CRC, GEC, melanoma, NSCLC, RCC, and HCC.
- the incidence of detectable talimogene laherparepvec DNA in blood and urine is measured.
- the incidence of clearance of talimogene laherparepvec DNA from blood and urine is also measured.
- Subject incidence and sample rate of detection of talimogene laherparepvec DNA and virus are determined at the surface of the injection site, at the exterior of the occlusive dressing, and in the oral mucosa.
- Subject incidence of talimogene laherparepvec DNA detection in lesions suspected to be herpetic in origin is performed.
- the objective of Part 1 is to evaluate the safety of intrahepatic injection of talimogene laherparepvec into liver tumors alone and in combination with systemically administered pembrolizumab for the non-HCC (Group A) and HCC (Group B) cohorts separately (Table 1).
- the safety of administering increasing concentration (10 7 plaque forming units (PFU)/mL or 10 8 PFU/mL) and volumes (maximum up to 4 mL or 8 mL) of talimogene laherparepvec will be determined using a standard 3+3 design.
- the initial concentration of talimogene laherparepvec in all cohorts is always 10 6 PFU/mL.
- Cohort 1 of Group B will be initiated only after safety has been established in Cohort 1 of Group A.
- Combination cohorts (Cohorts 5 and 6) in Part 1 will determine the safety of administering intrahepatic injection of talimogene laherparepvec at 10 7 PFU/mL or 10 8 PFU/mL sequentially (volume up to 4 mL for both doses) in combination with systemic IV administration of pembrolizumab (200 mg) (Table 1).
- a modified toxicity probability interval (mTPI) design will be used to determine safety in the combination cohorts.
- Part 2 will open to evaluate efficacy and safety of the combination treatment in the respective tumor types (six tumor non- HCC types in Group A and HCC tumor type in Group B) with the maximum tolerated concentration (MTC) of talimogene laherparepvec, as determined from Cohorts 5 and 6, in combination with systemic pembrolizumab. Timing of opening Part 2 for the non- HCC (Group A) and HCC (Group B) will be based on when the MTC for talimogene laherparepvec (combination cohorts) is determined for the respective Groups.
- MTC maximum tolerated concentration
- Talimogene laherparepvec will be used at a maximum volume of 4 mL (or up to 8 mL if safety of administering 8 mL is established from monotherapy cohorts 3 and 4 at the time of opening Part 2). If the safety of administering up to 8 mL from the monotherapy cohorts is not established at the time of opening Part 2, newly enrolled subjects in Part 2 will be allowed to receive up to a maximum of 8 mL, if and when, safety of administering 8 mL in monotherapy is established.
- Part 2 consists of 2 stage design to evaluate the efficacy and safety of talimogene laherparepvec in combination with systemic pembrolizumab. Efficacy and safety will be evaluated in each of the six non-HCC tumor types from Group A separately. Similarly, the efficacy and safety of the combination treatment will be determined for Group B HCC subjects. The primary analysis of efficacy will include subjects that receive any volume of talimogene laherparepvec. Sample Size:
- the total number of subjects who will participate in Part 1 and Part 2 of the study is anticipated to be approximately 3 to 244 subjects (approximately 3 to 104 subjects in Part 1; approximately 70 to 147 subjects in Part 2). This estimate includes approximately 147 Full Analysis Set subjects that receive the combination treatment in Parts 1 and 2, and up to 48 DLT evaluable subjects from Part 1 monotherapy cohorts.
- the Part 2 efficacy will include all treated subjects; therefore, dose limiting toxicity non- evaluable subjects will not be replaced in Part 2.
- Subjects must be age > 18 years at the time of informed consent. They must have histologically or cytologically confirmed BC, CRC, GEC, melanoma, NSCLC, or RCC with liver metastases or HCC. Non-HCC subjects must have received at least 1 prior standard of care systemic anti-cancer therapy for their locally advanced or metastatic disease. For the combination cohorts (Cohorts 5 and 6 in Part 1) and Part 2, subjects with metastatic melanoma or NSCLC do not need to have received prior therapy. Subjects must have measurable liver tumors that are suitable for injection. Eastern Cooperative Oncology Group (ECOG) performance status must be 0 or 1, and life expectancy should be approximately 5 months or more. Adequate hematological, renal, hepatic, and coagulation function is required. Liver function tests may be mildly abnormal but within the parameters defined in Section 4.1.1. Child Pugh score must be A to B7.
- ECOG Eastern Cooperative Oncology Group
- Subjects must not be candidates for hepatic surgery or locoregional therapy of liver tumors with curative intent or planned systemic anti-cancer therapy. Liver tumors must not be estimated to invade approximately more than one-third of the liver. Liver tumor-directed therapy, hepatic surgery, antibody-based therapy, or immunotherapy must not have been performed ⁇ 28 days, chemotherapy ⁇ 21 days, and targeted small molecule therapy or hormonal therapy ⁇ 14 days prior to enrollment. Subjects must have either no central nervous system (CNS) metastasis or carcinomatous meningitis, or if CNS metastasis is present, must have stable treated cerebral metastases from BC, NSCLC, RCC, CRC, or melanoma.
- CNS central nervous system
- HBV hepatitis B virus
- HCV hepatitis C virus
- qPCR real time polymerase chain reaction
- Subjects must not: have active herpetic skin lesions or prior complications of herpetic infection (e.g., herpetic keratitis or encephalitis); require treatment with an anti-herpetic drug; have received live-virus vaccination within 30 days of planned treatment start; have previous therapy with talimogene laherparepvec, oncolytic viruses, or tumor vaccine. They must not require concomitant treatment with warfarin.
- herpetic skin lesions or prior complications of herpetic infection e.g., herpetic keratitis or encephalitis
- require treatment with an anti-herpetic drug have received live-virus vaccination within 30 days of planned treatment start; have previous therapy with talimogene laherparepvec, oncolytic viruses, or tumor vaccine. They must not require concomitant treatment with warfarin.
- Subjects in the combination treatment cohort must not have: a history or evidence of psychiatric, substance abuse, or any other clinically significant disorder; toxic effects of the most recent prior chemotherapy not resolved to grade 1 or less (except alopecia); received a transfusion of blood products within 28 days prior to study enrollment; or expected other cancer therapy while on study with the exception of local radiation to the site of bone or other metastasis for palliative treatment.
- Male subjects of reproductive potential in the combination treatment must be willing to use acceptable methods of effective contraception during treatment and through 4 months after the last dose of pembrolizumab.
- Talimogene laherparepvec will be administered by image guided injection (either by ultrasound (US) or computed tomography (CT) scan) into injectable liver lesions only. Dosing concentrations and volumes will be determined during dose escalation in Part 1. The initial concentration for all subjects will be at 10 6 PFU/mL. Twenty-one (+ 3) days later, either 10 7 or 10 8 PFU/mL will be given. Subsequent doses will be given every 21 days (Q21D; ⁇ 3 days) thereafter. The volume will be either up to 4 mL or 8 mL.
- talimogene laherparepvec Up to 6 doses of talimogene laherparepvec may be administered (including 10 6 PFU/mL dose), and there is an investigator option to continue for up to 6 additional doses Q21D ( ⁇ 3 days). Talimogene laherparepvec will be provided at either 10 6 PFU/mL or 10 8 PFU/mL concentrations.
- Pembrolizumab at a dose of 200 mg will be administered every 3 weeks (Q3W; ⁇ 3 days) using 30minute IV infusion.
- talimogene laherparepvec and pembrolizumab are administered on the same day, talimogene laherparepvec should be administered first, if possible.
- Subjects can receive up to 35 cycles (approximately 24 months) with pembrolizumab. During that time, subjects may continue until progressive disease (PD) per the modified irRC-RECIST, unacceptable toxicity, withdrawal of consent, physician's decision to stop therapy for the subject, or sponsor's decision to terminate the study. Discontinuation of treatment may be considered for subjects who have attained a confirmed complete response (CR) that have been treated for at least 8 cycles (24 weeks) with pembrolizumab, and had at least 2 cycles of pembrolizumab beyond the date when the initial CR was declared. Procedures
- liver tumor biopsy unless already performed as standard of care; (2) radiographic tumor assessment; (3) documentation of concomitant medications; and (4) review of adverse events, disease related events, and serious adverse events.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Virology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Endocrinology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/759,476 US20200353022A1 (en) | 2017-10-27 | 2018-10-26 | Compositions and methods for treating liver cancer |
| CA3075294A CA3075294A1 (en) | 2017-10-27 | 2018-10-26 | Compositions and methods for treating liver cancer |
| MX2020003388A MX2020003388A (es) | 2017-10-27 | 2018-10-26 | Composiciones y metodos para tratar cancer hepatico. |
| BR112020007494-2A BR112020007494A2 (pt) | 2017-10-27 | 2018-10-26 | composições e métodos para tratamento do câncer de fígado |
| AU2018355519A AU2018355519A1 (en) | 2017-10-27 | 2018-10-26 | Compositions and methods for treating liver cancer |
| CN201880068853.5A CN111278448A (zh) | 2017-10-27 | 2018-10-26 | 用于治疗肝癌的组合物和方法 |
| JP2020523323A JP2021501150A (ja) | 2017-10-27 | 2018-10-26 | 肝臓がんを治療するための組成物及び方法 |
| EP18807758.0A EP3700544A1 (en) | 2017-10-27 | 2018-10-26 | Compositions and methods for treating liver cancer |
| KR1020207008272A KR20200078483A (ko) | 2017-10-27 | 2018-10-26 | 간암 치료를 위한 조성물 및 방법 |
| SG11202002123XA SG11202002123XA (en) | 2017-10-27 | 2018-10-26 | Compositions and methods for treating liver cancer |
| RU2020111709A RU2802962C2 (ru) | 2017-10-27 | 2018-10-26 | Композиции и способы лечения рака печени |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762578071P | 2017-10-27 | 2017-10-27 | |
| US62/578,071 | 2017-10-27 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019084418A1 true WO2019084418A1 (en) | 2019-05-02 |
Family
ID=64453576
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/057731 Ceased WO2019084418A1 (en) | 2017-10-27 | 2018-10-26 | COMPOSITIONS AND METHODS FOR THE TREATMENT OF LIVER CANCER |
Country Status (13)
| Country | Link |
|---|---|
| US (1) | US20200353022A1 (https=) |
| EP (1) | EP3700544A1 (https=) |
| JP (1) | JP2021501150A (https=) |
| KR (1) | KR20200078483A (https=) |
| CN (1) | CN111278448A (https=) |
| AR (1) | AR113805A1 (https=) |
| AU (1) | AU2018355519A1 (https=) |
| BR (1) | BR112020007494A2 (https=) |
| CA (1) | CA3075294A1 (https=) |
| MX (1) | MX2020003388A (https=) |
| SG (1) | SG11202002123XA (https=) |
| TW (1) | TWI817958B (https=) |
| WO (1) | WO2019084418A1 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2855328C1 (ru) * | 2025-04-07 | 2026-01-30 | Федеральное государственное бюджетное научное учреждение "Томский национальный исследовательский медицинский центр" Российской академии наук ("Томский НИМЦ") | Способ персонализированной мультимодальной терапии колоректального рака с синхронными условно резектабельными метастазами в печень и неблагоприятными факторами прогноза при наличии мутаций в генах KRAS и высоком уровне микросателлитной нестабильности MSI-H |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| HRP20131167T1 (hr) | 2007-06-18 | 2014-01-03 | Merck Sharp & Dohme B.V. | Antitijela za humani receptor programirane smrti pd-1 |
| US12310999B2 (en) * | 2017-04-28 | 2025-05-27 | Merck Sharp & Dohme Corp. | Biomarkers for cancer therapeutics |
| CN114191547A (zh) * | 2021-12-23 | 2022-03-18 | 中山大学 | 仑伐替尼与pd-1单抗联用在制备抗肝癌药物中的应用 |
| WO2025085538A1 (en) * | 2023-10-17 | 2025-04-24 | Lanier Biotherapeutics, Inc. | Alarmin binding molecules and treatment of cancer |
| WO2025211692A1 (ko) * | 2024-04-02 | 2025-10-09 | (주)에트노바테라퓨틱스 | 암 예방 또는 치료를 위한 병용 투여용 약학 조성물 세트 |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US7223593B2 (en) | 2000-01-21 | 2007-05-29 | Biovex Limited | Herpes virus strains for gene therapy |
| WO2012135408A1 (en) | 2011-03-31 | 2012-10-04 | Merck Sharp & Dohme Corp. | Stable formulations of antibodies to human programmed death receptor pd-1 and related treatments |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| WO2014036412A2 (en) | 2012-08-30 | 2014-03-06 | Amgen Inc. | A method for treating melanoma using a herpes simplex virus and an immune checkpoint inhibitor |
| WO2016196173A1 (en) | 2015-05-29 | 2016-12-08 | Merck Sharp & Dohme Corp. | Combination of a pd-1 antagonist and cpg-c type oligonucleotide for treating cancer |
| WO2018201028A1 (en) * | 2017-04-28 | 2018-11-01 | Merck Sharp & Dohme Corp. | Biomarkers for cancer therapeutics |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DK3169341T3 (da) * | 2014-07-16 | 2019-08-05 | Transgene Sa | Onkolytisk virus til ekspression af immun-checkpoint-modulatorer |
| AU2015289081B2 (en) * | 2014-07-16 | 2020-02-06 | Transgene Sa | Combination of oncolytic virus with immune checkpoint modulators |
| PL3426271T3 (pl) * | 2016-03-10 | 2025-11-24 | Cg Oncology, Inc. | Sposoby leczenia guzów litych terapią skojarzoną |
| WO2018111902A1 (en) * | 2016-12-12 | 2018-06-21 | Multivir Inc. | Methods and compositions comprising viral gene therapy and an immune checkpoint inhibitor for treatment and prevention of cancer and infectious diseases |
-
2018
- 2018-10-26 CA CA3075294A patent/CA3075294A1/en active Pending
- 2018-10-26 BR BR112020007494-2A patent/BR112020007494A2/pt not_active IP Right Cessation
- 2018-10-26 SG SG11202002123XA patent/SG11202002123XA/en unknown
- 2018-10-26 MX MX2020003388A patent/MX2020003388A/es unknown
- 2018-10-26 US US16/759,476 patent/US20200353022A1/en not_active Abandoned
- 2018-10-26 AU AU2018355519A patent/AU2018355519A1/en not_active Abandoned
- 2018-10-26 WO PCT/US2018/057731 patent/WO2019084418A1/en not_active Ceased
- 2018-10-26 EP EP18807758.0A patent/EP3700544A1/en not_active Withdrawn
- 2018-10-26 CN CN201880068853.5A patent/CN111278448A/zh active Pending
- 2018-10-26 JP JP2020523323A patent/JP2021501150A/ja active Pending
- 2018-10-26 KR KR1020207008272A patent/KR20200078483A/ko not_active Ceased
- 2018-10-26 AR ARP180103133A patent/AR113805A1/es unknown
- 2018-10-29 TW TW107138162A patent/TWI817958B/zh not_active IP Right Cessation
Patent Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US7223593B2 (en) | 2000-01-21 | 2007-05-29 | Biovex Limited | Herpes virus strains for gene therapy |
| US7537924B2 (en) | 2000-01-21 | 2009-05-26 | Biovex Limited | Virus strains |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| US8900587B2 (en) | 2007-06-18 | 2014-12-02 | Merck Sharp & Dohme Corp. | Antibodies to human programmed death receptor PD-1 |
| WO2012135408A1 (en) | 2011-03-31 | 2012-10-04 | Merck Sharp & Dohme Corp. | Stable formulations of antibodies to human programmed death receptor pd-1 and related treatments |
| WO2014036412A2 (en) | 2012-08-30 | 2014-03-06 | Amgen Inc. | A method for treating melanoma using a herpes simplex virus and an immune checkpoint inhibitor |
| WO2016196173A1 (en) | 2015-05-29 | 2016-12-08 | Merck Sharp & Dohme Corp. | Combination of a pd-1 antagonist and cpg-c type oligonucleotide for treating cancer |
| WO2018201028A1 (en) * | 2017-04-28 | 2018-11-01 | Merck Sharp & Dohme Corp. | Biomarkers for cancer therapeutics |
Non-Patent Citations (68)
| Title |
|---|
| "Fundamental Immunology", 1989, RAVEN PRESS |
| "Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases", 1993, MARCEL DEKKER |
| "Monoclonal Antibodies, Cytokines and Arthritis", 1991, MARCEL DEKKER |
| "Mortality and Causes of Death Collaborators", LANCET, vol. 388, no. 10053, 2015, pages 1459 - 1544 |
| "Physicians' Desk Reference", November 2002, MEDICAL ECONOMICS COMPANY |
| "World Cancer Report", 2014, WORLD HEALTH ORGANIZATION |
| AGNEW: "Chem. Intl. Ed. Engl.", vol. 33, 1994, pages: 183 - 186 |
| AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948 |
| ALTSCHUL, S. F. ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL, S. F. ET AL., J. MOL. EVOL., vol. 36, 1993, pages 290 - 300 |
| ALTSCHUL, S. F. ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| ALTSCHUL, S. F.: "Natl. Biomed. Res. Found.", J. MOL. BIOL., vol. 219, 1991, pages 555 - 565 |
| ALTSCHUL, S. F.: "Theoretical and Computational Methods in Genome Research", 1997, article "Evaluating the statistical significance of multiple distinct local alignments", pages: 1 - 14 |
| ANDTBACKA ET AL.: "Talimogene Laherparepvec Improves Durable Response Rate in Patients With Advanced Melanoma", J CLIN ONCOL, vol. 33, 2015, pages 2780 - 2788, XP055415475, DOI: doi:10.1200/JCO.2014.58.3377 |
| ANDTBACKA RHI ET AL., J. CLIN ONCOL., vol. 33, 2015, pages 2780 - 2788 |
| ANONYMOUS: "Trial to Evaluate the Safety ofTalimogene Laherparepvec Injected Into Liver Tumors Alone and in Combination With Systemic Pembrolizumab - Full Text View - ClinicalTrials.gov", 28 July 2015 (2015-07-28), XP055558899, Retrieved from the Internet <URL:https://clinicaltrials.gov/ct2/show/study/NCT02509507?term=talimogene&draw=4&rank=28> [retrieved on 20190219] * |
| BAERT ET AL.: "New Engl. J. Med.", vol. 348, 2003, pages: 601 - 608 |
| BENIAMINOVITZ ET AL., NEW ENGL. J. MED., vol. 342, 2000, pages 613 - 619 |
| CHESNEY, J.; COLLICHIO, F.; ANDTBACKA, R.H.; PUZANOV, I.; GLASPY, J.A.; MILHEM, M.; HAMID, O.; CRANMER, L.; SAENGER, Y.; ROSS, M.: "Interim safety and efficacy of a randomized (1: 1), open-label phase 2 study of talimogene laherparepvec (T) and ipilimumab (I) vs I alone in unresected, stage IIIB- IV melanoma", ANN ONCOL, vol. 27, no. 6, 2016, pages 379 - 400 |
| CHOTHIA ET AL., J MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883 |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| DAYHOFF, M. O. ET AL.: "Atlas of Protein Sequence and Structure", vol. 5, 1978, article "A model of evolutionary change in proteins", pages: 345 - 352 |
| DEMBO, A. ET AL., ANN. PROB., vol. 22, 1994, pages 2022 - 2039 |
| E. A. ET AL., EUR. J CANCER, vol. 45, 2009, pages 228 - 247 |
| ELVIN A. KABAT: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| GHOSH ET AL., NEW ENGL. J. MED., vol. 348, 2003, pages 24 - 32 |
| GISH, W. ET AL., NATURE GENET, vol. 3, 1993, pages 266 - 272 |
| HANCOCK, J. M. ET AL., COMPUT. APPL. BIOSCI., vol. 10, 1994, pages 67 - 70 |
| HARRINGTON ET AL., J CLIN ONCOL., vol. 27, no. 15a, 2009 |
| HENIKOFF, S. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 10915 - 10919 |
| HEROLD ET AL., NEW ENGL. J. MED., vol. 346, 2002, pages 1692 - 1698 |
| HU ET AL., CLIN CAN RES, vol. 12, 2006, pages 6737 - 6747 |
| HUNTER ET AL., J VIROL, vol. 73, no. 8, August 1999 (1999-08-01), pages 6319 - 6326 |
| KABAT ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 6609 - 6616 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| KABAT, ADV. PROT. CHEM., vol. 32, 1978, pages 1 - 75 |
| KARLIN, S. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 2264 - 2268 |
| KARLIN, S. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5877 |
| KAUFMAN ET AL., ANN SURGIC ONCOL., vol. 17, 2010, pages 718 - 730 |
| KAUFMAN; BINES, FUTURE ONCOL, vol. 6, no. 6, 2010, pages 941 - 949 |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 |
| LIPSKY ET AL., NEW ENGL. J. MED., vol. 343, 2000, pages 1594 - 1602 |
| LIU ET AL., GENE THER, vol. 10, 2003, pages 292 - 303 |
| LIU ET AL., J. NEUROL. NEUROSURG. PSYCH., vol. 67, 1999, pages 451 - 456 |
| LUI ET AL., GENE THERAPY, vol. 10, 2003, pages 292 - 303 |
| MACKIE ET AL., LANCET, vol. 357, 2001, pages 525 - 526 |
| MADDEN, T. L. ET AL., METH. ENZYMOL., vol. 266, 1996, pages 131 - 141 |
| MARKERT ET AL., GENE THER, vol. 7, 2000, pages 867 - 874 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597 |
| MILGROM ET AL., NEW ENGL. J. MED., vol. 341, 1999, pages 1966 - 1973 |
| PORTIELJI ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 52, pages 133 - 144 |
| PRESTA, J. ALLERGY CLIN. IMMUNOL., vol. 116, 2005, pages 731 |
| PUZANOV, I.; MILHEM, M.M.; MINOR, D.; HAMID, O.; LI, A.; CHEN, L.; CHASTAIN, M.; GORSKI, K.S.; ANDERSON, A.; CHOU, J. ET AL.: "Talimogene Laherparepvec in Combination With Ipilimumab in Previously Untreated, Unresectable Stage IIIB-IV Melanoma", J CLIN ONCOL, vol. 34, 2016, pages 2619 - 2626 |
| RAMPLING ET AL., GENE THER, vol. 7, 2000, pages 859 - 866 |
| RIBAS ANTONI ET AL: "Oncolytic Virotherapy Promotes Intratumoral T Cell Infiltration and Improves Anti-PD-1 Immunotherapy", CELL, CELL PRESS, AMSTERDAM, NL, vol. 170, no. 6, 7 September 2017 (2017-09-07), pages 1109, XP085189788, ISSN: 0092-8674, DOI: 10.1016/J.CELL.2017.08.027 * |
| SLAMON ET AL., NEW ENGL. J. MED., vol. 344, 2001, pages 783 - 792 |
| STATES, D. J. ET AL., METHODS, vol. 3, 1991, pages 66 - 70 |
| SUNDARESAN ET AL., J. VIROL, vol. 74, 2000, pages 3822 - 3841 |
| W. A. WEBER, J. NULL. MED., vol. 50, 2009, pages 1S - 10S |
| WASHINGTON, D.C.; SCHWARTZ, R. M. ET AL.: "Natl. Biomed. Res. Found.", vol. 5, 1978, article "Matrices for detecting distant relationships.'' in Atlas of Protein Sequence and Structure", pages: 353 - 358 |
| WATSON ET AL.: "Molecular Biology of the Gene", 1987, THE BENJAMIN/CUMMINGS PUB. CO., pages: 224 |
| WAWRZYNCZAK: "Antibody Therapy", 1996, BIOS SCIENTIFIC PUB. LTD |
| WOOTTON, J. C. ET AL., COMPUT. CHEM., vol. 17, 1993, pages 149 - 163 |
| YANG ET AL., NEW ENGL. J. MED., vol. 349, 2003, pages 427 - 434 |
| ZHANG, J. ET AL., GENOME RES., vol. 7, 1997, pages 649 - 656 |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2855328C1 (ru) * | 2025-04-07 | 2026-01-30 | Федеральное государственное бюджетное научное учреждение "Томский национальный исследовательский медицинский центр" Российской академии наук ("Томский НИМЦ") | Способ персонализированной мультимодальной терапии колоректального рака с синхронными условно резектабельными метастазами в печень и неблагоприятными факторами прогноза при наличии мутаций в генах KRAS и высоком уровне микросателлитной нестабильности MSI-H |
Also Published As
| Publication number | Publication date |
|---|---|
| SG11202002123XA (en) | 2020-04-29 |
| CN111278448A (zh) | 2020-06-12 |
| TW201922273A (zh) | 2019-06-16 |
| AR113805A1 (es) | 2020-06-10 |
| RU2020111709A (ru) | 2021-11-29 |
| KR20200078483A (ko) | 2020-07-01 |
| BR112020007494A2 (pt) | 2020-11-03 |
| RU2020111709A3 (https=) | 2022-04-26 |
| US20200353022A1 (en) | 2020-11-12 |
| MX2020003388A (es) | 2020-08-03 |
| JP2021501150A (ja) | 2021-01-14 |
| AU2018355519A1 (en) | 2020-03-26 |
| EP3700544A1 (en) | 2020-09-02 |
| CA3075294A1 (en) | 2019-05-02 |
| TWI817958B (zh) | 2023-10-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12534530B2 (en) | Combination of a PD-1 antagonist and a VEGFR inhibitor for treating cancer | |
| US12083112B2 (en) | Combination of a PD-1 antagonist and a VEGFR/FGFR/RET tyrosine kinase inhibitor for treating cancer | |
| EP3102604B1 (en) | Combination of a pd-1 antagonist and a 4-1bb agonist for treating cancer | |
| EP3035964B1 (en) | Treating cancer with a combination of a pd-1 antagonist and dinaciclib | |
| US10023649B2 (en) | Method of treating cancer with a combination of an anti-CCR4 antibody and a 4-1BB agonist | |
| US20190031765A1 (en) | Combination of an ox40 agonist and a 4-1bb agonist monoclonal antibody for treating cancer | |
| US20200353022A1 (en) | Compositions and methods for treating liver cancer | |
| RU2802962C2 (ru) | Композиции и способы лечения рака печени | |
| US20260116979A1 (en) | Combination of a pd-1 antagonist and a vegfr inhibitor for treating cancer | |
| HK40010365A (en) | Combination of a pd-1 antagonist and a vegfr inhibitor for treating cancer | |
| HK40010365B (en) | Combination of a pd-1 antagonist and a vegfr inhibitor for treating cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18807758 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3075294 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 20207008272 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018355519 Country of ref document: AU Date of ref document: 20181026 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020523323 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2020111709 Country of ref document: RU |
|
| ENP | Entry into the national phase |
Ref document number: 2018807758 Country of ref document: EP Effective date: 20200527 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020007494 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112020007494 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200415 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2018807758 Country of ref document: EP |