WO2019075400A1 - CONFORMATIONAL EPITOPES IN A CENTRAL PROTECTED REGION OF SYNCYTIAL RESPIRATORY VIRUS PROTEIN G - Google Patents
CONFORMATIONAL EPITOPES IN A CENTRAL PROTECTED REGION OF SYNCYTIAL RESPIRATORY VIRUS PROTEIN G Download PDFInfo
- Publication number
- WO2019075400A1 WO2019075400A1 PCT/US2018/055711 US2018055711W WO2019075400A1 WO 2019075400 A1 WO2019075400 A1 WO 2019075400A1 US 2018055711 W US2018055711 W US 2018055711W WO 2019075400 A1 WO2019075400 A1 WO 2019075400A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- rsv
- peptide
- mutant
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
- C07K14/08—RNA viruses
- C07K14/115—Paramyxoviridae, e.g. parainfluenza virus
- C07K14/135—Respiratory syncytial virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/155—Paramyxoviridae, e.g. parainfluenza virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1027—Paramyxoviridae, e.g. respiratory syncytial virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
- A61K2039/552—Veterinary vaccine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/18011—Paramyxoviridae
- C12N2760/18511—Pneumovirus, e.g. human respiratory syncytial virus
- C12N2760/18522—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/18011—Paramyxoviridae
- C12N2760/18511—Pneumovirus, e.g. human respiratory syncytial virus
- C12N2760/18533—Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/18011—Paramyxoviridae
- C12N2760/18511—Pneumovirus, e.g. human respiratory syncytial virus
- C12N2760/18534—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the field of the invention is the treatment of infectious disease. More specifically, the field is prophylaxis and treatment of respiratory syncytial virus (RSV) infection.
- RSV respiratory syncytial virus
- Epitopes of broadly neutralizing monoclonal antibodies defined by high resolution structural analysis enable design of optimized immunogens and screening tools for discovery of treatments.
- the field includes treatment of defective host immune function by mimicry of respiratory syncytial virus.
- RSV is a negative- strand RNA virus with 10 genes encoding 11 proteins, which has resisted effective management for over 60 years in part because infection does not provide robust immunity ⁇ Broadbent, L. et al. Influenza Other Respir Viruses (2015) 9: 169- 78 ⁇ . To date, no vaccine has been approved despite several substantial attempts ⁇ Jorquera, P.A. and Tripp, R.A. Expert Rev Respir Med (2017) 11(8):609-615 ⁇ . Over 50% of infants in the US are infected during their first year, with nearly 5% requiring hospitalization
- RSV has two major surface glycoproteins, F and G.
- the sole marketed mAb against RSV (Synagis®, described above) is only approved for prophylactic use in premature infants, and is directed against the F protein.
- This mAb is broadly useful due to conservation of the F protein sequence among strains.
- the G protein overall is quite variable, although a region in the middle of the sequence is highly conserved.
- Two subtypes of RSV, A and B circulate alternately at ⁇ l-2-year intervals, with comparable incidence worldwide.
- the mAb 3D3 has shown broad neutralizing activity both in vitro and in rodent models; the epitope for 3D3 defined at the level of short linear peptides is highly conserved across nearly all circulating strains.
- An additional mAb, 2D10, is of interest since no linear peptide epitope could be defined for it although it is active in viral
- a recombinant fusion protein comprising the central region (residues 131-230) of the G proteins of both RSV A and B subtypes was shown to be an effective immunogen in mice ⁇ Lee, J.Y. and Chang, J. PLoS One (2017)12:e0175384 ⁇ .
- immunosuppressive properties of the G protein may be responsible for this effect. Criteria defining quality of an immunogen, for which further improvements are useful, include:
- Design of improved vaccine components is one of the aspects of the present invention, based ultimately on interaction of conformational epitopes of the G protein with antibodies of known affinity.
- the present invention relates to compositions related to epitopes on the G protein from respiratory syncytial virus (RSV) revealed by crystallographic studies of high affinity, broadly neutralizing monoclonal antibodies (mAbs) bound to peptides derived from the conserved central region (CCR) of the G protein that is known to interact with host cell factors.
- These compositions include peptides and other binding moieties that mimic specifically portions of the central conserved region (CCR) of the G protein that also includes a region that is known to interact with host cell factors, including the CX3C receptor
- CX3CR1 More specifically, RSV G protein is organized as an N-terminal cytosolic region, a transmembrane region, and a variable ectodomain consisting of two mucin-like domains separated by a non-glycosylated central conserved region (CCR).
- the CCR contains four cysteine residues that form a cysteine noose, formed by disulfide bonds between a.a. 173-186 that further comprises a cystine loop at a.a. 176-182 and a CX3C chemokine motif (a.a. 182- 186).
- Specific peptides or peptidomimetics derived from the epitopes in this region may be used as immunogens or as tools for discovery of binding agents capable of neutralizing RSV.
- the invention also comprises epitope mimics that accentuate immunogenicity while minimizing pharmacological activity or vice versa.
- a deleterious pharmacological activity of a G protein vaccine is interaction with CX3CR1, which leads to undesirable side effects such as inflammation.
- Peptide-based vaccines that include a functional CX3CR1 binding site may thus stimulate this undesirable result.
- the three dimensional structure of the interaction of G protein with high affinity antibodies permits the identification of conserved residues of the CCR that can be modified to inactivate the CX3CR1 binding site and decrease or obliterate this effect without compromising the immunogenicity of the vaccine.
- modified peptide and “mutant” are used interchangeably.
- the invention is directed to mutants of the G protein or of peptides comprising all or a portion of the CCR thereof that are immunogenic but lack the ability to activate CX3CR1.
- These mutants can be designed by identifying amino acids that are contained within the CCR of the G protein and which do not participate in the binding of high affinity antibodies and substituting for them amino acids with side chains of different shape or size or charge, thus inhibiting the binding of the RSV G mutant to the receptor without interfering with the immunogenicity of the peptide or protein.
- the invention is directed to a peptide (including full length RSV G protein) that contains at least one amino acid substitution at position 162, 164, 166, 177, 187, and/or 193 of the RSV G protein and that shows reduced chemotactic activity as compared to wild type RSV
- the invention relates to a peptide having the amino acid sequence of residues 161-197 of respiratory syncytial virus (RSV) G protein (SEQ ID NO: l) or the amino acid sequence of positons 162-172 (SEQ ID NO:2) or of positions 169-198 (SEQ ID NO:3) or of positions 157-197 (SEQ ID NO:4) or of positions 148-197
- RSV respiratory syncytial virus
- An alternative immunogen is a molecule that comprises at least two covalently linked components, wherein said components are peptides of the amino acid sequence SEQ ID NO:2 and/or the amino acid sequence of SEQ ID NO:3 or wherein each of said components is the corresponding mutant or peptidomimetic of SEQ ID NO:2 and/or
- Peptide embodiments of the invention such as those that mimic soluble RSV G antigens or peptides that are binding moieties can be prepared recombinantly. Peptides that mimic antigens may thus be generated easily to facilitate comprehensive mutational analysis to identify variants within the CCR that can reduce or enhance immunogenicity or provide activation or inhibition of the CX3CR1 receptor.
- the invention provides a mutant or peptidomimetic of the peptide of SEQ ID NO: l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5 or SEQ ID NO:6 that has enhanced immunogenicity as compared to the respective peptide of SEQ ID NO: l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5 or SEQ ID NO:6, including embodiments wherein the conformation of said mutant is chemically stabilized.
- the invention also includes mutant or peptidomimetic of the peptides of SEQ ID NO: l, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5 or SEQ ID NO:6 that has reduced
- the invention is directed to a mutant or peptidomimetic of peptides of SEQ ID NO: l, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5 or SEQ ID NO:6 that stimulates or inhibits the chemokine receptor CX3CR1 responsive to fractalkine, especially, wherein this mutant or peptidomimetic has reduced immunogenicity as compared to the respective peptide of SEQ ID NO: l, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5 or SEQ ID NO:6.
- a suitable in vitro functional analysis interaction of a candidate moiety of the host chemokine receptor CX3CR1 is also disclosed.
- the method includes measuring the relative binding strength of the peptidomimetic s or mutants to mAbs that vary in affinity for the native protein. Agents that bind preferentially to mAbs with high affinity for the native protein are more likely to induce such antibodies than agents that preferentially bind to mAbs with weaker affinity or that have weak affinity for the optimal mAb.
- Another aspect of the invention is a method to identify immunogens useful in vaccines which method comprises contacting a candidate molecule with mAb 3D3, mAb 2D 10 or mAb 3G 12 or an antigen-binding fragment thereof and with at least one binding moiety that binds with low affinity to the RSV G protein, whereby a candidate molecule that preferentially binds to 3D3, mAb 2D10 or mAb 3G12 is identified as having said desirable properties as an immunogen.
- the invention also includes molecules thus identified which may be aptamers or members of a combinatorial library of small molecules or of peptides.
- conformational epitope mimics whether recombinant peptides or peptidomimetic s, provide useful tools for discovery of homogeneous
- compositions of non-immunoglobulin binding moieties with activity similar to the known broadly neutralizing mAbs includes a method to identify a binding moiety that has the characteristics of strain independence, high affinity for the conserved region of the RSV G protein and neutralizing activity which method comprises contacting a candidate binding moiety with a conformationally restrained form of a peptide having the amino acid sequence of any one of SEQ ID NOs: l-6 as shown in Figures 2A-C or a peptidomimetic said restrained form and detecting the presence or absence of a complex between said candidate binding moiety and said peptide or peptidomimetic, wherein the presence of said complex that shows a binding affinity of the candidate binding moiety for said peptide or peptidomimetic at least as strong as ⁇ identifies said binding moiety as having said characteristics.
- the invention also includes binding moieties thus identified.
- the invention further includes methods to provide prophylactic or therapeutic treatment with respect to RSV infection in a subject which method comprises administering to a subject in need of such treatment pharmaceutical or veterinary composition including the immunogens or binding moieties of the invention.
- the invention also includes methods to treat immune mediated inflammatory diseases, chronic pain and peripheral neuropathy which method comprises administering to a subject in need of such treatment compounds of the invention that interact with the C3XC receptor. These, too, may be included in
- FIG. 1 illustrates the RSV G protein and its central conserved region (CCR).
- Panel A is a diagram of the prominent location of the CCR at the tip of a folded back structure of the RSV G protein, preceding the heparin binding domain.
- the CCR structure [residues 161- 190] is shown in panel B at higher resolution, with dotted lines showing non-covalent interactions in the structure, with N and C terminal ends of the region noted.
- FIG. 2 illustrates the contact regions for mAbs 3D3, 2D10 and 3G12 on the CCR of RSV G protein.
- Panel A shows front and back views of the CCR as space filling model; black areas are the mAb contact regions.
- Panel B shows the mAb 3D3 and 2D10 variable domains as ribbon models, and the CCR of RSV G as space filling model.
- Panel C shows the mAb 3G12 variable domains as ribbon models, and the CCR of RSV G as space filling model.
- the CCRs are aligned at the cysteine noose residues.
- mAbs 3D3 and 3G12 bind to many of the same amino acids, however the three-dimensional epitopes are very different due to different conformations of the CCR in each structure.
- FIG. 3 illustrates the structure of fractalkine, the natural ligand for the CX3C chemokine receptor 1.
- Panel A shows the orientation of fractalkine binding to the receptor.
- Panel B shows fractalkine, with the CX3C motif in black.
- Panel C shows a portion of the RSV G protein [residues 161-190] with the CX3C motif in black.
- FIGS. 4A and 4B illustrate RSV G CCR (161-197, SEQ ID N0: 1).
- Figure 4A is a sequence logo showing highly conserved amino acids that may play a role in CX3CR1 binding and activation (height of the single amino acid abbreviations at each residue is proportional to how conserved it is).
- Figure 4B is a high magnification view of the region bound by mAbs 3D3 and 2D 10. conserveed amino acids outside of the mAb epitopes are selected for mutagenesis.
- RSV G[162-172] peptide contains a short helix and projects several hydrophobic residues, including Phel63, Phel65, Phel68,
- 3D3 binds to RSV G at a
- discontinuous, conformational epitope comprising -1,060 A ° 2 , designated as antigenic site ⁇ .
- the mAb 2D 10 also binds RSV G but its epitope could not be characterized by linear epitope mapping.
- a recombinant single-chain variable fragment (scFv) of 2D 10 forms stable complexes with a synthetic RSV G peptide (RSV G[169-198] SEQ ID NO:3), and as also shown in Example 5 the crystal structure of the complex was determined to 1.56 A- resolution.
- the mAb 2D 10 uses a twisted heavy-chain CDR3, heavy-chain CDR2, and light- chain CDR3 to bind to a -550 A ° 2 epitope on the RSV G cysteine noose.
- the CX3C chemokine motif which forms a short helix in the cysteine noose, is buried by 2D 10 binding.
- the 2D 10 epitope is comprised mainly of residues 177-188, and is thus technically continuous, the cysteine noose comprises two nested disulfide bonds that induce strong conformational character to this epitope, designated as antigenic site ⁇ 2.
- Protein Protein
- peptide and “polypeptide” are used interchangeably and to refer to chains of naturally occurring amino acids coupled through amide bonds such that they can be synthesized by recombinant methods regardless of the length of the chain.
- Peptidomimetics include unnatural or synthetic amino acids, including D and L isomers and amino acid analogs linked by amide linkages or other bonds, e.g., ester, ether, etc.
- Peptidomimetics also include organic molecules not obviously analogous to peptides, including, for example, aptamers.
- binding moiety includes antibodies and alternative non- immunoglobulin binding moieties as set forth hereinbelow.
- Antibodies include
- immunoreactive fragments of traditional antibodies and their various fragmented forms that still retain immuno specificity such as Fab, F(abab 2 , F v fragments, single-chain antibodies in which the variable regions of heavy and light chain are directly bound without some or all of the constant regions.
- antibodies also included as “antibodies” are bispecific antibodies which contain a heavy and light chain pair derived from one antibody source and a heavy and light chain pair derived from a different antibody source. Similarly, since light chains are often
- antibodies composed of a heavy chain variable region that determines the specificity of the antibody may be combined with a heterologous light chain variable region.
- Chimeric antibodies with constant and variable regions derived, for example, from different species are also included.
- the critical amino acid sequences are the CDR sequences arranged on a framework which framework can vary without necessarily affecting specificity or decreasing affinity to an unacceptable level. Definition of these CDR regions is accomplished by art-known methods. Specifically, the most commonly used method for identifying the relevant CDR regions is that of Kabat as disclosed in Wu, T. T., et al, J. Exp. Med. (1970) 132:211-250 and in the book Kabat, E. A., et al. (1983) Sequence of Proteins of Immunological Interest, Bethesda National Institute of Health, 323 pages.
- the mAbs of the invention may contain the three CDR regions of a heavy chain and optionally the three CDR' s of a light chain that matches it. Because binding affinity is also determined by the manner in which the CDR's are arranged on a framework, the mAbs may contain complete variable regions of the heavy chain containing the three relevant CDR's as well as, optionally, the complete light chain variable region comprising the three CDR's associated with the light chain
- the invention also includes binding moieties that mimic the binding
- mAb mimics include aptamers ⁇ Yu, Y., et al. Int J Mol Sci (2016) 17(3):358 ⁇ and protein mimics of antibodies or fragments thereof (alternative scaffolds) such as camelids, anticalins, ankyrin repeat proteins ⁇ Azhar A., et al. Int J Biol Macromol (2017) 102:630-641 ⁇ .
- Bispecific binding moieties may be formed by covalently linking two different binding moieties with different specificities.
- the CDR regions of the heavy and optionally light chain derived from one monospecific mAb may be coupled through any suitable linking means to peptides comprising the CDR regions of the heavy chain sequence and optionally light chain of a second mAb.
- the linkage is through an amino acid sequence
- the bispecific binding moieties can be produced recombinantly and the nucleic acid encoding the entire bispecific entity expressed recombinantly.
- the invention also includes the possibility of binding moieties that bind to one or both of the same epitopes as the bispecific antibody or binding entity/binding moiety that actually contains the CDR regions.
- the invention further includes bispecific constructs which comprise the complete heavy and light chain sequences or the complete heavy chain sequence and at least the CDR's of the light chains or the CDR's of the heavy chains and the complete sequence of the light chains.
- the invention is directed to a mutant or peptidomimetic of a peptide having the amino acid sequence of residues 161-197 of respiratory syncytial virus (RSV) G protein (SEQ ID NO: l) or of positions 169-198 (SEQ ID NO:3), or of positions 157-197
- RSV respiratory syncytial virus
- mutant or peptidomimetic elicits antibodies immunoreactive with RSV G protein.
- the elicited antibodies have sub- nM affinity for an epitope of RSV G protein conserved between A and B strains of the virus.
- the peptidomimetic or peptide is chemically stabilized to retain the conformation exhibited upon binding to antibody and/or contains at least one substitution for amino acid 162, 164, 166, 177, 187, 192 and/or of 193 the RSV G protein.
- the invention includes a mutant or peptidomimetic of peptide of SEQ ID NO: l, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5 or SEQ ID NO:6 that stimulates or inhibits the chemokine receptor responsive to fractalkine as compared to the respective peptide of SEQ ID NO: l, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5 or
- the mutant or peptidomimetic has reduced
- any proteins or peptides of the invention may be produced recombinantly using known techniques.
- the invention also includes nucleic acid molecules comprising nucleotide sequences encoding them, as well as vectors or expression systems that comprise these nucleotide sequences, cells containing expression systems or vectors for expression of these nucleotide sequences and methods to produce the peptides by culturing these cells and recovering the binding moieties produced.
- Any type of cell typically used in recombinant methods can be employed including prokaryotes, yeast, mammalian cells, insect cells and plant cells. Also included are human cells (e.g., muscle cells or lymphocytes) transformed with one or more recombinant molecules that encode the relevant peptides.
- RSV G (298 residues) contains a -40 amino acid central conserved region (CCR) that is highly conserved, devoid of glycosylation, and has been shown to play key roles in both virus infection and viral pathogenesis.
- CCR central conserved region
- RSV G CCR contains a CX3C chemokine motif that facilitates binding to the human chemokine receptor CX3CR1 to promote RSV infection in human airway epithelial cells as well as modulating signaling that affects trafficking of CX3CR1 + immune cells resulting in airway congestion.
- treatment with mAbs against the CCD of RSV G protein was associated with a reduction in total lung leukocytes in comparison to isotype control treated mice at day 5 post-inoculation, while treatment with anti-F mAb (Synagis) did not reduce total BAL cells ⁇ Caidi, H., et al. Antiviral Research (2016) 154: 149-157 ⁇ .
- CX3CR1 is implicated in preventing the disease-associated translocation of commensal bacteria to mesenteric lymph nodes.
- CX3CR1 -knockout mice and mice deficient in fractalkine both displayed increased translocation of bacteria and markedly increased disease severity in a model of dextran sulfate sodium (DSS)-induced colitis ⁇ Medina-Contreras, O., et al. J Clin Invest (2011) 121(12):4787-95 ⁇ .
- DSS dextran sulfate sodium
- CX3CR1 has been shown to be an important regulator of beta-cell function and insulin secretion ⁇ Lee, Y.S., et al. Cell (2013) 153(2):413-425 ⁇ , and the RSV G protein
- pharmacological motif mimic could thus also be developed as a therapeutic to treat diabetes.
- the pharmacological activity of the G protein is deleterious in the context of RSV infection and it is thus preferable to minimize that activity in the immunogen.
- this activity is centered around the C3XC receptor and successful mutants or peptidomimetics can be assessed using the chemotaxis assay, among other assays.
- the crystallographic studies described in the present invention permit identification of amino acids whose substitution would be useful in diminishing interaction with the C3XC receptor while retaining immunogenic properties which are the second desirable characteristic of a vaccine.
- residues 162, 164, 166, 177 and 187 are present in the CCR region of the RSV G protein and/or either a part of or adjacent to the C3XC motif and are not among the residues that specifically bind the high affinity antibodies described herein. Thus, replacing one or more of these residues with an alternative that will either alter the charge or the size and shape of the side chain will interfere with interaction with the C3XC receptor.
- conformational stability as has been shown for the RSV F protein, stabilization of the structure via mutations chosen based on antibody- antigen high resolution structural data results in achieving high titer more uniformly across immunized subjects than for the parental virus ⁇ McClellan, J.S., et al. Science (2013) 340(6136): 1113-1117 ⁇ .
- the G protein CCR can be made either synthetically or recombinantly, methods well known in the art can be used to systematically mutate this peptide.
- in vitro assays are needed. Suitable assays are known in the art for mAb binding, for evaluation of thermal stability, and for activation of the CX3CR1 receptor.
- Peptides incorporating non-natural motifs are often quite resistant to proteolytic degradation, which is an advantageous feature unrelated to the mimicry itself.
- a disadvantage of small molecules (“haptens”) is that they are often not immunogenic themselves; however, they can become effective immunogens when presented to the immune system embedded in virus like particles ⁇ Buonaguro, L., et al. Exp. Rev. Vaccines (2011) 10: 1569-1583 ⁇ .
- the F protein of RSV has been subjected to such mimicry.
- two “staples” crosslinks
- crosslinks were required to create an effective mimic, which displayed nanomolar potency for inhibition of RSV infection in Hep-2 cells in vitro
- privileged sites can be identified by alanine scanning mutagenesis (i.e. creation of variants in which one residue at a time is replaced by alanine) ⁇ Robinson, J. A. J Pept Sci (2013) 19(3): 127-40 ⁇ ; based on the high resolution structure, certain sites will benefit from substituting a different amino acid rather than alanine.
- Optimizing immunogenicity of each site potentially enables a vaccine that comprises a fusion of two or three peptides, among those displaying an optimal immunogen for the 3D3 site, an optimal immunogen for the 2D10 site, and an optimal immunogen for the 3G12 site.
- Such an immunogen can elicit high affinity mAbs while providing increased resistance to viral escape compared to a single immunogenic site; the avidity boost from two mAbs binding to the CCR (on the same or different copies of the molecule at the virus surface) contributes to higher neutralization potency across the diverse human population.
- Precedents for such multiple antigen vaccines include an RSV F protein vaccine that incorporates both pre- and post- fusion conformationally stabilized antigens ⁇ Cimica, V., et al. Clin Vaccine Immunol (2016) 23(6):451-9 ⁇ and a G protein vaccine that includes residues 131-230 from both A and B strains of RSV ⁇ Lee, J.Y. and Chang, J. PLoS One (2017)12:e0175384 ⁇ .
- Preserving T cell responses, in addition to B cell responses, is also facilitated by the novel structural data; the major T cell epitope has been mapped to residues 185-193 ⁇ Varga, S.M., et al. J Immunol. (2000) 165(11):6487-95 ⁇ .
- An important aspect of the invention is an effective immunogen for inducing mAbs that block the G protein interaction with CX3CR1, wherein that immunogen itself lacks binding to the receptor. Identifying the residues needed for CX3CR1 binding is accomplished using the same library of variants as for identification of key immunogenic epitopes, but assayed for functionality in a cell based assay for CX3CR1 activation as described in Example 4. Additional variants, such as those that are outside of mAb epitopes but are conserved and predicted to reduce or eliminate CX3CR1 binding, are also useful in this regard. Additional variants, such as insertion of an extra residue in the CX3C motif, may also be candidates.
- the conformational epitope mimics enable efficient discovery of homogeneous compositions of non- immunoglobulin binding moieties with activity similar to the known broadly neutralizing mAbs such as aptamers or alternative scaffolds. Such mimics can provide superior stability, lower cost of manufacture ⁇ e.g. by expression in bacterial rather than in mammalian cells), and simpler formulation for inhaled delivery. (The epitope mimics can also be used for identification of additional mAbs.) Homology modeling of the epitope mimics for human RSV can be used to develop analogous epitope mimics for generating mAbs useful in veterinary indications, e.g.
- Those candidates that successfully compete with the mAb for the epitope are selected as suitable binding agents. Further optimization can be achieved by rank ordering the candidates with regard to binding to epitope mimics that vary in their fidelity to the optimal conformation. As described above with regard to stabilization of epitope mimics, the fidelity of epitope mimics can be determined by measuring relative affinity for mAbs such as 3D3 or mAbs with lower affinity binding to the same general region of RSV G protein. Binding agents are deemed superior if they show stronger affinity for epitope mimics that in turn display high affinity binding to the known mAbs with broadly neutralizing activity.
- the invention is also directed to pharmaceutical and veterinary compositions which comprise as active ingredients the binding moieties, mutants or other peptides or peptidomimetics of the invention.
- the compositions contain suitable physiologically compatible excipients such as buffers and other simple excipients.
- the compositions may include additional active ingredients as well, in particular in the case of immunogens immune system stimulants as vaccine adjuvants.
- the pharmaceutical or veterinary compositions may also contain other formulation excipients, including formulations for intra-nasal or inhaled delivery of mAbs as described in US Patent No. 9,718,875.
- binding moieties of the invention may also be used in diagnosis.
- the immunogens are employed in a method to generate an immune response to RSV, comprising administering formulations containing them to a subject, including a human subject, such as a pregnant woman, an infant, an elderly human, or an immunocompromised subject.
- a subject including a human subject, such as a pregnant woman, an infant, an elderly human, or an immunocompromised subject.
- the binding moieties of the invention may also be used for therapy or prophylaxis. Infections in other animal species that are related to RSV may also be treated prophylactically or therapeutically by the immunogens or binding moieties of the invention.
- Mutants or pe tidomimetics that modulate the C3XC receptor are employed in methods to treat other conditions such as rheumatoid arthritis, osteoarthritis, atherosclerosis, diabetes, chronic pain arising from peripheral neuropathy, ulcerative colitis and inflammatory bowel disease.
- Recombinant mAbs 3D3 and 2D 10 were produced by transient-transfection in CHO cells and purification by immobilized protein A.
- the CDRs for these mAbs are disclosed in Figure 5A of US Patent No. 8,273,354 and single chain Fv sequences are included in those employed in recombinant production as SEQ ID NOs: 9 and 10
- Fab 3D3 was generated from recombinantly produced 3D3 by incubation with immobilized papain, followed by removal of the Fc fragment with immobilized protein A. Fab 3D3 was then purified by Superdex 200 size-exclusion chromatography in 10 mM Tris-HCl pH 8.0 and 150 mM NaCl.
- scFv 2D 10 included in SEQ ID NO: 10, a synthetic gene codon- optimized for Drosophila melanogaster encoding 2D 10 heavy chain variable region, a (GGGGS) 3 GGG linker, and 2D 10 light chain variable region, was cloned into pMT-puro in- frame with an N-terminal BiP signal sequence and a C-terminal thrombin cleavage site followed by a Twin-Strep purification tag. The resulting scFv 2D 10 expression plasmid was used to obtain stably-transfected Schneider 2 (S2) insect cells.
- S2 stably-transfected Schneider 2
- Secreted scFv 2D10 was affinity purified on a StrepTrap column, digested with thrombin protease to remove the purification tag, and then purified by Superdex 200 size-exclusion chromatography in 10 mM Tris-HCl pH 8.0 and 150 mM NaCl.
- G[ecto] RSV G ectodomain
- P03423 A synthetic gene encoding RSV G ectodomain (G[ecto]) P03423) was cloned into pCF in-frame with an N-terminal TPA signal sequence and C-terminal tandem 6-histidine and Twin-Strep purification tags (SEQ ID NO:7 that includes residues 64 to 298, UniProtKB entry).
- G[ecto] was produced by transient-transfection in CHO cells and secreted G[ecto] was affinity purified on a StrepTrap column.
- a synthetic gene codon-optimized for Escherichia coli encoding RSV G residues 161 to 197 (G [161- 197]) (SEQ ID NO: l UniProtKB entry P03423) with a C-terminal 6- histidine purification tag (SEQ ID NO:8) was cloned into pET52b. The peptide was expressed overnight in E. coli BL21(DE3) at 18°C.
- the cells were then were lysed by ultrasonication in 20 mM Tris-HCl pH 8.0, 150 mM NaCl, and 25 mM imidazole (Buffer A) containing 2 ⁇ MgCl 2 , benzonase, and protease inhibitors.
- Buffer A containing 2 ⁇ MgCl 2 , benzonase, and protease inhibitors.
- RSV G[ 161-197] was purified from soluble lysates by HisTrap FF affinity chromatography and eluted with a gradient into Buffer B (Buffer A containing 500 mM imidazole). Analogous methods were used to produce related peptides (G [162- 172] (SEQ ID NO: 2) and G [169-198] (SEQ ID NO: 3)).
- peptides, mutants and peptidomimetics of the invention are evaluated in a murine model using the following criteria.
- Table 1 Immunogenicity Evaluation Criteria Based on pfu/g lung tissue at day 5 3 75% reduction of RSV in lungs vs. naive mice post-challenge and RT-PCR 2 50% reduction of RSV in lungs vs. naive mice quantitation of viral genomes/g
- Thl/Th2 assayed by IFNy and IL-4 2 moderate; Thl/Th2 balanced ELISPOTs or by intracellular
- the assay was performed using a transwell insert plate with an 8 ⁇ pore size. Approximately 2 million log-phase THP-1 cells (a human leukemia monocytic cell line) washed twice and suspended in serum-free RPMI 1640 media were added to the upper chamber of the insert plate. Negative control was serum-free media alone to which serum-free media containing 25 nM mAb was added to the lower chamber. As a positive control, media containing 10% FBS was added to the lower chamber. RSV G[ecto] or RSV G[ 161-197] samples were added to the lower chamber at a final concentration of 5 nM in serum-free media.
- RSV G[161-197] was pre- incubated with 5-molar excess mAb for 20 min at room temperature, and then added to serum-free media in the lower chamber, for a final concentration of 5 nM RSV G[ 161-197] and 25 nM mAb.
- anti-CX3CRl antibody 2 1 mg/mL anti-CX3CRl rabbit polyclonal antibody (ThermoFisher Scientific Cat# PA5-19910) was incubated with THP-1 cells for 30 minutes in the upper chamber before being placed into the well. The assembled plates were incubated in a C02 incubator at 37°C for 5 h.
- Diffraction data were collected at cryogenic temperature at the Advanced Light Source on beamline 8.3.1 using a wavelength of 1.11503 A. Diffraction data from a single crystal were processed with iMosflm and Aimless.
- the Fab 3D3-RSV G[162-172] complex structure was solved by molecular replacement with a Fab homology model and the program PHASER, and the structure was refined and manually rebuilt using PHENIX and Coot, respectively.
- the final Fab 3D3-RSV G[162-172] complex structure (PDB code 5WNB) had the following Ramachandran statistics: 96.5% favored, 3.5% allowed, 0% outliers.
- Diffraction data were collected at cryogenic temperature at the Advanced Light Source beamline 8.3.1 using a wavelength of 1.11582 A.
- Diffraction data were collected at cryogenic temperature at the Advanced Light Source on beamline 8.3.1 using a wavelength of 1.11503 A.
- Diffraction data from a single crystal were processed with iMosflm and Aimless.
- the Fab 3D3-RSV G[161-197] complex structure was solved by molecular replacement with Fab 3D3 and the program PHASER, and the structure was refined and manually rebuilt using PHENIX and Coot, respectively.
- the final Fab 3D3-RSV G[161-197] complex structure (PDB code 5WNA) had the following Ramachandran statistics: 97.6% favored, 2.4% allowed, 0% outliers.
- Crystals were transferred into a cryoprotectant solution of 28% PEG 4000, 0.17 M ammonium sulfate, 0.085 M sodium citrate pH 5.6 and 15% glycerol, and 25% glycerol and flash frozen in liquid nitrogen. Diffraction data were collected at cryogenic temperature at the Advanced Photon Source on beamline 23-ID-D using a wavelength of 1.033 A. Diffraction data from a single crystal were processed with HKL2000. The scFv 2D10-RSV G[169-198] complex structure was solved by molecular replacement with a scFv homology model and the program
- Crystals were transferred into a cryoprotectant solution of 2.0 M ammonium sulfate, 100 mM sodium acetate trihydrate pH 4.4, and 25% glycerol and flash frozen in liquid nitrogen. Diffraction data were collected at cryogenic temperature at the Advanced Light Source on beamline 8.3.1 using a wavelength of 1.11582 A. Diffraction data from a single crystal were processed with iMosflm and Aimless.
- 3G12+RSV G 1 1 5-"7 " 1 1 9"7 complex structure was solved by molecular replacement the program PHASER, and the structure was refined and manually rebuilt using PHENIX and Coot, respectively.
- the final Fab 3G12-RSV G[157-197] complex structure (PDB code 6MKC) had the following Ramachandran statistics: 95.7% favored, 4.3% allowed, 0% outliers.
- Table 3 summarizes the crystallographic data (structures deposited in the Protein Data Bank: www.pdb.org).
- 3D3-RSV G 3D3-RSV G 2D10-RSV G 3G12-RSV G
- each of these mutations shows diminished chemotactic activity, the most effective being the substitution of arginine for serine at position 177. Combinations of these mutations are included within the scope of the invention.
- the peptides, mutants and peptidomimetics of the invention can be used to identify effective non-immunoglobulin binding agents.
- non-immunoglobulin protein scaffolds are known in the art that provide equivalent pharmacological activity arising from high affinity, high specificity binding to an epitope similar to one bound by a traditional mAb ⁇ Sha, F, et al. Protein Sci. (2017) 26(5):910-924 ⁇ .
- Examples include scaffolds based on fibronectin, lipocalin, lens crystallin, tetranectin, ankyrin, Protein A (Ig binding domain).
- Small peptide families may also have antibody-like affinity and specificity, including avian pancreatic peptides and conotoxins ⁇ Josephson, K., et al., J. Am. Chem.
- Cross-linked peptides similarly provide the ability to generate high affinity binding agents with well- defined specificity.
- non-protein based agents such as nucleic acid aptamers can also provide equivalent binding ⁇ Sun, H. and Zu, Y. Molecules (2015) 20(7): 11959-80 ⁇ .
- SEQ ID NO Composition (amino acid and encoding nucleic acid)
- RSV G protein ectodomain [residues 64-298 from RSV strain A2, GenBank KT992094.1, with 2 synonymous mutatations (underlined)] with N terminal TPA secretion signal and C terminal 6His-2Strep tag
- MDAMKRGLCCVLLLCGA V VSPSEFSANHKVTPTTAIIQDATSQIKNTTP T YLTQNPQLGIS PS NPS EITS QITTILAS TTPG VKS TLQS TT VKTKNTTT TQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKR IPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINT TKTNIITTLLTS NTTGNPELTS QMETFHS TS S EGNPS PS Q VS TTS E YPS Q PSSPP PRQHHHHHHGWSHPQFEKGGGSGGGSGGGSWSHPQFEK
- RSV G protein [residues 161-197] with N terminal start codon and spacer glycine and C terminal 6His tag
- RSV G protein [residues 157-197] with N terminal start codon and spacer glycine and C terminal 6His tag
- RSV G protein [residues 148-197] with N terminal start codon and spacer glycine and C terminal 6His tag
- RSV G protein [residues 161-195] with N terminal start codon and spacer glycine and C terminal 6His tag
- scFv 3D3 single chain Fv with N terminal Bip signal sequence, internal flexible linker and C terminal thrombin protease cleavage site followed by 6His-2Strep tag
- scFv 2D10 single chain Fv (scFv 2D10) with N terminal Bip signal sequence, internal flexible linker and C terminal thrombin protease cleavage site followed by 6His-2Strep tag
- RSV respiratory syncytial virus
- mutant or peptidomimetic above which is a mutant comprising no more than five amino acid substitutions and/or deletions and/or additions.
- mutant or peptidomimetic above which is a mutant comprising no more than five amino acid substitutions and/or deletions and/or additions that has altered pharmacological activity with respect to activation of the chemokine receptor responsive to fractalkine.
- a molecule having desirable properties as an immunogen wherein said properties include induction of antibodies that have strain independent high affinity for the conserved region of the RSV G protein and have neutralizing activity, that is identified by contacting a candidate molecule with the mAb 3D3, 2D10 or 3G12 or an antigen-binding fragment thereof and with at least one binding moiety that binds with low affinity to the RSV G protein, whereby a candidate molecule that preferentially binds to 3D3, 2D10, 3G12 or fragment is identified as having said desirable properties as an immunogen.
- a molecule that comprises covalently linked components wherein said components are peptides of the amino acid sequence SEQ ID NO:2 and the amino acid sequence of SEQ ID NO:3 or each of said components is the corresponding mutant or peptidomimetic of SEQ ID NO:2 and/or SEQ ID NO:3 as described in embodiments 3-8.
- a mutant peptide comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NOs:3-6 which contains at least one substitution for amino acid 162, 164, 166, 177, 187, 192 and/or of 193 the RSV G protein which mutant shows reduced chemotactic activity as compared to wild type RSV G protein.
- a method to design a mutant peptide for use as a vaccine against RSV which method comprises identifying amino acids that are contained within the CCR of the G protein which amino acids do not participate in the binding of high affinity antibodies and substituting for them amino acids with side chains of different shape or size or charge, thus inhibiting the binding of the mutant to the receptor (CX3CR1) without interfering with the immunogenicity of the peptide or protein.
- a peptide or mutant peptide described in any of the preceding embodiments coupled to moiety for use in assay of said peptide or mutant or for use in purification of said peptide or mutant.
- a pharmaceutical or veterinary composition comprising as active ingredient at least one of any peptide, peptidomimetic, mutant or molecule described above. 19.
- a method to provide a prophylactic or therapeutic treatment with respect to RSV infection in a subject which method comprises administering to a subject in need of such treatment an effective amount of the pharmaceutical composition just described.
- a method to treat immune mediated inflammatory diseases, chronic pain and peripheral neuropathy comprises administering to a subject in need of such treatment an effective amount of the pharmaceutical or veterinary composition wherein the active agent is that described in embodiments 12 or 13.
- a recombinant expression system for the production of any peptides or mutants described above which expression system is a nucleic acid that comprises a nucleotide sequence encoding said peptide or mutant operably linked to control sequences for its expression.
- a method to identify a molecule having desirable properties as an immunogen, wherein said properties include induction of antibodies that have strain independent high affinity for the conserved region of the RSV G protein and have neutralizing activity comprises contacting a candidate molecule with the mAb 3D3, 2D10 or 3G12 or an antigen-binding fragment thereof and with at least one binding moiety that binds with low affinity to the RSV G protein, whereby a candidate molecule that preferentially binds to 3D3, 2D10 or 3G12 is identified as having said desirable properties as an immunogen.
- a pharmaceutical or veterinary composition comprising as active ingredient the binding moiety above.
- a method to provide a prophylactic or therapeutic treatment with respect to RSV infection in a subject which method comprises administering to a subject in need of such treatment an effective amount of this pharmaceutical or veterinary composition.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Pulmonology (AREA)
- Communicable Diseases (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP18865711.8A EP3694548A4 (en) | 2017-10-13 | 2018-10-12 | CONFORMATIONAL EPITOPES IN A CENTRAL PROTEIN G REGION OF RESPIRATORY SYNCYTIAL VIRUS |
| CA3079604A CA3079604A1 (en) | 2017-10-13 | 2018-10-12 | Conformational epitopes in respiratory syncytial virus g protein central conserved region |
| JP2020520775A JP7445895B2 (ja) | 2017-10-13 | 2018-10-12 | 呼吸器合胞体ウイルスgタンパク質中央保存領域の立体構造エピトープ |
| AU2018346960A AU2018346960A1 (en) | 2017-10-13 | 2018-10-12 | Conformational epitopes in respiratory syncytial virus G protein central conserved region |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762572271P | 2017-10-13 | 2017-10-13 | |
| US62/572,271 | 2017-10-13 | ||
| US201762588022P | 2017-11-17 | 2017-11-17 | |
| US62/588,022 | 2017-11-17 | ||
| US201862633999P | 2018-02-22 | 2018-02-22 | |
| US62/633,999 | 2018-02-22 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019075400A1 true WO2019075400A1 (en) | 2019-04-18 |
Family
ID=66101661
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/055711 Ceased WO2019075400A1 (en) | 2017-10-13 | 2018-10-12 | CONFORMATIONAL EPITOPES IN A CENTRAL PROTECTED REGION OF SYNCYTIAL RESPIRATORY VIRUS PROTEIN G |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US11773143B2 (enExample) |
| EP (1) | EP3694548A4 (enExample) |
| JP (1) | JP7445895B2 (enExample) |
| AU (1) | AU2018346960A1 (enExample) |
| CA (1) | CA3079604A1 (enExample) |
| WO (1) | WO2019075400A1 (enExample) |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2021534239A (ja) | 2018-08-08 | 2021-12-09 | トレリス・バイオサイエンス,エルエルシー | Rsvの改善された受動的および能動的ワクチン |
| US12367329B1 (en) * | 2024-06-06 | 2025-07-22 | EvolutionaryScale, PBC | Protein binder search |
| CN119479801A (zh) * | 2024-11-11 | 2025-02-18 | 苏州系统医学研究所 | 一种针对囊膜病毒表面抗原稳定突变位点的数据预测方法 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040009177A1 (en) * | 2000-10-18 | 2004-01-15 | Tripp Ralph A. | Compositions and methods for modulating RSV infection and immunity |
| US20050042230A1 (en) * | 2003-07-15 | 2005-02-24 | Id Biomedical Corporation Of Quebec | Subunit vaccine against respiratory syncytial virus infection |
| US20130034564A1 (en) * | 2007-10-25 | 2013-02-07 | Kauvar Lawrence M | Anti-rsv g protein antibodies |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AUPO026596A0 (en) | 1996-06-05 | 1996-06-27 | Biomolecular Research Institute Limited | Viral peptide |
| EP2590675B1 (en) * | 2010-07-07 | 2018-08-29 | Artificial Cell Technologies, Inc. | Respiratory syncytial virus antigenic compositions and methods |
| EP3408284A4 (en) * | 2016-01-28 | 2019-08-14 | The Brigham and Women's Hospital, Inc. | DETERMINATION OF AN ANTIBODY AGAINST A PATHOGEN |
-
2018
- 2018-10-12 WO PCT/US2018/055711 patent/WO2019075400A1/en not_active Ceased
- 2018-10-12 EP EP18865711.8A patent/EP3694548A4/en active Pending
- 2018-10-12 US US16/159,497 patent/US11773143B2/en active Active
- 2018-10-12 CA CA3079604A patent/CA3079604A1/en active Pending
- 2018-10-12 JP JP2020520775A patent/JP7445895B2/ja active Active
- 2018-10-12 AU AU2018346960A patent/AU2018346960A1/en not_active Abandoned
-
2023
- 2023-08-19 US US18/452,524 patent/US20240150414A1/en active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040009177A1 (en) * | 2000-10-18 | 2004-01-15 | Tripp Ralph A. | Compositions and methods for modulating RSV infection and immunity |
| US20050042230A1 (en) * | 2003-07-15 | 2005-02-24 | Id Biomedical Corporation Of Quebec | Subunit vaccine against respiratory syncytial virus infection |
| US20130034564A1 (en) * | 2007-10-25 | 2013-02-07 | Kauvar Lawrence M | Anti-rsv g protein antibodies |
Also Published As
| Publication number | Publication date |
|---|---|
| US20240150414A1 (en) | 2024-05-09 |
| AU2018346960A1 (en) | 2020-05-28 |
| EP3694548A4 (en) | 2021-10-20 |
| US11773143B2 (en) | 2023-10-03 |
| US20190135876A1 (en) | 2019-05-09 |
| JP7445895B2 (ja) | 2024-03-08 |
| JP2020536934A (ja) | 2020-12-17 |
| CA3079604A1 (en) | 2019-04-18 |
| EP3694548A1 (en) | 2020-08-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240150414A1 (en) | Conformational epitopes in respiratory syncytial virus g protein central conserved region | |
| US12410241B2 (en) | Human monoclonal antibodies to enterovirus D68 | |
| CN103483421B (zh) | 用于治疗hbv感染及相关疾病的多肽及抗体 | |
| CN105669838B (zh) | 来自水痘-带状疱疹病毒gE蛋白的中和表位及针对其的抗体 | |
| TWI877396B (zh) | 一種抗新型冠狀病毒的雙特異性抗體及其應用 | |
| WO2018022786A1 (en) | Antibodies to zika virus and methods of use thereof | |
| Naidoo et al. | The potential of nanobodies for COVID-19 diagnostics and therapeutics | |
| WO2023040835A1 (zh) | 一株羊驼源纳米抗体及其应用 | |
| CN106459186A (zh) | 针对hiv‑1 v1v2 env区域的广谱中和性单克隆抗体 | |
| WO2022099187A2 (en) | Sars-cov-2 antigen-binding proteins and uses thereof | |
| US20230374153A1 (en) | METHODS OF PREVENTING OR TREATING INFECTION BY RESPIRATORY VIRUSES INCLUDING SARS-CoV-2 | |
| JP2021507717A (ja) | 抗原結合性ポリペプチド | |
| CN119403828A (zh) | 能够与冠状病毒sars-cov-2的刺突蛋白结合的抗体 | |
| CN110156890A (zh) | Semaphorin7A单克隆抗体及其在制备用于治疗炎症疾病药物方面的应用 | |
| Isaacs et al. | A nanobody-based therapeutic targeting Nipah virus limits viral escape | |
| WO2023040834A1 (zh) | 一株羊驼源纳米抗体及其应用 | |
| WO2022210830A1 (ja) | 抗SARS-CoV-2抗体 | |
| CN115087667A (zh) | 特异性结合SARS-CoV-2的抗原结合蛋白 | |
| US10766929B2 (en) | De novo designed hemagglutinin binding proteins | |
| US20250296987A1 (en) | Rsv/hmpv cross-reactive antibodies | |
| US12246063B2 (en) | Immunogen providing an extended protective lifetime against respiratory syncytial virus (RSV) and vaccines thereof | |
| US20240285753A1 (en) | Epitope-scaffold immunogens for pancoronavirus vaccines | |
| US20250179152A1 (en) | Sars-cov-2 neutralizing synthetic proteins | |
| Van Zant et al. | SARS-CoV-2 spike protein binding ligands and its application in COVID-19 therapeutics | |
| Fedechkin | Structures Of Respiratory Syncytial Virus G Antigen Bound To Broadly Neutralizing Antibodies For Vaccine And Therapeutic Design |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18865711 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3079604 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020520775 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018865711 Country of ref document: EP Effective date: 20200513 |
|
| ENP | Entry into the national phase |
Ref document number: 2018346960 Country of ref document: AU Date of ref document: 20181012 Kind code of ref document: A |