WO2019042555A1 - MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF - Google Patents
MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF Download PDFInfo
- Publication number
- WO2019042555A1 WO2019042555A1 PCT/EP2017/071891 EP2017071891W WO2019042555A1 WO 2019042555 A1 WO2019042555 A1 WO 2019042555A1 EP 2017071891 W EP2017071891 W EP 2017071891W WO 2019042555 A1 WO2019042555 A1 WO 2019042555A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- antigen binding
- seq
- binding fragment
- sequence identity
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/116—Togaviridae (F); Matonaviridae (F); Flaviviridae (F)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/18—Togaviridae; Flaviviridae
- G01N2333/183—Flaviviridae, e.g. pestivirus, mucosal disease virus, bovine viral diarrhoea virus, classical swine fever virus (hog cholera virus) or border disease virus
- G01N2333/185—Flaviviruses or Group B arboviruses, e.g. yellow fever virus, japanese encephalitis, tick-borne encephalitis, dengue
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/26—Infectious diseases, e.g. generalised sepsis
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to multispecific antibodies, and antigen binding fragments thereof, that bind specifical ly to distinct Zika virus (ZIKV) epitopes. Such antibodies potently neutralize infection of Zika virus (ZIKV) and minimize or abolish the generation of Zika virus escape mutants.
- the invention also relates to nucleic acids that encode such antibodies and antibody fragments.
- the invention relates to the use of the antibodies and antibody fragments of the invention in prevention and treatment of ZIKV infection.
- Zika virus a mosquito-borne flavivirus
- ZIKV Zika virus
- Trans. R. Soc. Trop. Med. Hyg. 46, 509-520 (1 952) and the first human infection was reported in Nigeria in 1954 F. N. Macnamara, Zika virus: a report on three cases of human infection during an epidemic of jaundice in Nigeria. Trans. R. Soc. Trop. Med. Hyg. 48, 1 39-145 (1 954)).
- ZIKV belongs to the genus flavivirus, which also includes the West Nile virus, dengue virus, tick-borne encephalitis virus, yellow fever virus, and several other viruses which may cause encephalitis.
- Flaviviruses are enveloped, with icosahedral and spherical geometries. The diameter is around 50 nm.
- Genomes are linear positive-sense RNA and non-segmented, around 10-1 1 kb in length.
- the genome of flaviviruses encodes 3 structural proteins (Capsicl, prM, and Envelope) and 8 non-structural proteins (NS1 , NS2A, NS2B, NS3, NS4A, NS4B, NS5 and NS5B).
- flavivirus envelope (E) proteins mediate fusion and are the main target of neutralizing antibodies
- the non-structural protein 1 (NS1 ) is secreted by infected cells and is involved in immune evasion and pathogenesis (D. A. Muller, P. R. Young, The flavivirus NS1 protein: molecular and structural biology, immunology, role in pathogenesis and application as a diagnostic biomarker. Antiviral Res. 98, 192-208 (2013)).
- ZIKV NS1 revealed conserved features with NS1 of other flaviviruses although with different electrostatic characteristics ( J. Kim et al., Zika virus NS1 structure reveals diversity of electrostatic surfaces among flaviviruses, 1 -6 (201 6)).
- a phenomenon that is characteristic of certain flaviviruses is the disease-enhancing activity of cross-reactive antibodies elicited by previous infection by heterologous viruses.
- DEV Dengue virus
- 4 serotypes there is epidemiological evidence that a primary infection protects from reinfection with the same serotype, but represents a risk factor for the development of severe disease upon reinfection with a different serotype (S. B. Haistead, Dengue Antibody-Dependent Enhancement: Knowns and Unknowns. Microbiol Spectr. 2, 249-271 (2014)).
- the exacerbated disease is triggered by E and prM-specific antibodies that fail to neutralize the incoming virus but instead enhance its capture by Fc receptor-expressing (FcR + ) cells, leading to enhanced viral replication and activation of cross- reactive memory T cells.
- FcR + Fc receptor-expressing
- the resulting cytokine storm is thought to be the basis of the most severe form of disease known as dengue hemorragic fever/dengue shock syndrome (S. B. Haistead, Neutralization and antibody-dependent enhancement of dengue viruses. Adv Virus Res. 60, 421 -467 (2003); G. Screaton, J. Mongkolsapaya, S. Yacoub, C. Roberts, New insights into the immunopathology and control of dengue virus infection. Nat Rev Immunol. 15, 745- 759 (201 5).
- composition “comprising” thus encompasses “including” as well as “consisting” e.g., a composition “comprising” X may consist exclusively of X or may include something additional e.g., X + Y.
- the terms "a” and “an” and “the” and similar reference used in the context of describing the invention (especially in the context of the claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. Recitation of ranges of values herein is merely intended to serve as a shorthand method of referring individually to each separate value falling within the range. Unless otherwise indicated herein, each individual value is incorporated into the specification as if it were individually recited herein.
- disease as used herein is intended to be generally synonymous, and is used interchangeably with, the terms “disorder” and “condition” (as in medical condition), in that al l reflect an abnormal condition of the human or animal body or of one of its parts that impairs normal functioning, is typically manifested by distinguishing signs and symptoms, and causes the human or animal to have a reduced duration or quality of life.
- treatment of a subject or patient is intended to include prevention, prophylaxis, attenuation, amelioration and therapy.
- subject or patient are used interchangeably herein to mean al l mammals including humans. Examples of subjects include humans, cows, dogs, cats, horses, goats, sheep, pigs, and rabbits. In one embodiment, the patient is a human.
- antigen binding fragment fragment
- fragment fragment
- antibody fragment are used interchangeably to refer to any fragment of an antibody of the invention that retai ns the antigen-binding activity of the antibody.
- antibody fragments include, but are not limited to, a single chain antibody, Fab, Fab', F(ab') 2 , Fv or scFv.
- antibody as used herein includes both antibodies and antigen binding fragments thereof.
- antibody encompasses various forms of antibodies including, without being l imited to, whole antibodies, antibody fragments, in particular antigen bindi ng fragments, human antibodies, chimeric antibodies, humanized antibodies, recombinant antibodies and genetical ly engineered antibodies (variant or mutant antibodies) as long as the characteristic properties according to the i nvention are retained.
- Monoclonal antibodies are preferred and especially preferred are monoclonal antibodies with human CDRs or human variable regions.
- antibodies, or antigen binding fragments thereof, according to the present invention are preferably derived from human antibodies (i.e., they comprise CDRs and/or variable regions of human antibodies).
- antibodies, or antigen binding fragments thereof, according to the present invention also comprise constant regions of human antibodies.
- all constant and variable regions of the antibodies, or antigen binding fragments thereof, according to the present invention are of human origin, i.e. human constant and human variable regions, such as constant and variable regions of a human antibody.
- Human antibodies are well-known in the state of the art (van Dijk, M. A., and van de Winkel, J. G., Curr. Opin. Chem. Biol. 5 (2001 ) 368-374). Human antibodies can also be produced in transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire or a selection of human antibodies in the absence of endogenous immunoglobulin production. Transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge (see, e.g., Jakobovits, A., et al., Proc. Natl. Acad. Sci.
- human monoclonal antibodies are also available for the preparation of human monoclonal antibodies (Cole et al ., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1 985); and Boerner, P., et al., Immunol. 147 (1 991 ) 86-95).
- human monoclonal antibodies are prepared by using improved EBV-B cell immortalization as described in Traggiai E, Becker S, Subbarao K, Kolesnikova L, Uematsu Y, Gismondo MR, Murphy BR, Rappuoli R, Lanzavecchia A. (2004): An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus. Nat Med.
- human antibody as used herein also comprises such antibodies which are modified, e.g. in a variable region or in a constant region, to generate the properties according to the invention as described herein.
- Antibodies of the invention can be of any isotype ⁇ e.g., IgA, IgG, IgM i.e. an ⁇ , ⁇ or ⁇ heavy chain), but will preferably be IgG. Within the IgG isotype, antibodies may be lgG1 , lgG2, lgG3 or lgG4 subclass, whereby IgGI is preferred.
- Antibodies of the invention may have a or a ⁇ light chain.
- the antibody according to the present invention may be a purified antibody or a single chain antibody, such as a bispecific single-chain Fv fragment (scFv).
- scFv bispecific single-chain Fv fragment
- the invention also provides fragments of the antibodies of the invention, particularly fragments that retain the antigen-binding activity of the antibodies.
- fragments of the antibodies of the invention may, in some places, refer explicitly to antigen binding fragment(s), antibody fragment(s), variant(s) and/or derivative(s) of antibodies, it is understood that the term "antibody” or “antibody of the invention” includes all categories of antibodies, namely, antigen binding fragment(s), antibody fragment(s), variant(s) and derivative(s) of antibodies.
- Fragments of the antibodies of the invention can be obtained from the antibodies by methods that include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction.
- fragments of the antibodies can be obtained by cloning and expression of part of the sequences of the heavy or light chains.
- the i nvention includes a bispecific scFv comprising the CDRs from an antibody of the invention.
- Antibody fragments of the invention may impart monovalent or multivalent interactions and be contained in a variety of structures.
- scFv molecules may be synthesized to create a trivalent "triabody” or a tetravalent "tetrabody.”
- the scFv molecules may include a domain of the Fc region resulting in bivalent minibodies.
- Antibodies according to the present invention may be provided in purified form. Typical ly, the antibody wi ll be present in a composition that is substantially free of other polypeptides e.g., where less than 90% (by weight), usually less than 60% and more usually less than 50% of the composition is made up of other polypeptides.
- Antibodies according to the present i nvention may be immunogenic in human and/or i n non-human (or heterologous) hosts e.g., in mice.
- the antibodies may have an idiotope that is immunogenic in non-human hosts, but not in a human host.
- Antibodies of the invention for human use include those that cannot be easily isolated from hosts such as mice, goats, rabbits, rats, non-primate mammals, etc. and cannot generally be obtained by humanization or from xeno-mice.
- neutralizing antibody is one that can neutralize, i.e., prevent, inhibit, reduce, impede or interfere with, the ability of a pathogen to initiate and/or perpetuate an infection in a host.
- neutralizing antibody and “an antibody that neutralizes” or “antibodies that neutralize” are used interchangeably herein. These antibodies can be used alone, or in combination, as prophylactic or therapeutic agents upon appropriate formulation, in association with active vaccination, as a diagnostic tool, or as a production tool as described herein.
- a dose which is expressed as [g, mg, or other unit]/kg (or g, mg etc.) usually refers to [g, mg, or other unit] "per kg (or g, mg etc.) bodyweight", even if the term "bodyweight” is not explicitly mentioned.
- the term "vaccine” as used herein is typically understood to be a prophylactic or therapeutic material providing at least one antigen, preferably an immunogen.
- the antigen or immunogen may be derived from any material that is suitable for vaccination.
- the antigen or immunogen may be derived from a pathogen, such as from bacteria or virus particles etc., or from a tumor or cancerous tissue.
- the antigen or immunogen stimulates the body's adaptive immune system to provide an adaptive immune response.
- an "antigen” or an “immunogen” refers typically to a substance which may be recognized by the immune system, preferably by the adaptive immune system, and which is capable of triggering an antigen-specific immune response, e.g. by formation of antibodies and/or antigen-specific T cells as part of an adaptive immune response.
- an antigen may be or may comprise a peptide or protein which may be presented by the MHC to T-cells.
- sequence variant refers to any alteration in a reference sequence, whereby a reference sequence is any of the sequences listed in the "Tables of Sequences and SEQ ID Numbers" (sequence listing), i.e. SEQ ID NO: 1 to SEQ ID NO: 273.
- sequence variant includes nucleotide sequence variants and amino acid sequence variants.
- sequence variants referred to herein are in particular functional sequence variants, i.e. sequence variants maintaining the biological function of, for example, the antibody.
- such a maintained biological function is preferably the neutralization of ZIKV infection and/or the binding of the antibody to the ZIKV E protein.
- Preferred sequence variants are thus functional sequence variants having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity to a reference sequence.
- sequence variant thereof having at least 70%>, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%>, at least 95%>, at least 96%, at least 97%, at least 98% or at least 99% sequence identity
- sequence variant means (i) that the sequence variant is functional as described herein and (ii) the higher the % sequence identity, the more preferred the sequence variant.
- the phrase "functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%o, at least 90%, at least 92%, at least 95%>, at least 96%>, at least 97%, at least 98% or at least 99%> sequence identity” means in particular that the functional sequence variant has at least 70% sequence identity, preferably at least 75% sequence identity, preferably at least 80% sequence identity, more preferably at least 85% sequence identity, more preferably at least 88% sequence identity, even more preferably at least 90 % sequence identity, even more preferably at least 92% sequence identity, still more preferably at least 95% sequence identity, still more preferably at least 96% sequence identity, particularly preferably at least 97% sequence identity, particularly preferably at least 98% sequence identity and most preferably at least 99% sequence identity to the respective reference sequence.
- sequence variant includes in particular such variants that comprise mutations and/or substitutions in comparison to the reference sequence.
- exemplary variants of an Fc moiety sequence include, but are not limited to, those that have an L to A substitution at position CH2 4, CH2 5, or both.
- nucleotide sequence variant has an altered sequence in which one or more of the nucleotides in the reference sequence is deleted, or substituted, or one or more nucleotides are inserted into the sequence of the reference nucleotide sequence. Nucleotides are referred to herein by the standard one-letter designation (A, C, G, or T). Due to the degeneracy of the genetic code, a "nucleotide sequence variant" can either result in a change in the respective reference amino acid sequence, i .e. in an "amino acid sequence variant” or not.
- Preferred sequence variants are such nucleotide sequence variants, which do not result in amino acid sequence variants (si lent mutations), but other non-silent mutations are withi n the scope as well, in particular mutant nucleotide sequences, which result in an amino acid sequence, which is at least 80%, preferably at least 90 %, more preferably at least 95% sequence identical to the reference sequence.
- amino acid sequence variant has an altered sequence in which one or more of the amino acids in the reference sequence is deleted or substituted, or one or more amino acids are inserted into the sequence of the reference amino acid sequence.
- the amino acid sequence variant has an amino acid sequence which is at least 80% identical to the reference sequence, preferably, at least 90% identical, more preferably at least 95% identical, most preferably at least 99% identical to the reference sequence.
- Variant sequences which are at least 90% identical have no more than 1 0 alterations, i.e. any combination of deletions, insertions or substitutions, per 1 00 amino acids of the reference sequence.
- the substitutions be conservative amino acid substitutions, in which the substituted amino acid has simi lar structural or chemical properties with the corresponding amino acid in the reference sequence.
- conservative amino acid substitutions involve substitution of one al iphatic or hydrophobic amino acids, e.g. alanine, valine, leucine and isoleucine, with another; substitution of one hydoxyl-containing amino acid, e.g. serine and threonine, with another; substitution of one acidic residue, e.g. glutamic acid or aspartic acid, with another; replacement of one amide-contai ning residue, e.g.
- asparagine and glutami ne with another; replacement of one aromatic residue, e.g. phenylalanine and tyrosine, with another; replacement of one basic residue, e.g. lysine, arginine and histidine, with another; and replacement of one small amino acid, e.g., alanine, serine, threonine, methionine, and glycine, with another.
- one aromatic residue e.g. phenylalanine and tyrosine
- basic residue e.g. lysine, arginine and histidine
- replacement of one small amino acid e.g., alanine, serine, threonine, methionine, and glycine
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- Examples of termi nal insertions include the fusion to the N- or C-terminus of an amino acid sequence to a reporter molecule or an enzyme.
- the alterations in the sequence variants do not abolish the functionality of the respective reference sequence, in the present case, e.g., the functionality of a sequence of an antibody, or antigen binding fragment thereof, to bind to the same epitope and/or to sufficiently neutralize infection of ZIKV.
- Guidance in determining which nucleotides and amino acid residues, respectively, may be substituted, i nserted or deleted without abolishing such functional ity are found by using computer programs well known in the art.
- nucleic acid sequence or an amino acid sequence "derived from” a designated nucleic acid, peptide, polypeptide or protein refers to the origin of the nucleic acid, peptide, polypeptide or protein.
- the nucleic acid sequence or amino acid sequence which is derived from a particular sequence has an amino acid sequence that is essentially identical to that sequence or a portion thereof, from which it is derived, whereby "essentially identical" i ncludes sequence variants as defined above.
- nucleic acid sequence or amino acid sequence which is derived from a particular peptide or protei n is derived from the corresponding domain in the particular peptide or protein.
- “corresponding" refers in particular to the same functionality.
- an "extracellular domain” corresponds to another "extracellular domain” (of another protein), or a “transmembrane domain” corresponds to another “transmembrane domain” (of another protein).
- “Corresponding” parts of peptides, proteins and nucleic acids are thus easily identifiable to one of ordinary skill in the art.
- sequences "derived from” other sequence are usually easily identifiable to one of ordinary skill in the art as having its origin in the sequence.
- a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may be identical to the starting nucleic acid, peptide, polypeptide or protein (from which it is derived).
- a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may also have one or more mutations relative to the starting nucleic acid, peptide, polypeptide or protein (from which it is derived), in particular a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may be a functional sequence variant as described above of the starting nucleic acid, peptide, polypeptide or protein (from which it is derived).
- one or more amino acid residues may be substituted with other amino acid residues or one or more amino acid residue insertions or deletions may occur.
- mutation relates to a change in the nucleic acid sequence and/or in the amino acid sequence in comparison to a reference sequence, e.g. a corresponding genomic sequence.
- a mutation e.g. in comparison to a genomic sequence, may be, for example, a (naturally occurring) somatic mutation, a spontaneous mutation, an induced mutation, e.g. induced by enzymes, chemicals or radiation, or a mutation obtained by site- directed mutagenesis (molecular biology methods for making specific and intentional changes in the nucleic acid sequence and/or in the amino acid sequence).
- mutation or “mutating” shall be understood to also include physically making a mutation, e.g.
- a mutation includes substitution, deletion and insertion of one or more nucleotides or amino acids as well as inversion of several successive nucleotides or amino acids.
- a mutation may be introduced into the nucleotide sequence encoding said amino acid sequence in order to express a (recombinant) mutated polypeptide.
- a mutation may be achieved e.g., by altering, e.g., by site-directed mutagenesis, a codon of a nucleic acid molecule encoding one amino acid to result in a codon encoding a different amino acid, or by synthesizing a sequence variant, e.g., by knowing the nucleotide sequence of a nucleic acid molecule encoding a polypeptide and by designing the synthesis of a nucleic acid molecule comprising a nucleotide sequence encoding a variant of the polypeptide without the need for mutating one or more nucleotides of a nucleic acid molecule.
- the present invention is based, amongst other findings, on the discovery that multispecific antibodies, and antigen-binding fragments thereof, that bind specifically to distinct Zika virus epitopes. Such antibodies minimize or eliminate the generation of Zika virus escape mutants. In particular, there is currently no prevention/treatment available for Zika virus infection.
- the antibodies according to the present invention are highly effective in preventing as well as treating or attenuating Zika virus infection. Moreover, due to the specificity of the antibodies for Zika virus, they do not elicit ADE, but rather block ADE.
- the present invention provides an isolated multispecific antibody, or an antigen binding fragment thereof, that specifically binds to distinct Zika virus epitopes.
- the present invention provides an isolated multispecific antibody, or an antigen binding fragment thereof, that comprises at least two epitope binding sites, which specifically bind to distinct Zika virus epitopes.
- multispecific antibodies are able to bind to at least two different epitopes.
- the multispecific antibodies specifically bind to (at least two) distinct Zika virus epitopes.
- the term "multispecific” refers to the ability to bind to at least two different epitopes, e.g.
- the multispecific antibodies, or the antigen binding fragments thereof, according to the present invention bind to at least two different epitopes on the same ZIKV protein, most preferably to at least two different epitopes on Zika virus envelope (E) protein.
- E Zika virus envelope
- the antibody, or antigen binding fragment thereof, according to the present invention is bispecific, trispecific, tetraspecific or pentaspecific, more preferably the antibody, or the antigen binding fragment thereof, is bispecific, trispecific or tetraspecific, even more preferably the antibody, or the antigen binding fragment thereof, is bispecific or trispecific, and most preferably the antibody, or the antigen binding fragment thereof, is bispecific.
- bispecific trispecific
- tetraspecific refers to the number of different epitopes to which the antibody, or the antigen binding fragment thereof, can bind to.
- conventional monospecific IgG-type antibodies have two identical epitope binding sites (paratopes) and can, thus, only bind to identical epitopes (but not to different epitopes).
- a multispecific antibody in contrast, has at least two different types of epitope binding sites (paratopes) and can, thus, bind to at least two different epitopes.
- paratope refers to an epitope-binding site of the antibody.
- the terms “paratope” and “epitope binding site” are used herein interchangeably.
- a single “specificity” may refer to one, two, three or more identical paratopes in a single antibody.
- the actual number of paratopes in one single antibody molecule is referred to as "valency".
- the antibody, or antigen binding fragment thereof, according to the present invention is bivalent, trivalent, tetravalent, hexavalent or octavalent, more preferably, the antibody, or the antigen binding fragment thereof, is bivalent or tetravalent, most preferably, the antibody, or the antigen binding fragment thereof, is tetravalent.
- the antibody, or antigen binding fragment thereof, according to the present invention is bispecific and tetravalent.
- the antibody, or antigen binding fragment thereof, according to the present invention comprises exactly two (identical) copies of each of the distinct epitope binding sites specifically binding to at least two distinct, Zika virus epitopes.
- a single native IgG antibody is monospecific and bivalent, since it has two identical paratopes (two identical copies).
- a multispecific antibody comprises at least two (different) paratopes.
- the term “multispecific” refers to antibodies, and antigen binding fragments, having more than one paratope and the ability to bind to two or more different epitopes.
- the term “multispecific antibodies/antigen binding fragments” comprises in particular bispecific antibodies as defined above, but typically also protein, e.g. antibody, scaffolds, which bind in particular to three or more different epitopes, i.e. antibodies having three or more paratopes.
- the multispecific antibody, or the antigen binding fragment thereof may comprise two or more paratopes, wherein some paratopes may be identical so that all paratopes of the antibody belong to at least two different types of paratopes and, hence, the antibody has at least two specificities.
- the multispecific antibody or antigen binding fragment thereof according to the present invention may comprise four paratopes, wherein each two paratopes are identical (i.e. have the same specificity) and, thus, the antibody or fragment thereof is bispecific and tetravalent (two identical paratopes for each of the two specificities).
- one specificity refers in particular to one or more paratopes exhibiting the same specificity (which typically means that such one or more paratopes are identical) and, thus, “two specificities” may be realized by two, three, four five, six or more paratopes as long as they refer to only two specificities.
- a multispecific antibody may comprise one single paratope for each (of the at least two) specificity, i.e. the multispecific antibody comprises in total at least two paratopes.
- a bispecific antibody comprises one single paratope for each of the two specificities, i.e. the antibody comprises in total two paratopes.
- the antibody comprises exactly two (identical) paratopes for each of the two specificities, i.e. the antibody comprises in total four paratopes.
- the antibody may comprise three (identical) paratopes for each of the two specificities, i.e. the antibody comprises in total six paratopes.
- the term "antigen” refers to any structural substance which serves as a target for the receptors of an adaptive immune response, in particular as a target for antibodies, T cell receptors, and/or B cell receptors.
- An “epitope”, also known as “antigenic determinant”, is the part (or fragment) of an antigen that is recognized by the immune system, in particular by antibodies, T cell receptors, and/or B cell receptors.
- one antigen has at least one epitope, i.e. a single antigen has one or more epitopes.
- An antigen may be (i) a peptide, a polypeptide, or a protein, (ii) a polysaccharide, (iii) a lipid, (iv) a lipoprotein or a lipopeptide, (v) a glycolipid, (vi) a nucleic acid, or (vii) a small molecule drug or a toxin.
- an antigen may be a peptide, a protein, a polysaccharide, a lipid, a combination thereof including lipoproteins and glycolipids, a nucleic acid (e.g.
- the antigen is selected from (i) a peptide, a polypeptide, or a protein, (ii) a polysaccharide, (iii) a lipid, (iv) a lipoprotein or a lipopeptide and (v) a glycolipid; more preferably, the antigen is a peptide, a polypeptide, or a protein.
- the antibody, or the antigen binding fragment thereof, according to the present invention binds to at least two different Zika virus epitopes.
- the at least to different Zika virus epitopes may be located on different Zika virus antigens, such as different Zika virus (ZIKV) proteins, or on the same Zika virus antigen, e.g. on the same ZIKV protein.
- ZIKV antigens/proteins include capsid, prM, envelope and the non-structural proteins NS1 , NS2A, NS2B, NS3, NS4A, NS4B, NS5 and NS5B.
- the antibody, or the antigen binding fragment thereof, according to the present invention binds to (at least two) distinct epitopes on Zika virus envelope protein (ZIKV E protein).
- ZIKV E protein Zika virus envelope protein
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises at least two epitope binding sites, which specifically bind to distinct epitopes on Zika virus envelope protein (ZIKV E protein).
- ZIKV includes a nucleocapsid core, which comprising single-stranded RNA wrapped by core proteins. The nucleocapsid core is encapsulated by a lipid bilayer membrane with "membrane proteins" and "envelope proteins”.
- ZIKV envelope protein (E protein) is the dominant antigen.
- ZIKV E protein The structure and domains of ZIKV E protein is described, for example, in Dai L, Song J, Lu X, Deng YQ, Musyoki AM, Cheng H, Zhang Y, Yuan Y, Song H, Haywood J, Xiao H, Yan J, Shi Y, Qin CF, Qi J, Gao GF. Structures of the Zika Virus Envelope Protein and Its Complex with a Flavivirus Broadly Protective Antibody. Cel l Host Microbe. 201 6 May 1 1 ;1 9(5):696-704.
- the (at least two) distinct Zika virus epitopes, to which the antibody, or the antigen binding fragment thereof, according to the present invention, binds to are non-overlapping epitopes.
- the amino acids formi ng the first Zika virus epitope, to which the antibody, or the antigen binding fragment thereof, according to the present invention, bi nds to are distinct from the amino acids forming the second Zika virus epitope, to which the antibody, or the antigen binding fragment thereof, according to the present invention, bi nds to.
- the antibody, or the antigen binding fragment thereof, according to the present invention may be of any antibody format.
- multispecific antibodies preferably encompass "whole" antibodies, such as whole IgG- or IgG-like molecules, whi le antigen binding fragments in the context of the present invention preferably refer to smal l recombinant formats, such as a format based on bispecific T-cell engagers (BiTE®s; except that in the context of the present invention both specificities target Zika virus, accordingly, the T-cell specificity of BiTE®s may be replaced by a (second) ZIKV specificity), tandem single chain variable fragment molecules (taFvs), diabodies (Dbs), single chain diabodies (scDbs) and various other derivatives of these (cf. bispecific antibody formats as described by Byrne H. et al.
- bispecific antibody formats include, but are not limited to, Fabs-in-tandem-lg, DVD-lg, quadroma, chemically coupled Fab (fragment antigen binding), and BiTE® (bispecific T cell engager).
- the antibody is preferably a Fabs-in-tandem-lg (FIT-lg) or a DVD-lg.
- the antibody, or the antigen binding fragment thereof, according to the present invention may be selected from bispecific IgG-like antibodies (BslgG) comprising CrossMab; DAF (two- in-one); DAF (four-in-one); DutaMab; DT-lgG; Knobs-in-holes common LC; Knobs-in-holes assembly; Charge pair; Fab-arm exchange; SEEDbody; Triomab; LUZ-Y; Fcab; ⁇ -body; and Orthogonal Fab.
- BslgG bispecific IgG-like antibodies
- the antibody, or the antigen binding fragment thereof, according to the present invention may be selected from bispecific antibody fragments comprising Nanobody; Nanobody-HAS; BiTE; Diabody; DART; TanclAb; scDiabody; sc-Diabody-CH3; Diabody- CH3; Triple Body; Miniantibody; Minibody; TriBi minibody; scFv-CH3 KIH; Fab-scFv; scFv- CH-CL-scFv; F(ab')2; F(ab')2-scFv2; scFv-KIH; Fab-scFv-Fc; Tetravalent HCAb; scDiabody- Fc; Diabody-Fc; Tandem scFv-Fc; and Intrabody.
- bispecific antibody fragments comprising Nanobody; Nanobody-HAS; BiTE; Diabody; DART; TanclAb; scDiabody; sc-Diabody-CH3; Diabody- CH
- the antibody, or the antigen binding fragment thereof, according to the present invention may be selected from IgG-appended antibodies with an additional antigen- binding moiety comprising DVD-lgG; lgG(H)-scFv; scFv-(H)lgG; lgG(L)-scFv; scFV-(L)lgG; lgG(L,H)-Fv; !gG(H)-V; V(H)-lgG; lgG(L)-V; V(L)-lgG; KIH IgG-scFab; 2scFv-lgG; lgG-2scFv; scFv4-lg; scFv4-lg; Zybody; and DVI-lgG (four-in-one).
- This antibody format is described in detai l, for example, in Wu C, Ying H, Grinnell C, Bryant S, Miller R, Clabbers A, Bose S, McCarthy D, Zhu RR, Santora L, Davis- Taber R, Kunes Y, Fung E, Schwartz A, Sakorafas P, Gu J, Tarcsa E, Murtaza A, Ghayur T. Simultaneous targeting of multiple disease mediators by a dual-variable-domain immunoglobulin. Nat Biotechnol. 2007 Nov;25(1 1 ):1290-7; or in DiGiammarino E, Ghayur T, Liu J. Design and generation of DVD-lgTM molecules for dual-specific targeting.
- the antibody, or the antigen binding fragment thereof, according to the present invention is an IgG-appended antibody of the Fabs-in-tandem-lg (FIT-lg) format.
- the antibody, or the antigen binding fragment thereof, accordi ng to the present invention is most preferably of the Fabs-in-tandem-lg (FIT-lg) format.
- Fabs-in-tandem-lg (FIT-lg) format is described in detai l, for example, in WO 201 5/103072 A1 , which is incorporated by reference herein in its entirety, or in Gong S, Ren F, Wu D, Wu X, Wu C: Fabs-in-tandem immunoglobulin is a novel and versatile bispecific design for engaging multiple therapeutic targets.
- Polypeptide 2 usually comprises the heavy chain variable and CH I regions of the outer Fab
- polypeptide 3 usually comprises by the light chain of the inner Fab.
- an antibody of the FIT-lg format usually comprises an "inner Fab” and an "outer Fab".
- the antibody according to the present invention neutralizes Zika virus infection.
- the antibody, or the antigen binding fragment thereof, according to the present invention reduces preferably viral infectivity of Zika virus.
- neutralization assay animal viruses are typically propagated in cells and/or cell lines.
- a neutralization assay is preferred, wherein cultured cells are incubated with a fixed amount of Zika virus (Z1KV) in the presence (or absence) of the antibody to be tested.
- Z1KV Zika virus
- flow cytometry may be used.
- other readouts are conceivable, such as determining the amount of ZIKV non-structural proteins (such as ZI KV NS1 ) secreted into culture supernatant.
- a ZIKV nonstructural protein 1 (NS1 ) antigen capture enzyme-linked immunosorbent assay (ELISA)-based tissue culture infectious dose-50 (TCID50) test may be used as an alternative to the standard plaque assay for titrating Zika virus - in a similar manner as described for dengue virus (DENV) by Li J, Hu D-M, Ding X-X, Chen Y, Pan Y-X, Qiu L-W, Che X-Y: Enzyme-linked immunosorbent assay-format tissue culture infectious dose-50 test for titrating dengue virus.
- DEV dengue virus
- a ZIKV neutralization assay cultured cel ls, for example Vero cells, are incubated with a fixed amount of ZIKV in the presence or absence of the antibody to be tested, for example for about four days. After incubation, cells may be washed and further cultivated. To measure virus infectivity, flow cytometry may be used. To this end, cells may be fixed, e.g. with 2% formaldehyde, permeabi lizes, e.g.
- Cel ls may then be incubated with a goat anti-mouse IgG conjugated to a dye, such as Alexa Fluor488 and analyzed by flow cytometry.
- viable cells may be detected by flow cytometry using for example the VVST-1 reagent (Roche).
- a preferred ZIKV strain to be used in such a neutralization assay is ZIKV H/PF/201 3.
- the antibody and antigen binding fragment of the invention have high neutralizing potency.
- the concentration of the antibody required for 50% neutralization of Zika virus (IC 5 o) as compared to no-antibody controls is, for example, up to about 3 pg/ml or up to about 1 pg/ml.
- the concentration of the antibody of the invention required for 50% neutralization of ZIKV (ICso) is up to about 500 ng/ml, more preferably the concentration of the antibody of the invention required for 50% neutralization of ZIKV (IC 5 o) is up to about 250 ng/ml, even more preferably the concentration of the antibody of the invention required for 50% neutralization of ZIKV (IC 5 o) is up to about 150 ng/ml.
- the concentration of the antibody of the invention required for 50% neutralization of ZIKV is about 100 ng/ml or less, e.g. about 90 ng/ml or less, about 80 ng/ml or less, about 70 ng/ml or less, about 60 ng/ml or less, about 50 ng/ml or less, about 45 ng/ml or less, about 40 ng/ml or less, about 35 ng/ml or less, about 30 ng/ml or less, about 25 ng/ml or less, about 20 ng/ml or less or, particularly preferably, about 1 5 ng/ml or less.
- the concentration of the antibody of the invention required for 50% neutralization of ZIKV is preferably about 50 ng/ml or less. This means that only low concentrations of the antibody are required for 50% neutralization of ZIKV.
- concentration of the antibody of the invention required for 50% neutralization of ZIKV can be measured using standard neutralization assays as known to one of skill in the art or, in particular, as described above.
- binding of an antibody may be assessed by use of a standard ELISA (enzyme-linked immunosorbent assay), which is well-known to the skilled person.
- An exemplary standard ELISA may be performed as follows: ELISA plates may be coated (e.g., overnight at 4°C) with a sufficient amount (e.g., 1 pg/ml) of the protein/complex/particle to which binding of the antibody is to be tested (for example, for DENV binding as outlined below, DENV E proteins and/or DENV VLPs are used), e.g. in PBS. Plates may then be blocked, e.g.
- Bovine Serum Albumin BSA
- BSA Bovine Serum Albumin
- Plates may then be washed, the required substrate (e.g., p-NPP) may be added and plates may be read, e.g. at 405 nm.
- the relative affinities of antibody binding may be determined by measuring the concentration of mAb (ECso) required to achieve 50% maximal binding at saturation.
- the ECso values may be calculated by interpolation of binding curves fitted with a four-parameter nonlinear regression with a variable slope.
- the antibody, or an antigen binding fragment thereof, according to the present invention does essentially not bind to Dengue virus-like particles and/or to Dengue envelope protein. More preferably, the antibody, or an antigen binding fragment thereof, according to the present invention does essentially not bind to Dengue virus-like particles and/or to Dengue envelope protein of any of the four DENV serotypes DENV1 , DENV2, DENV3 and DENV4.
- essentially not binding means that for the antibody, or an antigen binding fragment thereof, no EC 5 o-value up to 10 2 ng/ml, preferably up to 10 3 ng/ml, more preferably up to 5*10 3 ng/ml, even more preferably up to 8*10 3 ng/ml, and most preferably up to 1 0 4 ng/ml can be determined in a standard ELISA to Dengue virus-like particles (DENV VLP) and/or to Dengue envelope protein (DENV E protein).
- the concentration of the antibody, or an antigen binding fragment thereof, required to achieve 50% maximal binding at saturation (ECso) to Dengue virus-like particles (DENV VLP) and/or to Dengue envelope protein (DENV E protein) in a standard ELISA is typically more than 10 2 ng/ml, preferably more than 10 3 ng/ml, more preferably more than 5*10 3 ng ml, even more preferably more than 8*10 3 ng/ml, and most preferably more than 10 4 ng/ml.
- the antibody, or an antigen binding fragment thereof, according to the present invention does not contribute to antibody-dependent enhancement (ADE) of Zika virus infection. More preferably, the antibody, or an antigen binding fragment thereof, according to the present invention blocks antibody-dependent enhancement (ADE) of Zika virus infection.
- AD antibody-dependent enhancement
- ADE may be assessed by a flow-cytometry based assay using, for example cultured cells or cell lines, such as K562 cells.
- the antibodies to be tested and ZIKV may be mixed for 1 hour at 37°C and added to 5000 K562 cells/well. After four days, cells may be fixed, permeabilized, and stained with m4G2, e.g. as described above for neutralization assays. The number of infected cells was determined by flow cytometry, as described above for neutralization assays.
- the antibody according to the present invention eliminates generation of ZIKV escape mutants. Elimination of generation of escape mutants can easily be assessed by the person skilled in the art. For example, to identify the propensity of an antibody or antibody fragment to generate escape mutants, ZIKV is repeatedly passaged in the presence of sub-neutralizing concentrations of the antibody or antigen binding fragment thereof of interest. As shown in examples 10 and 1 1 of the present application, ZIKV escape mutants ("MARMs") typically appear afterthe third or fourth passage of ZIKV.
- MAMs ZIKV escape mutants
- an antibody can be considered to eliminate the generation of ZIKV escape mutants, if even after five passages of the virus (ZIKV) in presence of sub-neutralizing concentrations of that antibody or antigen binding fragment thereof, no ZIKV escape mutants can be identified. More preferably, no ZIKV escape mutants can be identified after six passages of the virus (ZIKV) in presence of sub-neutralizing concentrations of the antibody, or antigen binding fragment thereof, according to the present invention. Even more preferably, no ZIKV escape mutants can be identified after seven passages of the virus (ZIKV) in presence of sub-neutralizing concentrations of the antibody, or antigen binding fragment thereof, according to the present invention. Most preferably, no ZIKV escape mutants can be identified after eight passages of the virus (ZIKV) in presence of sub-neutralizing concentrations of the antibody, or antigen binding fragment thereof, according to the present invention.
- ZIKV for example strain H/PF/2013
- various sub-neutralizing concentrations of the antibody/antigen binding fragment of interest e.g., for at least 30 min, for example, at about 37°C (body temperature).
- (living) cells for example Vero cells
- incubation e.g. for at least one day, preferably 3 - 4 days, for example, at about 37°C (body temperature) to allow virus propagation to occur.
- supernatants from three conditions may be selected: the lowest concentration of the antibody/antigen binding fragment of interest at which full protection of the monolayer was observed, one concentration at which a partial CPE effect on the cell monolayer was observed and one concentration at which 100% of the cell monolayer was destroyed by the ZIKV CPE.
- One part of the selected supernatant can be used for micro-neutralization assays and subsequent sequencing of the virus (to identify escape mutants), while another part of the (same) selected supernatant can be used for the next selection step (passage).
- (a part of the) selected supernatant can be mixed with the various sub- neutralizing concentrations of the antibody/antigen binding fragment of interest and incubated, as described above, followed by addition of (living) cells and incubation as described above, to finally again select supernatants.
- This selection and propagation process is repeated to arrive at least at five passages, preferably at least six passages, more preferably at least seven passages, and most preferably at least eight passages.
- each CDR or each variable region of at least one epitope binding site of the antibody, or an antigen binding fragment thereof, according to the present invention is a human CDR or a human variable region, respectively. More preferably, each CDR or each variable region comprised in the antibody, or an antigen binding fragment thereof, according to the present invention is a human CDR or a human variable region, respectively. Most preferably, all constant regions and variable regions comprised in the antibody, or an antigen binding fragment thereof, according to the present invention are a human constant regions and human variable regions.
- the antibody, or an antigen binding fragment thereof, according to the present invention is a monoclonal antibody, preferably a monoclonal antibody wherein each CDR or each variable region comprised in the antibody, or an antigen binding fragment thereof, according to the present invention is a human CDR or a human variable region, respectively.
- the antibody, or the antigen binding fragment thereof, according to the present invention is of the IgG type, such as lgG1 type, lgG2 type, lgG3 type, or lgG4 type, more preferably of the lgG1 type.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (i) a heavy chain constant region of the lgG1 CH1 -CH2-CH3 type, wherein "CH1 " refers to the constant domain 1 of the heavy chain, “CH2” refers to the constant domain 2 of the heavy chain, and “CH3” refers to the constant domain 3 of the heavy chain; and (ii) a light chain constant region of the IgG CL type, wherein “CL” refers to the constant domain of the light chain.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain constant region of the lgG1 CH1 -CH2-CH3 type comprising or consisting of an amino acid sequence according to SEQ ID NO: 91 or 92, or a functional sequence variant thereof, and a light chain constant region of the IgG CL type comprising or consisting of an amino acid sequence according to SEQ ID NO: 93 or 94, or a functional sequence variant thereof.
- the antibody according to the present invention comprises an Fc moiety.
- the Fc moiety is derived from human origin, e.g. from human IgGI , lgG2, lgG3, and/or lgG4, whereby human IgGI is particularly preferred.
- Various multispecific antibody formats comprising an Fc moiety are known in the art.
- Preferred antibody formats comprising an Fc moiety are the IgG-appended antibody formats described above.
- an antibody comprising an Fc moiety is more effective and displays a longer half-life than antibodies or antibody fragments without Fc moiety.
- an Fc moiety refers to a sequence derived from the portion of an immunoglobulin heavy chain beginning in the hinge region just upstream of the papain cleavage site (e.g., residue 2 ⁇ 6 in native IgG, taking the first residue of heavy chain constant region to be 1 14) and ending at the C-terminus of the immunoglobulin heavy chain. Accordingly, an Fc moiety may be a complete Fc moiety or a portion (e.g., a domain) thereof. A complete Fc moiety comprises at least a hinge domain, a CH2 domain, and a CH3 domain (e.g., EU amino acid positions 21 6-446).
- an Fc moiety comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant, portion, or fragment thereof.
- a hinge e.g., upper, middle, and/or lower hinge region
- a CH2 domain e.g., a CH2 domain
- a CH3 domain e.g., a variant, portion, or fragment thereof.
- an Fc moiety comprises at least a hinge domain, a CH2 domain or a CH3 domain. More preferably, the Fc moiety is a complete Fc moiety.
- the Fc moiety may also comprises one or more amino acid insertions, deletions, or substitutions relative to a naturally-occurring Fc moiety. For example, at least one of a hinge domain, CH2 domain or CH3 domain (or portion thereof) may be deleted.
- an Fc moiety may comprise or consist of: (i) hinge domain (or portion thereof) fused to a CH2 domain (or portion thereof), (ii) a hinge domain (or portion thereof) fused to a CH3 domain (or portion thereof), (iii) a CH2 domain (or portion thereof) fused to a CH3 domain (or portion thereof), (iv) a hinge domain (or portion thereof), (v) a CH2 domain (or portion thereof), or (vi) a CH3 domain or portion thereof.
- the Fc moiety may be modified such that it varies in amino acid sequence from the complete Fc moiety of a naturally occurring immunoglobulin molecule, while retaining at least one desirable function conferred by the naturally-occurring Fc moiety.
- Such functions include Fc receptor (FcR) binding, antibody half-life modulation, ADCC function, protein A binding, protein G binding, and complement binding.
- FcR Fc receptor
- ADCC antibody half-life modulation
- protein A binding protein G binding
- complement binding complement binding.
- C1 q binds to at least two molecules of IgGI or one molecule of IgM, attached to the antigenic target (Ward, E. S., and Ghetie, V., Ther. Immunol. 2 (1 995) 77-94).
- Burton, D. R. described ( Wo/. Immunol. 22 (1 985) 1 61 -206) that the heavy chain region comprising amino acid residues 318 to 337 is involved in complement fixation.
- Duncan, A. R., and Winter, G. ⁇ Nature 332 (1988) 738-740) using site directed mutagenesis, reported that Glu31 8, Lys320 and Lys322 form the binding site to C1 q.
- the role of Glu31 8, Lys320 and Lys 322 residues in the binding of C1 q was confirmed by the ability of a short synthetic peptide containing these residues to inhibit complement mediated lysis.
- FcR binding can be mediated by the interaction of the Fc moiety (of an antibody) with Fc receptors (FcRs), which are specialized cell surface receptors on hematopoietic cells.
- Fc receptors belong to the immunoglobulin superfamily, and were shown to mediate both the removal of antibody-coated pathogens by phagocytosis of immune complexes, and the lysis of erythrocytes and various other cellular targets (e.g. tumor cells) coated with the corresponding antibody, via antibody dependent cell mediated cytotoxicity (ADCC; Van de Winkel, J. G., and Anderson, C. L, /. Leukoc. Biol. 49 (1991 ) 51 1 -524).
- ADCC antibody dependent cell mediated cytotoxicity
- FcRs are defined by their specificity for immunoglobulin classes; Fc receptors for IgG antibodies are referred to as FcyR, for IgE as FCER, for IgA as FcaR and so on and neonatal Fc receptors are referred to as FcRn.
- Fc receptor binding is described for example in Ravetch, J. V., and Kinet, J. P., Annu. Rev. Immunol. 9 (1991 ) 457-492; Capel, P. J., et al., Immunomethods 4 (1994) 25-34; de Haas, M., et al., J Lab. Clin. Med. 126 (1 995) 330-341 ; and Gessner, J. E., et al., Ann. Hematol. 76 (1998) 231 -248.
- FcyR cross-linking of receptors by the Fc domain of native IgG antibodies
- FcyR In humans, three classes of FcyR have been characterized, which are: (i) FcyRI (CD64), which binds monomeric IgG with high affinity and is expressed on macrophages, monocytes, neutrophils and eosinophils; (ii) FcyRll (CD32), which binds complexed IgG with medium to low affinity, is widely expressed, in particular on leukocytes, is known to be a central player in antibody-mediated immunity, and which can be divided into FcyRllA, FcyRIIB and FcyRIIC, which perform different functions in the immune system, but bind with similar low affinity to the IgG-Fc, and the ectodomains of these receptors are highly homologuous; and (iii) FcyRIII (CD1 6), which binds IgG with medium to low affinity and exists as two types: FcyRIIIA found on NK cells, macrophages, eosinophils and some
- FcyRllA is found on many cells involved in killing (e.g. macrophages, monocytes, neutrophils) and seems able to activate the killing process.
- FcyRIIB seems to play a role in inhibitory processes and is found on B-cells, macrophages and on mast cells and eosinophils. Importantly, 75% of all FcyRIIB is found in the liver (Ganesan, L. P. et al., 2012: FcyRllb on liver sinusoidal endothelium clears small immune complexes. Journal of Immunology 1 89: 4981 -4988).
- FcyRIIB is abundantly expressed on Liver Sinusoidal Endothelium, called LSEC, and in Kupffer cells in the liver and LSEC are the major site of small immune complexes clearance (Ganesan, L. P. et al., 2012: FcyRllb on liver sinusoidal endothelium clears small immune complexes. Journal of Immunology 1 89: 4981 -4988). Accordingly, in the present invention such antibodies, and antigen binding fragments thereof, are preferred, which are able to bind to FcyRllb, for example antibodies comprising an Fc moiety for binding to FcyRllb, in particular an Fc region, such as, for example IgG-type antibodies.
- FcyRIIB acts to inhibit phagocytosis as mediated through FcyRIIA.
- eosinophi ls and mast cells the b form may help to suppress activation of these cells through IgE binding to its separate receptor.
- FcyRI binding modification in native IgG of at least one of E233-G236, P238, D265, N297, A327 and P329 reduces binding to FcyRI.
- FcyRII binding reduced binding for FcyRIIA is found e.g.
- FcyRIII binding reduced binding to FcyRIIIA is found e.g. for mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, S239, E269, E293, Y296, V303, A327, K338 and D376.
- two regions of native IgG Fc appear to be critical for interactions of FcyRlls and IgGs, namely (i) the lower hinge site of IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (ii) the adjacent region of the CH2 domain of IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge region, e.g. in a region of P331 (Wines, B.D., et al., J. Immunol. 2000; 1 64: 5313 - 5318).
- FcyRI appears to bind to the same site on IgG Fc
- FcRn and Protein A bind to a different site on IgG Fc, which appears to be at the CH2-CH3 interface
- the Fc moiety may comprise or consist of at least the portion of an Fc moiety that is known in the art to be required for FcRn binding or extended half-life.
- the Fc moiety of the antibody of the invention comprises at least the portion of known in the art to be required for Protein A binding and/or the Fc moiety of the antibody of the invention comprises at least the portion of an Fc molecule known in the art to be required for protein G binding.
- the retained function is the neutralization of Zika virus infection, which is assumed to be mediated by FcyR binding.
- a preferred Fc moiety comprises at least the portion known in the art to be required for FcyR binding.
- a preferred Fc moiety may thus at least comprise (i) the lower hinge site of native IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (ii) the adjacent region of the CH2 domain of native IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge region, e.g. in a region of P331 , for example a region of at least 3, 4, 5, 6, 7, 8, 9, or 10 consecutive amino acids in the upper CH2 domain of native IgG Fc around P331 , e.g. between amino acids 320 and 340 (EU numbering) of native IgG Fc.
- the antibody, or antigen binding fragment thereof, according to the present invention comprises an Fc region.
- Fc region refers to the portion of an immunoglobulin formed by two or more Fc moieties of antibody heavy chains.
- the Fc region may be monomeric or "single-chain" Fc region (i.e., a scFc region).
- Single chain Fc regions are comprised of Fc moieties linked within a single polypeptide chain (e.g., encoded in a single contiguous nucleic acid sequence).
- Exemplary scFc regions are disclosed in WO 2008/143954 A2.
- the Fc region is a dimeric Fc region.
- a “dimeric Fc region” or “dcFc” refers to the dimer formed by the Fc moieties of two separate immunoglobulin heavy chains.
- the dimeric Fc region may be a homodimer of two identical Fc moieties (e.g., an Fc region of a naturally occurring immunoglobulin) or a heterodimer of two non-identical Fc moieties.
- the Fc moieties of the Fc region may be of the same or different class and/or subclass.
- the Fc moieties may be derived from an immunoglobulin (e.g., a human immunoglobulin) of an lgC1 , lgG2, lgG3 or lgG4 subclass.
- the Fc moieties of Fc region are of the same class and subclass.
- the Fc region (or one or more Fc moieties of an Fc region) may also be chimeric, whereby a chimeric Fc region may comprise Fc moieties derived from different immunoglobulin classes and/or subclasses.
- a chimeric Fc region may comprise Fc moieties derived from different immunoglobulin classes and/or subclasses.
- at least two of the Fc moieties of a dimeric or single-chain Fc region may be from different immunoglobulin classes and/or subclasses.
- the chimeric Fc regions may comprise one or more chimeric Fc moieties.
- the chimeric Fc region or moiety may comprise one or more portions derived from an immunoglobulin of a first subclass (e.g., an lgG1 , lgG2, or lgG3 subclass) while the remainder of the Fc region or moiety is of a different subclass.
- an Fc region or moiety of an Fc polypeptide may comprise a CH2 and/or CH3 domain derived from an immunoglobulin of a first subclass (e.g., an lgG1 , lgG2 or lgG4 subclass) and a hinge region from an immunoglobulin of a second subclass (e.g., an lgG3 subclass).
- the Fc region or moiety may comprise a hinge and/or CH2 domain derived from an immunoglobulin of a first subclass (e.g., an lgG4 subclass) and a CH3 domain from an immunoglobulin of a second subclass (e.g., an lgG1 , lgG2, or lgG3 subclass).
- a first subclass e.g., an lgG4 subclass
- a CH3 domain from an immunoglobulin of a second subclass e.g., an lgG1 , lgG2, or lgG3 subclass
- the chimeric Fc region may comprise an Fc moiety (e.g., a complete Fc moiety) from an immunoglobulin for a first subclass (e.g., an lgG4 subclass) and an Fc moiety from an immunoglobulin of a second subclass (e.g., an IgG1, lgG2 or lgG3 subclass).
- the Fc region or moiety may comprise a CH2 domain from an lgG4 immunoglobulin and a CH3 domain from an IgGI immunoglobulin.
- the Fc region or moiety may comprise a CH1 domain and a CH2 domain from an lgG4 molecule and a CH3 domain from an IgGI molecule.
- the Fc region or moiety may comprise a portion of a CH2 domain from a particular subclass of antibody, e.g., EU positions 292-340 of a CH2 domain.
- an Fc region or moiety may comprise amino acids a positions 292-340 of CH2 derived from an lgG4 moiety and the remainder of CH2 derived from an IgGI moiety (alternatively, 292-340 of CH2 may be derived from an IgGI moiety and the remainder of CH2 derived from an lgG4 moiety).
- an Fc region or Fc moiety may (additionally or alternatively) for example comprise a chimeric hinge region.
- the chimeric hinge may be derived, e.g. in part, from an IgGI , lgG2, or lgG4 molecule (e.g., an upper and lower middle hinge sequence) and, in part, from an lgG3 molecule (e.g., an middle hinge sequence).
- an Fc region or moiety may comprise a chimeric hinge derived, in part, from an IgGI molecule and, in part, from an lgG4 molecule.
- the chimeric hinge may comprise upper and lower hinge domains from an lgG4 molecule and a middle hinge domain from an IgGI molecule.
- Such a chimeric hinge may be made, for example, by introducing a proline substitution (Ser228Pro) at EU position 228 in the middle hinge domain of an lgG4 hinge region.
- the chimeric hinge can comprise amino acids at EU positions 233-236 are from an lgG2 antibody and/or the Ser228Pro mutation, wherein the remaining amino acids of the hinge are from an lgG4 antibody (e.g., a chimeric hinge of the sequence ESKYGPPCPPCPAPPVAGP).
- Further chimeric hinges, which may be used in the Fc moiety of the antibody according to the present invention are described in US 2005/01 63783 A1 .
- the Fc moiety comprises or consists of an amino acid sequence derived from a human immunoglobulin sequence (e.g., from an Fc region or Fc moiety from a human IgG molecule).
- polypeptides may comprise one or more amino acids from another mammalian species.
- a primate Fc moiety or a primate binding site may be included in the subject polypeptides.
- one or more murine amino acids may be present in the Fc moiety or in the Fc region.
- the antibody according to the present invention comprises, in particular in addition to an Fc moiety as described above, other parts derived from a constant region, in particular from a constant region of IgG, preferably from a constant region of IgGI , more preferably from a constant region of human IgGI . More preferably, the antibody according to the present invention comprises, in particular in addition to an Fc moiety as described above, al l other parts of the constant regions, in particular all other parts of the constant regions of IgG, preferably all other parts of the constant regions of IgGI , more preferably all other parts of the constant regions of human IgGI .
- amino acid sequences of constant regions are the amino acid sequences accordi ng to SEQ ID NOs: 91 - 94 (encoded, for example, by nucleic acid sequences according to SEQ ID NOs: 95 - 98, respectively).
- amino acid sequence of IgGI CH 1 -CH2-CH3 is according to SEQ ID NO: 9 ⁇ or a functional sequence variant thereof, as described herein.
- amino acid sequence of IgGI CH1 -CH2-CH3 is according to SEQ ID NO: 92 or a functional sequence variant thereof, as described herein, wherein the "LALA" mutation is maintained.
- a particularly preferred antibody according to the present invention comprises a (complete) Fc region derived from human IgGI . More preferably, the antibody according to the present i nvention comprises, in particular in addition to a (complete) Fc region derived from human IgGI also al l other parts of the constant regions of IgG, preferably all other parts of the constant regions of IgGI , more preferably all other parts of the constant regions of human IgGI .
- antibody-dependent enhancement (ADE) of Zika virus infection is brought about by the binding of the Fc moiety of the antibody, in particular, the Fc moiety of the heavy chain of an IgG molecule, to an Fc receptor, e.g., an Fey receptor on a host cel l.
- an Fc receptor e.g., an Fey receptor on a host cel l.
- the antibody according to the present invention, or an antigen binding fragment thereof comprises one or more mutations in the Fc moiety.
- the mutation(s) may be any mutation that reduces binding of the antibody to an Fc receptor (FcR), in particular reduces binding of the antibody to an Fey receptor (FcyR).
- the antibody accordi ng to the present invention comprises a (complete) Fc moiety/Fc region, wherein the interaction/binding with FcRn is not compromised. Accordingly, it is particularly preferred that the antibody according to the present invention, or an antigen binding fragment thereof, comprises one or more mutations in the Fc moiety, which (i) reduce(s) binding of the antibody to an Fey receptor, but do(es) not compromise interaction with FcRn.
- a mutation is the "LALA" mutation described below.
- binding of the antibody to an Fc receptor may be assessed by various methods known to the skilled person, such as ELISA (Hessell AJ, Hangartner L, Hunter M, Havenith CEG, Beurskens FJ, Bakker JM, Lanigan CMS, Landucci G, Forthal DN, Parren PWHI, et al.: Fc receptor but not complement binding is important in antibody protection against H IV.
- ELISA Hessell AJ, Hangartner L, Hunter M, Havenith CEG, Beurskens FJ, Bakker JM, Lanigan CMS, Landucci G, Forthal DN, Parren PWHI, et al.: Fc receptor but not complement binding is important in antibody protection against H IV.
- the antibody according to the present invention may be glycosylated.
- N-linked glycans attached to the CH2 domain of a heavy chain can influence C1 q and FcR binding, with aglycosylated antibodies having lower affinity for these receptors.
- the CH2 domain of the Fc moiety of the antibody according to the present invention may comprise one or more mutations, in which a glycosylated residue is substituted by a non-glycosylated residue.
- the glycan structure can also affect activity e.g. differences in complement-mediated cell death may be seen depending on the number of galactose sugars (0, 1 or 2) at the terminus of a glycan' s biantennary chain.
- the antibody's glycans do not lead to a human immunogenic response after administration.
- the antibody according to the present invention can be modified by introducing random amino acid mutations into particular region of the CH2 or CH3 domain of the heavy chain in order to alter their binding affinity for FcR and/or their serum half-life in comparison to unmodified antibodies.
- modifications include, but are not limited to, substitutions of at least one amino acid from the heavy chain constant region selected from the group consisting of amino acid residues 250, 314, and 428.
- the Fc moiety of an antibody of the invention comprises a substitution at positions CH2 4, CH2 5, or both.
- the amino acid at positions 4 and 5 of CH2 of the wild-type IgGI and lgG3 is a leucine ("L").
- the antibody according to the present invention comprises an amino acid at position CH2 4, CH2 5, or both, that is not an L.
- antibody according to the present invention comprises an alanine ("A") at position CH2 4, or CH2 5, or both.
- the antibody according to the present invention comprises both, a CH2 L4A and a CH2 L5A substitution.
- Such antibodies are referred to herein as a "LALA" variant.
- an exemplary amino acid sequence of IgGI CH1 -CH2-CH3 comprising the "LALA” mutation is according to SEQ ID NO: 92. Accordingly, the amino acid sequence of IgGI CH1 -CF12-CH3 is preferably according to SEQ ID NO: 92 or a functional sequence variant thereof, as described herein, wherein the "LALA” mutation is maintained. Most preferably, the antibody is of the FIT-lg format described above comprising a "LALA" mutation in the Fc moiety as described herein.
- the antibody, or antigen binding fragment thereof, according to the present invention does not comprise a binding site for an Fc receptor. More preferably, the antibody, or antigen binding fragment thereof, does not comprise an Fc region, even more preferably, the antibody, or antigen binding fragment thereof, does not comprise an Fc moiety.
- Fc Fc receptor
- the antibody, or the antigen binding fragment thereof, according to the present invention preferably binds specifically to (at least two) distinct epitopes on Zika virus envelope protein (ZIKV E protein). More preferably, the antibody, or antigen binding fragment thereof, binds to domain III of Zika virus envelope protein (EDI1I, also referred to as "Dill"). In other words, it is preferred that the antibody, or antigen binding fragment thereof, according to the present invention binds to an epitope of Zika virus envelope protein, which includes one or more amino acid residues of domain III of Zika virus envelope protein (EDIII).
- ZIKV includes a nucleocapsid core, which comprising single-stranded RNA wrapped by core proteins.
- the nucleocapsid core is encapsulated by a lipid bilayer membrane with "membrane proteins" and "envelope proteins".
- ZIKV envelope protein (E protein) is the dominant antigen.
- the ectodomain of the envelope protein comprises three distinct domains: E protein domain I (EDI), E protein domain II (EDM), and E protein domain III (EDIII).
- EDIII is highly conserved among different ZIKV strains (see Figure 8 for an alignment of amino acid sequences of EDIII of different ZIKV strains).
- Antibodies binding to domain III of Zika virus envelope protein show (i) increased neutralization of ZIKV and (ii) decreased cross- reactivity with DENV (in particular essentially no cross-reactivity with DENV) as compared to antibodies binding to domain l/ll of Zika virus envelope protein (EDI/11).
- the antibody, or antigen binding fragment thereof more preferably binds to domain III of Zika virus envelope protein (EDIII) with EDIII having the following amino acid sequence (SEQ ID NO: 263):
- X may be any (naturally occurring) amino acid.
- the , the antibody, or antigen binding fragment thereof, according to the present invention binds to an epitope of Zika virus envelope protein, which includes one or more amino acid residues of SEQ ID NO: 263. It is also preferred that the antibody, or antigen binding fragment thereof, according to the present invention binds to domain III of Zika virus envelope protein (EDIII) with EDIII having the following amino acid sequence (SEQ ID NO: 265):
- XI may be any (naturally occurring) amino acid, preferably K, A, or E;
- X2 may be any (natura ly occurring amino acid, preferably V, F, or L;
- X3 may be any (natura ly occurring amino acid, preferably S or F;
- X4 may be any (natura ly occurring amino acid, preferably I or V;
- X5 may be any (natura ly occurring amino acid, preferably T or V;
- X6 may be any (natura ly occurring ' amino acid, preferably L or D;
- X7 may be any (natura ly occurring amino acid, preferably V or G;
- X8 may be any (natura ly occurring amino acid, preferably A or G;
- X9 may be any (natura ly occurring) amino acid except R, preferably T
- XI 0 may be any (naturally occurring) amino acid, preferably V or I;
- X1 1 may be any (naturally occurring) amino acid, preferably A or V;
- X12 may be any (naturally occurring) amino acid, preferably M or T;
- X1 3 may be any (naturally occurring) amino acid, preferably S or G;
- X14 may be any (naturally occurring) amino acid, preferably E or K;
- X15 may be any (naturally occurring) amino acid, preferably V or I;
- X1 6 may be any (naturally occurring) amino acid, preferably E, A, K, or D; and X1 7 may be any (naturally occurring) amino acid, preferably E, A, or K, more preferably K or A.
- the , the antibody, or antigen binding fragment thereof, according to the present invention binds to an epitope of Zika virus envelope protein, which includes one or more amino acid residues of SEQ ID NO: 265.
- EDIII stretches from amino acid 309 to amino acid 403 of ZIKV E protein of the ZIKV H/PF/2013 strain (Genbank accession number KJ776791 ). Accordingly, the antibody, or antigen binding fragment thereof, most preferably binds to domain III of Zika virus envelope protein (EDIII) with EDIII having the following amino acid sequence (SEQ ID NO: 264):
- the antibody, or antigen binding fragment thereof, according to the present invention binds to an epitope of Zika virus envelope protein, which includes one or more amino acid residues of SEQ ID NO: 264. More preferably, the antibody, or antigen binding fragment thereof, according to the present invention binds to an epitope of Zika virus envelope protein, which includes one or more amino acid residues of the lateral ridge (LR) of EDIII and/or one or more amino acid residues of the EDI-EDIII hinge region.
- LR lateral ridge
- the EDIII lateral ridge and EDI-EDIII hinge region are known to the skilled person and described, for example, in Zhao, H., Fernandez, E., Dowd, K.A., Speer, S.D., Piatt, D.J., Gorman, M.J., Govero, J., Nelson, C.A., Pierson, T.C., Diamond, M.S., et al. (201 6). Structural Basis of Zika Virus-Specific Antibody Protection. Cell 1 66(4):101 6-27 and in Kostyuchenko VA, Lim EX, Zhang S, Fibriansah G, Ng TS, Ooi JS, Shi J, Lok SM. Structure of the thermally stable Zika virus.
- the antibody, or antigen bindi ng fragment thereof, according to the present invention (is able to) inhibit(s) a post-attachment step of ZIKV.
- Post- attachment typically refers to any step of ZIKV infection after attachment of ZIKV to the cell membrane (of the cell targeted by ZIKV).
- the antibody, or antigen binding fragment thereof, according to the present invention preferably (is able to) prevent(s) membrane fusion.
- the antibody, or antigen binding fragment thereof, according to the present invention (is able to) cause(s) aggregation of ZI KV (particles).
- the antibody, or antigen binding fragment thereof, according to the present invention (is able to) (i) inhibit(s) a post-attachment step of ZIKV and (ii) cause(s) aggregation of ZIKV (particles).
- the antibody, or antigen bindi ng fragment thereof, according to the present invention comprises at least one CDR, preferably all six CDRs, more preferably a variable region, even more preferably both variable regions (i .e., an epitope binding site), in particular a specificity, of the exemplified human antibody ZKA190, which binds to ZIKV EDIII (cf. Example 1 , Figure 1 ).
- Amino acid sequences of CDRs and variable regions of ZKA1 90, which are preferably comprised in the antibody, or antigen binding fragment thereof, according to the present invention, are described in Tables 1 and 2 below.
- the antibody, or antigen binding fragment thereof binds to a quaternary epitope displayed on a ZIKV infectious virion.
- such antibodies show typically no detectable binding to recombinant ZIKV E protein or to ZIKV EDIII in a standard ELISA (as described above), i.e. if tested in vitro, in particular in purified form (i.e. ZIKV E protein "outside/without" a virion, a virus-like particle or the like).
- "no detectable binding” typically means that no EC 3 o up to 10000 ng/ml was detected in a standard ELISA.
- the quaternary epitope displayed on a ZIKV infectious virion is typically a conformational epitope.
- the quaternary epitope displayed on a ZIKV infectious virion may be formed at the interface of two envelope protein monomers making up a dimer ("envelope dimer epitope”; EDE) or it may be formed across neighbouring dinners ("herring- bone epitope”).
- the antibody, or antigen binding fragment thereof, according to the present invention comprises at least one CDR, preferably all six CDRs, more preferably a variable region, even more preferably both variable regions (i.e., an epitope binding site), in particular a specificity, of the exemplified human antibody ZKA230, which binds to a quaternary epitope displayed on a ZIKV infectious virion (cf. Example 1 , Figure 1 ).
- Amino acid sequences of CDRs and variable regions of ZKA230, which are preferably comprised in the antibody, or antigen binding fragment thereof, according to the present invention, are described in Tables 1 and 2 below.
- the antibody, or antigen binding fragment thereof binds to domain II of Zika virus envelope protein (EDM).
- EDM Zika virus envelope protein
- EDII is an elongated finger-like domain containing a conserved fusion loop that interacts with the host cel l endosomal membrane extending approx. from amino acid position 52 to amino acid position 1 32 and approx. from ami no acid position 1 93 to amino acid position 280 of ZIKV E protein (Dai L, Song J, Lu X, Deng YQ, Musyoki AM, Cheng H, Zhang Y, Yuan Y, Song H, Haywood J, Xiao H, Yan J, Shi Y, Qin CF, Qi J, Gao GF. Structures of the Zika Virus Envelope Protein and Its Complex with a Flavivirus Broadly Protective Antibody. Cell Host Microbe. 201 6 May 1 1 ;1 9(5):696-704).
- the antibody, or antigen binding fragment thereof, according to the present invention comprises at least one CDR, preferably all six CDRs, more preferably a variable region, even more preferably both variable regions (i .e., an epitope binding site), in particular a specificity, of the exemplified human antibody ZKA1 85, which binds to ZIKV EDM.
- CDRs and variable regions of ZKA1 85 which are preferably comprised in the antibody, or antigen binding fragment thereof, according to the present invention, are described in Tables 1 and 2 below.
- the antibody, or antigen binding fragment thereof, according to the present invention (i) binds to domain III of Zika virus envelope protein (EDIII) and (ii) binds to domain II of Zika virus envelope protein (EDM).
- EDIII Zika virus envelope protein
- EDM Zika virus envelope protein
- it is preferred that antibody, or antigen bindi ng fragment thereof, according to the present invention comprises (i) an epitope bindi ng site, which specifically binds to domain III of Zika virus envelope protein (EDIII), and (ii) an epitope binding site, which specifically binds to domain II of Zika virus envelope protein (EDII).
- domain III of Zika virus envelope protein comprises or consists of an amino acid sequence as set forth in SEQ ID NO: 263 or 265, in particular as set forth in SEQ ID NO: 264.
- the antibody, or antigen binding fragment thereof binds to an epitope of Zika virus envelope protein, which includes one or more amino acid residues of the lateral ridge (LR) of EDIII and/or one or more amino acid residues of the EDI-EDIII hinge region.
- the epitope binding site targeting EDIII preferably binds to one or more amino acid residues of the lateral ridge (LR) of EDIII and/or one or more amino acid residues of the EDI-EDIII hinge region. It is also preferred that the antibody, or antigen binding fragment thereof, according to the present invention (i) binds to domain III of Zika virus envelope protein (EDIII) and (ii) binds to a quaternary epitope displayed on a ZIKV infectious virion.
- EDIII Zika virus envelope protein
- antibody, or antigen binding fragment thereof comprises (i) an epitope binding site, which specifically binds to domain III of Zika virus envelope protein (EDIII), and (ii) an epitope binding site, which specifically binds to a quaternary epitope displayed on a ZIKV infectious virion.
- domain III of Zika virus envelope protein comprises or consists of an amino acid sequence as set forth in SEQ ID NO: 263 or 265, in particular as set forth in SEQ ID NO: 264.
- the antibody, or antigen binding fragment thereof binds to an epitope of Zika virus envelope protein, which includes one or more amino acid residues of the lateral ridge (LR) of EDIII and/or one or more amino acid residues of the EDI-EDIII hinge region.
- the epitope binding site targeting EDIII preferably binds to one or more amino acid residues of the lateral ridge (LR) of EDIII and/or one or more amino acid residues of the EDI-EDIII hinge region.
- a single epitope binding site (also referred to as "paratope” or “antigen receptor”) of the antibody according to the present invention, or the antigen binding fragment thereof preferably comprises three complementarity determining regions (CDRs) on a heavy chain and (at least) three CDRs on a light chain.
- complementarity determining regions (CDRs) are the hypervariable regions present in heavy chain variable domains and light chain variable domains.
- the CDRs of a heavy chain and the connected light chain of an antibody together form the antigen receptor (epitope binding site).
- the three CDRs (CDR1 , CDR2, and CDR3) are arranged non-consecutively in the variable domain.
- epitope binding sites are typically composed of two variable domains (for example, on two different polypeptide chains, i.e. heavy and light chain), there are six CDRs for each epitope binding site (heavy chain: CDRH1 , CDRH2, and CDRH3; light chain: CDRL1 , CDRL2, and CDRL3).
- the CDRs on the heavy and/or light chain may be separated by framework regions, whereby a framework region (FR) is a region in the variable domain which is less "variable" than the CDR.
- FR framework region
- a chain or each chain, respectively
- the sequences of the heavy chains and light chains of various exemplified human anti ZIKV E protein antibodies comprising three different CDRs on the heavy chain and three different CDRs on the light chain were determined (cf. Tables 1 and 2 below).
- the position of the CDR amino acids are defined according to the IMGT numbering system (IMGT: http://www.imgt.org/; cf. Lefranc, M.-P. et al. (2009) Nucleic Acids Res. 37, D1006-D1012).
- the antibody, or antigen binding fragment thereof, according to the present invention comprises at least one CDR of the following exemplified antibodies.
- the antibody, or antigen binding fragment thereof, according to the present invention comprises all six CDRs (of an epitope binding site) of the following exemplified antibodies. Even more preferably, the antibody, or antigen binding fragment thereof, according to the present invention comprises the heavy chain variable region (VH) and the light chain variable region (VL) of the following exemplified antibodies.
- Table 1 shows the SEQ ID NO's of the amino acid sequences of the heavy chain CDR's (CDRH1 , CDRH2, and CDRH3) and of the heavy chain variable region (referred to as "VH") of exemplary antibodies:
- Table 2 shows the SEQ ID NO's of the amino acid sequences of the light chain CDR's (CDRL1 , CDRL2, and CDRL3) and of the light chain variable region (referred to as "VL") of exemplary antibodies:
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises amino acid sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to at least one of the CDR sequences, the VH sequence and/or the VL sequence shown in Table 1 and/or in Table 2.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 3, 75, 39, 21 , 57, 101 , 105, 109, 1 13, 1 1 7, 121 , 125, 129, 133, 137, 141 , 145, 149, 1 53, 1 57, 161 , 165, 1 69, 1 73, 1 77, 181 , 1 85, 1 89, 193, 1 97, 201 , 205, 209, 213, 21 7, 221 , 225, 229, 233, 237, 241 , 245, 249, 253, 257
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 3, 21 , and 39, 57 and 75 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 3, 21 , and 39 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to SEQ ID NO: 21 or according to SEQ ID NO: 39; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1, at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1, at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to SEQ ID NO: 3 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1, at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1, at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH1 comprises an amino acid sequence according to any of SEQ ID NOs: 1, 19, 37, 55, 73, 99, 103, 107, 111, 115, 119, 123, 127, 131,
- the at least one CDRH2 comprises an amino acid sequence according to any of SEQ ID NOs: 2, 20, 38, 56, 74, 100, 104, 108, 112, 116, 120, 124, 128, 132, 136, 140, 144, 148, 152, 156, 160, 164, 168, 172, 176, 180, 184, 188, 192, 196, 200, 204, 208, 212, 216, 220, 224, 228, 232, 236, 240, 244, 248, 252, 256, and 260, or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to any of SEQ ID NOs: 3, 21, 39, 57, 75, 101, 105, 109, 113, 117, 121, 125, 129, 133, 137, 141, 145, 149, 153, 157, 161, 165, 169, 173, 177, 181, 185, 189, 193, 197,
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH1 comprises an amino acid sequence according to any of SEQ ID NOs: 1 , 1 9, 37, 55 and 73 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to any of SEQ ID NOs: 2, 20, 38, 56 and 74 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to any of SEQ ID NOs: 3, 21 , 39, 57 and 75 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH 1 comprises an amino acid sequence according to any of SEQ ID NOs: 1 , 1 9, and 37 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to any of SEQ ID NOs: 2, 20, and 38 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to any of SEQ ID NOs: 3, 21 , and 39 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRLl , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH1 comprises an amino acid sequence according to SEQ ID NO: 1 or according to SEQ ID NO: 73; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to SEQ ID NO: 3 or according to SEQ ID NO: 75; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chain CDRH 1 comprises an amino acid sequence according to SEQ ID NO: 1 9 or according to SEQ ID NO: 37; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to SEQ ID NO: 21 or according to SEQ ID NO: 39; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH 1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one heavy chai n CDRH 1 comprises an amino acid sequence according to SEQ I D NO: 1 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRH2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one heavy chain CDRH3 comprises an amino acid sequence according to SEQ ID NO: 3 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to any of SEQ ID NOs: 4, 22, 40, 58 and 76 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRL2 comprises an amino acid sequence according to any of SEQ ID NOs: 5, 6, 23, 24, 41 , 42, 59, 60, 77 and 78 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one CDRL3 amino comprises an amino acid sequence according to any of SEQ ID NOs: 7, 25, 43, 61 and 79 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to any of SEQ ID NOs: 4, 22, and 40 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRL2 comprises an amino acid sequence according to any of SEQ ID NOs: 5, 6, 23, 24, 41 , and 42, or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one CDRL3 amino comprises an amino acid sequence according to any of SEQ ID NOs: 7, 25, and 43 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to SEQ ID NO:
- SEQ ID NO: 76 or according to SEQ ID NO: 76; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity;
- the at least one CDRL2 comprises an amino acid sequence according to any of SEQ ID NOs: 5, 6, 77 and 78 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one CDRL3 amino comprises an amino acid sequence according to SEQ ID NO: 7 or according to SEQ ID NO: 79; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to SEQ ID NO:
- the at least one CDRL2 comprises an amino acid sequence according to any of SEQ I D NOs: 23, 24, 41 and 42 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and/or
- the at least one CDRL3 amino comprises an amino acid sequence according to SEQ ID NO: 25 or according to SEQ ID NO: 43; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH I , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein
- the at least one CDRL1 comprises an amino acid sequence according to SEQ ID NO:
- the at least one CDRL2 comprises an amino acid sequence according to SEQ ID NO:
- the at least one CDRL3 amino comprises an amino acid sequence according to SEQ ID NO: 7 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH I , CDRH2, and CDRH3 amino acid sequences (i) according to SEQ ID NOs: 1 - 3; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 19 - 21 ; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (iii) according to SEQ ID NOs: 37 - 39; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 8
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH l , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii i) according to SEQ ID NOs: 1 9 - 23
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (iii) according to SEQ ID NOs: 1 9 - 23 and 25; or functional sequence
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (iii) according to SEQ ID NOs: 73 - 77 and 79;
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 19 - 23 and 25; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) according to SEQ ID NOs: 19 - 22 and 24 - 25; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (iii) according to SEQ ID NOs: 37 - 41 and 43;
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH 1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention as described above comprises CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 19 - 23 and 25; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) according to SEQ ID NOs: 1 9 - 22 and 24 - 25; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof comprises (a) a first epitope binding site comprising CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and
- a second epitope binding site comprising CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 9 - 23 and 25; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) according to SEQ ID NOs: 19 - 22 and 24 - 25; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention as described above comprises CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 37 - 41 and 43; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) according to SEQ ID NOs: 37 - 40 and 42 - 43; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (a) a first epitope binding site comprising CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and
- a second epitope binding site comprising CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ ID NOs: 37 - 41 and 43; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) according to SEQ ID NOs: 37 - 40 and 42 - 43; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain variable region (VH) and, optionally, a light chain variable region (VL), wherein the heavy chain variable region (VH) comprises or consists of an amino acid sequence according to any of SEQ ID NOs: 8, 26, 44, 62, 80, 102, 106, 1 10, 1 14, 1 18, 122, 126, 1 30, 134, 1 38, 142, 146, 1 50, 1 54, 158, 1 62, 1 66, 1 70, 1 74, 1 78, 182, 1 86, 1 90, 194, 198, 202, 206, 210, 214, 21 8, 222, 226, 230, 234, 238, 242, 246, 250, 254, 258, and 262; or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (i) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 26 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%,
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (i) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chai n variable region (VL) amino acid sequence according to SEQ ID NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; (ii) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 26 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80°/
- the antibody, or the antigen bindi ng fragment thereof, according to the present invention comprises (i) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chai n variable region (VL) amino acid sequence according to SEQ ID NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 80 or a functional sequence variant thereof having at least 70%, at least 75%
- the antibody, or the antigen bindi ng fragment thereof, according to the present invention comprises (i) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 26 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 27 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (ii) a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 44 or a functional sequence variant thereof having at least 70%, at least 75%, at least a heavy chain variable
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- VH heavy chain variable region
- the antibody, or the antigen binding fragment thereof, according to the present invention as described above comprises a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 26 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 27 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- VH heavy chain variable region
- the antibody, or the antigen bi nding fragment thereof, according to the present invention as described above comprises
- a first epitope binding site comprising a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a l ight chain variable region (VL) amino acid sequence according to SEQ ID NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and
- a second epitope binding site comprising a heavy chain variable region (VH) ami no acid sequence according to SEQ ID NO: 26 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 27 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- VH heavy chain variable region
- SEQ ID NO: 26 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%,
- the antibody, or the antigen binding fragment thereof, according to the present invention as described above comprises a heavy chain variable region (VH) ami no acid sequence according to SEQ ID NO: 44 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 45 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- VH heavy chain variable region
- SEQ ID NO: 44 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%,
- the antibody, or the antigen binding fragment thereof, according to the present invention as described above comprises
- a first epitope binding site comprising a heavy chain variable region (VH) amino acid sequence accordi ng to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chai n variable region (VL) amino acid sequence according to SEQ ID NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; and
- a second epitope binding site comprising a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 44 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 45 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- VH heavy chain variable region
- the antibody, or the antigen binding fragment thereof, according to the present invention is in the Fabs-in-tandem-lg (FIT-lg) format and the outer Fab of the FIT- Ig format comprises an epitope binding site comprising CDRH 1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences (i) according to SEQ I D NOs: 1 - 5 and 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (i i) according to SEQ ID NOs: 1 - 4 and 6 - 7; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%
- the outer Fab of the FIT-lg format comprises an epitope binding site comprising a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 8 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) amino acid sequence according to SEQ I D NO: 9 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- VH heavy chain variable region
- the inner Fab of the FIT-lg format comprises an epitope binding site comprisi ng CDRH 1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 ami no acid sequences (i) according to SEQ ID NOs: 1 9 - 23 and 25; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity; or (i i) according to SEQ ID NOs: 1 9 - 22 and 24 - 25; or functional sequence variants thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- the inner Fab of the FIT-lg format comprises an epitope binding site comprising a heavy chain variable region (VH) amino acid sequence accordi ng to SEQ ID NO: 26 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity and/or a light chain variable region (VL) ami no acid sequence according to SEQ ID NO: 27 or a functional sequence variant thereof having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity.
- VH heavy chain variable region
- the antibody, or an antigen binding fragment thereof, according to the present invention is for use as a medicament.
- the antibody, or an antigen binding fragment thereof, according to the present invention may be used in the preparation of a medicament. More preferably, the antibody, or an antigen binding fragment thereof, according to the present invention is for use in the prevention and/or treatment of Zika virus infection. In other words, the antibody, or an antigen binding fragment thereof, according to the present invention may be used in the preparation of a medicament or use in the prevention and/or treatment of Zika virus infection. This aspect is described in more detail below.
- the invention also provides a nucleic acid molecule comprising at least one polynucleotide encoding the antibody, or the antigen binding fragment thereof, according to the present invention as described above or a fragment thereof, wherein the fragment comprises at least one CDR of the antibody, or the antigen binding fragment thereof.
- a nucleic acid molecule is a molecule comprising, preferably consisting of nucleic acid components.
- nucleic acid molecule preferably refers to DNA or RNA molecules. In particular, it is used synonymous with the term "polynucleotide".
- a nucleic acid molecule is a polymer comprising or consisting of nucleotide monomers which are covalently linked to each other by phosphodiester-bonds of a sugar/phosphate-backbone.
- nucleic acid molecule also encompasses modified nucleic acid molecules, such as base- modified, sugar-modified or backbone-modified etc. DNA or RNA molecules.
- the encoded fragment of the antibody or antigen binding fragment thereof according to the present invention comprises at least one CDR of the antibody, or the antigen binding fragment thereof.
- Tables 1 and 2 provide the SEQ ID numbers for the amino acid sequences of the CDRs and VH and VL of exemplary antibodies according to the present invention. Accordingly, the nucleic acid molecule according to the present invention preferably comprises a polynucleotide encoding one or more of the amino acid sequences shown in Tables 1 and 2.
- the encoded fragment of the antibody or antigen binding fragment thereof comprises three CDRs, more preferably all three heavy chain CDRs of an epitope binding site (CDRHl , CDRH2, CDRH3) and/or all three light chain CDRs of an epitope binding site (CDRL1 , CDRL2, CDRL3). Accordingly, it is preferred that the encoded fragment of the antibody or antigen binding fragment thereof comprises (exactly) three or six CDRs.
- the nucleic acid molecule according to the present invention preferably comprises a polynucleotide encoding three or six of the CDR amino acid sequences shown in Tables 1 and 2, in particular corresponding CDRH l , CDRH2, and CDRH3 sequences, and/or CDRL1 , CDRL2, and CDRL3 sequences.
- the encoded fragment of the antibody or antigen binding fragment thereof comprises a variable region, for example a heavy chain variable region (VH) and/or a light chain variable region (VL). Accordingly, it is preferred that the encoded fragment of the antibody or antigen binding fragment thereof comprises (exactly) one or two variable regions.
- the nucleic acid molecule according to the present invention preferably comprises a polynucleotide encoding one or two of the variable region amino acid sequences shown in Tables 1 and 2.
- the encoded fragment of the antibody or antigen binding fragment thereof comprises a (complete) polypeptide chain of the antibody or antigen binding fragment thereof according to the present invention.
- Such a (complete) polypeptide chain may be, for example, a (complete) heavy chain or a (complete) light chain.
- such a (complete) polypeptide chain may also comprise both, heavy and light chain elements, which is known in the art for many multispecific antibody formats (e.g., polypeptide chains comprising heavy chai n constant regions, but also, e.g. in addition to one or more heavy chain variable region(s), a light chain variable region).
- the nucleic acid molecule may be mono-, bi-, or multicistronic, such as tricistronic.
- a bicistronic or multicistronic nucleic acid molecule is typically a nucleic acid molecule that typically may have two (bicistronic) or more (multicistronic) open reading frames (ORFs).
- An open reading frame in this context is a sequence of codons that is translatable into a peptide or protein.
- the nucleic acid molecule of the present invention contains at least one polynucleotide codi ng for at least one antibody, or antigen binding fragment thereof, according to the present invention.
- the second, third etc. coding polynucleotide may code for other peptides/proteins and/or may code for antibodies, e.g. according to the present invention, or fragments thereof as well, which may be the same or distinct from the first antibody coding region.
- the inventive nucleic acid molecule contai ns at least two coding polynucleotides, for example (exactly) two or three coding polynucleotides, all of them coding for identical or distinct antibodies or fragments or variants thereof.
- distinct fragments of an antibody, or an antigen binding fragment thereof, according to the present invention may be encoded by different polynucleotides on the same nucleic acid molecule.
- an inventive nucleic acid molecule may code for more than one antibody or a fragment of an antibody within the same coding region.
- the inventive nucleic acid molecule may be mono-, bi- or multicistronic.
- the antibody, or the antigen binding fragment thereof, according to the present invention may be a single chain antibody.
- the complete si ngle chain of the antibody or the antigen binding fragment thereof is encoded by one single polynucleotide.
- the nucleic acid molecule accordi ng to the present invention is monocistronic, in particular it may comprise one (single) polynucleotide encoding the antibody, or the antigen binding fragment thereof, according to the present invention.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (exactly) two distinct polypeptide chains, such as, for example, a heavy chain and a l ight chain.
- This may be i llustrated by a classical native IgG molecule, which comprises two identical heavy chains and two identical light chains and, thus, two distinct polypeptide chains (even though the antibody finally comprises four polypeptide chains, they may be encoded by two (distinct) polynucleotides).
- such two distinct polypeptide chains e.g., a heavy chain and a light chain
- the antibody, or the antigen binding fragment thereof may be encoded by two disti nct polynucleotides, which may be located on the same nucleic acid molecule, e.g. in a bicistronic nucleic acid molecule, or on (exactly two) distinct nucleic acid molecules (e.g., each nucleic acid molecule may be monocistronic).
- the nucleic acid molecule according to the present invention is bicistronic, in particular it may comprise (exactly) two polynucleotides encoding (together) the antibody, or the antigen binding fragment thereof, according to the present invention. It is also preferred that the nucleic acid molecule according to the present invention comprises (at least or exactly) one polynucleotide encoding a fragment of the antibody, or the antigen binding fragment thereof, according to the present invention, as described above (e.g., a (complete) polypeptide chai n). Accordingly, it is preferred that the nucleic acid molecule according to the present invention is monocistronic.
- the antibody, or the antigen binding fragment thereof, according to the present invention may be encoded by a plurality of (e.g., monocistronic) nucleic acid molecules.
- an antibody comprisi ng two distinct polypeptide chains may be encoded by two polynucleotides located on two disti nct nucleic acid molecules.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises (exactly) three distinct polypeptide chains.
- the nucleic acid molecule is tricistronic (e.g., encoding all three polypeptide chains comprised in such an antibody, or the antigen binding fragment thereof, according to the present i nvention).
- the nucleic acid molecule is mono- or bicistronic, for example encoding one single or two polypeptide chains comprised in such an antibody, or the antigen binding fragment thereof, according to the present invention.
- a plurality of nucleic acid molecules, such as two or three nucleic acid molecules may encode (together) the antibody, or the antigen binding fragment thereof, according to the present invention.
- the antibody, or the antigen binding fragment thereof, according to the present invention is particularly preferably in the Fabs-in-tandem-lg (FIT-lg) format, which usually comprises the following three polypeptide chains:
- Polypeptide 1 comprising or consisting of the light chain of the outer Fab and the heavy chain of the inner Fab including the constant domains CH 1 -CH2-CH3, preferably with the "LALA" mutation as described above, wherein preferably the light chain of the outer Fab is fused, preferably without li nkers, to the N -terminus of the heavy chain of the inner Fab;
- Polypeptide 2 comprising or consisting of the heavy chain of the outer Fab (VH and CH I of the outer Fab);
- Polypeptide 3 comprising or consisting of the light chain of the inner Fab.
- such a FIT-lg may preferably be encoded by one (e.g., tricistronic) nucleic acid molecule, by three (e.g., monocistronic) nucleic acid molecule, or by two (e.g., one monocistronic, one bicistronic) nucleic acid molecules.
- the nucleic acid molecule according to the present invention comprises a polynucleotide encoding polypeptide 1 of a FIT-lg antibody according to the present invention. More preferably, the nucleic acid molecule does not comprise polynucleotides encoding polypeptide 2 or polypeptide 3 of the FIT-lg antibody according to the present invention. Such a nucleic acid molecule is preferably monocistronic.
- the nucleic acid molecule according to the present invention comprises a polynucleotide encoding polypeptide 2 of a FIT-lg antibody according to the present invention. More preferably, the nucleic acid molecule does not comprise polynucleotides encoding polypeptide 1 or polypeptide 3 of the FIT-lg antibody according to the present invention. Such a nucleic acid molecule is preferably monocistronic. It is also preferred that the nucleic acid molecule according to the present invention comprises a polynucleotide encoding polypeptide 3 of a FIT-lg antibody according to the present invention.
- the nucleic acid molecule does not comprise polynucleotides encoding polypeptide 1 or polypeptide 2 of the FIT-lg antibody according to the present invention.
- Such a nucleic acid molecule is preferably monocistronic.
- the nucleic acid molecule according to the present invention comprises a polynucleotide encoding polypeptide 1 and a polynucleotide encoding polypeptide 2 of a FIT-lg antibody according to the present invention. More preferably, the nucleic acid molecule does not comprise a polynucleotide encoding polypeptide 3 of the FIT-lg antibody according to the present invention. Such a nucleic acid molecule is preferably bicistronic.
- the nucleic acid molecule according to the present invention comprises a polynucleotide encoding polypeptide 1 and a polynucleotide encoding polypeptide 3 of a FIT-lg antibody according to the present invention. More preferably, the nucleic acid molecule does not comprise a polynucleotide encoding polypeptide 2 of the FIT-lg antibody according to the present invention. Such a nucleic acid molecule is preferably bicistronic.
- the nucleic acid molecule according to the present invention comprises a polynucleotide encoding polypeptide 2 and a polynucleotide encoding polypeptide 3 of a FIT-lg antibody according to the present invention. More preferably, the nucleic acid molecule does not comprise a polynucleotide encoding polypeptide 1 of the FIT-lg antibody according to the present invention. Such a nucleic acid molecule is preferably bicistronic.
- the nucleic acid molecule according to the present invention comprises a polynucleotide encoding polypeptide 1 , a polynucleotide encoding polypeptide 2 and a polynucleotide encoding polypeptide 3 of a FIT-lg antibody according to the present invention.
- a nucleic acid molecule is preferably tricistronic.
- the nucleic acid molecule may be a DNA molecule or an RNA molecule.
- nucleic acid molecules and/or polynucleotides include, e.g., a recombinant polynucleotide, a vector, an oligonucleotide, an RNA molecule such as an rRNA, an mRNA, an miRNA, an si RNA, or a tRNA, or a DNA molecule such as a cDNA.
- the nucleic acid molecule is a DNA plasmid or an mRNA molecule.
- a DNA plasmid is a circular, preferably double-stranded, DNA molecule.
- Table 3 below provides the SEQ ID numbers for exemplary nucleic acid sequences encoding the CDRs and VH and VL of exemplary antibodies according to the present invention. Due to the redundancy of the genetic code, the present invention also comprises sequence variants of these nucleic acid sequences and i n particular such sequence variants, which encode the same amino acid sequences.
- Table 3 shows exemplary nucleic acid sequences of the CDR's and the heavy chain variable region (VH) and the light chain variable region (VL) of five exemplary antibodies ("ZKA190”, “ZKA64”, “ZKA230”, “ZKA1 85”, “ZKA78”):
- CDRH2 1 1 atatcatatgagggaagtaataaa
- CDRL1 1 3 cagagtgttagtagcagttac
- CDRL3 1 6 cagcagtatggtaggtcaaggtggaca
- VH 1 7 caggtgcagctggtggagtctgggggaggcgtggtccagc ctgggaggtccctgagactctcctgtgcagcctctggatt caccttcagtaaatatggcatgcactgggtccgccaggct ccaggcaaggggctggagtgggtggcagttatatcatatg agggaagtaataaatattatgcagactccgtgaagggccg attcaccatctccagagacaattccaagaacacgctgtat ctgcaaatgaacagcctgagagctgaggacacggcagtgt a11actgtgcgaaatcggggacccaatactatgatactac tggtatgagtataggggtttggaatactttggctact
- CDRL2 32 gaggacaac
- CDRL3 34 tactcaacagacagcagttctaatcccctgggagta
- CDRL2 51 ctcatctgtattaatgatcaccggccc
- CDRL3 52 gcaacatgggatgacagcctgggtggccttgta
- VL 54 cagtctgtgctgactcagccaccctcagcgtctgggaccc ccgggcagagggtcaecatctcttgttctggaagcagctc caacatcggaggtaattatgtatactggtaccagcagctc ccaggaacggcccccaaactcctcatctgtattaatgatc accggccctcaggggtccctgaccgattctctggctccaa gtctggcacctcagcctccctggccatcagtgggctccag tccgaggatgaggctgattattactgtgcaacatgggatg acagcctgggtggccttgtattcggcggagggaccaagct gaccgtcctag
- CDRL1 67 cagtccgtgctgtaccgctctaacaacaagaattac
- CDRL2 69 ctgatctattgggcttcaacccgggaa
- CDRL3 70 cagcagtactattctagtcctcgaact
- CDRL2 87 ctgatctatggagcatcctccagggct
- CDRL3 88 cagcagtacaatgattggccccctatcaca
- VH 89 caggtgcagctggtccagagcggagcagaggtgaagaac ccggcgcctcagtgaaggtcagctgcaaagcttccggcta caccttcacagggtatcacatcgactgggtgaggcaggca agaggacagggactggaatggatgggacggattaacccta attctggcgggaccaactacgcccagaagtttcagggccg agtgactatgaccagagacaccagcatctccacagcttat atgcagctgtccccggctgagatctgacgatagtgccgtct actattgtgctcggatgagctcctctgagatctgacgatagtgccgtct actattgtgctcggatg
- the sequence of the nucleic acid molecule according to the present invention comprises or consists of a nucleic acid sequence according to any one of SEQ ID NOs: 1 0 - 1 8, 28 - 36, 46 - 54, 64 - 72, and 82 - 90; or a functional sequence variant thereof.
- nucleic acid sequences according to the invention include nucleic acid sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to the nucleic acid encoding a CDR, a VH sequence and/or a VL sequence shown in Tables ⁇ and 2, for example to the sequences shown in Table 3.
- the nucleic acid molecule may be manipulated to insert, delete or alter certain nucleic acid sequences. Changes from such manipulation include, but are not limited to, changes to introduce restriction sites, to amend codon usage, to add or optimize transcription and/or translation regulatory sequences, etc. It is also possible to change the nucleic acid to alter the encoded amino acids. For example, it may be useful to introduce one or more ⁇ e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, etc.) amino acid substitutions, deletions and/or insertions into the antibody's amino acid sequence.
- Such point mutations can modify effector functions, antigen-binding affinity, post-translational modifications, immunogenicity, etc., can introduce amino acids for the attachment of covalent groups (e.g., labels) or can introduce tags (e.g., for purification purposes). Mutations can be introduced in specific sites or can be introduced at random, followed by selection (e.g., molecular evolution). For instance, one or more nucleic acids encoding any of the CDR regions, a VH sequence and/or a VL sequence of an (exemplary) antibody of the invention can be randomly or directionally mutated to introduce different properties in the encoded amino acids. Such changes can be the result of an iterative process wherein initial changes are retained and new changes at other nucleotide positions are introduced. Further, changes achieved in independent steps may be combined. Different properties introduced into the encoded amino acids may include, but are not limited to, enhanced affinity.
- the present invention also provides a plurality of nucleic acid molecules as described above, wherein each nucleic acid molecule comprises at least one polynucleotide encoding a fragment of the antibody, or of the antigen binding fragment thereof, according to the present invention, as described above.
- the plurality of fragments encoded by the plurality of nucleic acid molecules forms an antibody, or an antigen binding fragment thereof, according to the present invention.
- the plurality of nucleic acid molecules according to the present invention encodes the (complete) antibody, or the (complete) antigen binding fragment thereof, according to the present invention.
- nucleic acid molecules in addition to the plurality of nucleic acid molecules according to the present invention are required to encode/produce the (complete) antibody, or the (complete) antigen binding fragment thereof, according to the present invention.
- the plurality of nucleic acid molecules according to the present invention encodes all polypeptide chains of an antibody, or of an antigen binding fragment thereof, according to the present invention.
- a preferred example of the plurality of nucleic acid molecules according to the present invention are (exactly) two nucleic acid molecules, wherein each of the nucleic acid molecules comprises one single or more than one (e.g., two or three) polynucleotides, each polynucleotide encoding a (distinct) polypeptide chain of the antibody, or of the antigen binding fragment thereof, according to the present invention.
- the nucleic acid molecules of such a plurality of nucleic acid molecules are preferably mono- or bicistronic.
- An example thereof are two nucleic acid molecules encoding together a FIT-lg antibody according to the present invention as described above (e.g., one bicistronic nucleic acid molecule combined with the corresponding monocistronic nucleic acid molecule, such that polypeptides 1 , 2 and 3 of the FIT-lg are encoded by the two nucleic acid molecules; as described above).
- the present invention provides (exactly) three nucleic acid molecules, wherein each of the nucleic acid molecules comprises one (single) polynucleotide encoding a (distinct) polypeptide chain of the antibody, or of the antigen binding fragment thereof, according to the present invention.
- the nucleic acid molecules of such a plurality of nucleic acid molecules are preferably monocistronic.
- An examples thereof are three nucleic acid molecules encoding together a FIT-lg antibody according to the present invention as described above (e.g., three (e.g., monocistronic) nucleic acid molecules, one encoding polypeptide 1 of the FIT-lg, another encoding polypeptide 2 of the FIT-lg, and the third encoding polypeptide 3 of the FIT-lg; as described above).
- Vectors e.g., three (e.g., monocistronic) nucleic acid molecules, one encoding polypeptide 1 of the FIT-lg, another encoding polypeptide 2 of the FIT-lg, and the third encoding polypeptide 3 of the FIT-lg; as described above).
- vectors for example, expression vectors, comprising a nucleic acid molecule according to the present invention.
- a vector comprises a nucleic acid molecule as described above.
- vector refers to a nucleic acid molecule, preferably to a recombinant nucleic acid molecule, i.e. a nucleic acid molecule which does not occur in nature.
- a vector in the context of the present invention is suitable for incorporating or harboring a desired nucleic acid sequence.
- Such vectors may be storage vectors, expression vectors, cloning vectors, transfer vectors etc.
- a storage vector is a vector which allows the convenient storage of a nucleic acid molecule.
- the vector may comprise a sequence corresponding, e.g., to a desired antibody or antibody fragment thereof according to the present invention.
- An expression vector may be used for production of expression products such as RNA, e.g.
- an expression vector may comprise sequences needed for transcription of a sequence stretch of the vector, such as a promoter sequence.
- a cloning vector is typically a vector that contains a cloning site, which may be used to incorporate nucleic acid sequences into the vector.
- a cloning vector may be, e.g., a plasmid vector or a bacteriophage vector.
- a transfer vector may be a vector which is suitable for transferring nucleic acid molecules into cells or organisms, for example, viral vectors.
- a vector in the context of the present invention may be, e.g., an RNA vector or a DNA vector.
- a vector is a DNA molecule, such as a DNA plasmid.
- a vector in the sense of the present application comprises a cloning site, a selection marker, such as an antibiotic resistance factor, and a sequence suitable for multiplication of the vector, such as an origin of replication.
- a vector in the context of the present application is a plasmid vector.
- the present invention also provides a plurality of vectors according to the present invention, preferably encoding the antibody, or the antigen binding fragment thereof, according to the present invention. Accordingly, preferred embodiments and examples of the plurality of nucleic acid molecules according to the present invention as described above also apply for the plurality of vectors according to the present invention.
- the present invention also provides cell expressing the antibody, or the antigen binding fragment thereof, according to the present invention; and/or comprising the vector according the present invention or the plurality of vectors according the present invention.
- Examples of such cells include but are not limited to, eukaryotic cells, e.g., yeast cells, animal cells or plant cells.
- the cells are mammalian cells, more preferably a mammalian cell line.
- Preferred examples include human cells, CHO cells, HEK293T cells, PER.C6 cells, NSO cells, human liver cells, myeloma cells or hybridoma cells.
- the cell may be transfected with the vector according to the present invention or with the plurality of vectors according to the present invention, preferably with an expression vector or a plurality thereof.
- transfection refers to the introduction of nucleic acid molecules, such as DNA or RNA (e.g. mRNA) molecules, into cells, preferably into eukaryotic cells.
- RNA e.g. mRNA
- transfection encompasses any method known to the skilled person for introducing nucleic acid molecules into cells, preferably into eukaryotic cells, such as into mammalian cells. Such methods encompass, for example, electroporation, lipofection, e.g.
- the cells of the present invention may be transfected stably or transiently with the vector according to the present invention or with the plurality of vectors according to the present invention, e.g. for expressing the antibody, or the antigen binding fragment thereof, according to the present invention.
- the cells are stably transfected with the vector according to the present invention or with the plurality of vectors according to the present invention encoding the antibody, or the antigen binding fragment thereof, according to the present invention.
- the cells are transiently transfected with the vector according to the present invention or with the plurality of vectors according to the present invention encoding the antibody, or the antigen binding fragment thereof, according to the present invention.
- Antibodies of the invention may be coupled, for example, to a drug for delivery to a treatment site or coupled to a detectable label to facilitate imaging of a site comprising cells of interest.
- Methods for coupling antibodies to drugs and detectable labels are well known in the art, as are methods for imaging using detectable labels.
- Labeled antibodies may be employed in a wide variety of assays, employing a wide variety of labels. Detection of the formation of an antibody-antigen complex between an antibody of the invention and an epitope of interest can be facilitated by attaching a detectable substance to the antibody.
- Suitable detection means include the use of labels such as radionuclides, enzymes, coenzymes, fluoresces, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
- labels such as radionuclides, enzymes, coenzymes, fluoresces, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material is luminol;
- examples of bioluminescent materials include luciferase, luciferin, and aequorin; and
- suitable radioactive material include 1251, 131 1, 35S, or 3H.
- labeled reagents may be used in a variety of well-known assays, such as radioimmunoassays, enzyme immunoassays, e.g., ELISA, fluorescent immunoassays, and the like.
- Labeled antibodies according to the present invention may be thus be used in such assays for example as described in US 3,766,1 62; US 3,791 ,932; US 3,81 7,837; and US 4,233,402.
- An antibody according to the invention may be conjugated to a therapeutic moiety such as a cytotoxin, a therapeutic agent, or a radioactive metal ion or radioisotope.
- a therapeutic moiety such as a cytotoxin, a therapeutic agent, or a radioactive metal ion or radioisotope.
- radioisotopes include, but are not limited to, 1-131 , 1-123, 1-125, Y-90, Re-188, Re-186, At- 21 1 , Cu-67, Bi-212, Bi-213, Pd-109, Tc-99, ln-1 1 1 , and the like.
- Such antibody conjugates can be used for modifying a given biological response; the drug moiety is not to be construed as limited to classical chemical therapeutic agents.
- the drug moiety may be a protein or polypeptide possessing a desired biological activity.
- proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas ex
- an antibody, or antibody fragment thereof can be conjugated to a second antibody, or antibody fragment thereof, to form an antibody heteroconjugate as described in US 4,676,980.
- linkers may be used between the labels and the antibodies of the invention, e.g., as described in US 4,831 , 1 75.
- Antibodies or, antigen-binding fragments thereof may be directly labeled with radioactive iodine, indium, yttrium, or other radioactive particle known in the art, e.g., as described in US 5,595,721 .
- Treatment may consist of a combination of treatment with conjugated and non-conjugated antibodies administered simultaneously or subsequently e.g., as described in WOOO/52031 ; WO00/52473.
- Antibodies of the invention may also be attached to a solid support. Additionally, antibodies of the invention, or functional antibody fragments thereof, can be chemically modified by covalent conjugation to a polymer to, for example, increase their circulating half-life. Examples of polymers, and methods to attach them to peptides, are shown in US 4,766, 1 06; US 4, 1 79,337; US 4,495,285 and US 4,609,546. In some embodiments the polymers may be selected from polyoxyethylatecl polyols and polyethylene glycol (PEG).
- PEG polyethylene glycol
- PEG is soluble in water at room temperature and has the general formula: R(0-CH 2 -CH 2 ) n O-R, wherein R can be hydrogen, or a protective group such as an alkyl or alkanol group.
- the protective group may have between 1 and 8 carbons.
- the protective group is methyl.
- the symbol n is a positive integer. In one embodiment n is between 1 and 1 ,000. In another embodiment n is between 2 and 500.
- the PEG has an average molecular weight between 1 ,000 and 40,000, more preferably the PEG has a molecular weight between 2,000 and 20,000, even more preferably the PEG has a molecular weight between 3,000 and 1 2,000.
- PEG may have at least one hydroxy group, for example the PEG may have a terminal hydroxy group.
- the PEG is the terminal hydroxy group which is activated to react with a free amino group on the inhibitor.
- the type and amount of the reactive groups may be varied to achieve a covalently conjugated PEG/antibody of the present invention.
- Water-soluble polyoxyethylated polyols are also useful in the present invention. They include polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), and the like. In one embodiment, POG is used. Without being bound by any theory, because the glycerol backbone of polyoxyethylated glycerol is the same backbone occurring naturally in, for example, animals and humans in mono-, di-, triglycerides, this branching would not necessarily be seen as a foreign agent in the body. POG may have a molecular weight in the same range as PEG.
- liposome Another drug delivery system that can be used for increasi ng circulatory half-life is the liposome.
- Methods of preparing liposome delivery systems are known to one of skil l in the art.
- Other drug delivery systems are known in the art and are described in, for example, referenced in Poznansky et al. (1 980) and Poznansky (1 984).
- Antibodies of the invention may be provided in purified form.
- the antibody wil l be present in a composition that is substantially free of other polypeptides e.g., where less than 90% (by weight), usually less than 60% and more usually less than 50% of the composition is made up of other polypeptides.
- Antibodies of the i nvention may be immunogenic in non-human (or heterologous) hosts e.g., in mice. I n particular, the antibodies may have an idiotope that is immunogenic in non-human hosts, but not in a human host.
- antibodies of the invention for human use include those that cannot be easily isolated from hosts such as mice, goats, rabbits, rats, non-primate mammals, etc. and cannot generally be obtained by humanization or from xeno-mice.
- the present invention also provides a pharmaceutical composition comprising one or more of:
- the present invention also provides a pharmaceutical composition comprising the antibody, or the antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the plurality of nucleic acid molecules according to the present invention, the vector according to the present invention, the plurality of vectors according to the present invention and/or the cell according to the present invention.
- the pharmaceutical composition may preferably also contain a pharmaceutically acceptable carrier, diluent and/or excipient.
- a pharmaceutically acceptable carrier may facilitate administration, it should not itself induce the production of antibodies harmful to the individual receiving the composition. Nor should it be toxic.
- Suitable carriers may be large, slowly metabolized macromolecules such as proteins, polypeptides, liposomes, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers and inactive virus particles.
- pharmaceutically acceptable carriers in a pharmaceutical composition according to the present invention may be active components or inactive components.
- the pharmaceutically acceptable carrier in a pharmaceutical composition according to the present invention is not an active component in respect to Zika virus infection.
- salts can be used, for example mineral acid salts, such as hydrochlorides, hydrobromides, phosphates and sulphates, or salts of organic acids, such as acetates, propionates, malonates and benzoates.
- mineral acid salts such as hydrochlorides, hydrobromides, phosphates and sulphates
- organic acids such as acetates, propionates, malonates and benzoates.
- compositions of a pharmaceutical composition may additionally contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents or pH buffering substances, may be present in such compositions. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries and suspensions, for ingestion by the subject.
- Pharmaceutical compositions of the invention may be prepared in various forms. For example, the compositions may be prepared as injectables, either as liquid solutions or suspensions.
- Solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared (e.g., a lyophilized composition, similar to SynagisTM and HerceptinTM, for reconstitution with sterile water containing a preservative).
- the composition may be prepared for topical administration e.g., as an ointment, cream or powder.
- the composition may be prepared for oral administration e.g., as a tablet or capsule, as a spray, or as a syrup (optionally flavored).
- the composition may be prepared for pulmonary administration e.g., as an inhaler, using a fine powder or a spray.
- the composition may be prepared as a suppository or pessary.
- the composition may be prepared for nasal, aural or ocular administration e.g., as drops.
- the composition may be in kit form, designed such that a combined composition is reconstituted just prior to administration to a subject.
- a lyophilized antibody may be provided in kit form with sterile water or a sterile buffer.
- the active ingredient in the composition is an antibody molecule, an antibody fragment or variants and derivatives thereof, in particular the active ingredient in the composition is an antibody, an antibody fragment or variants and derivatives thereof, according to the present invention.
- the active ingredient in the composition may be susceptible to degradation in the gastrointestinal tract.
- the composition may contain agents which protect the antibody from degradation but which release the antibody once it has been absorbed from the gastrointestinal tract.
- compositions of the i nvention generally have a pH between 5.5 and 8.5, in some embodiments this may be between 6 and 8, and in other embodiments about 7.
- the pH may be maintained by the use of a buffer.
- the composition may be steri le and/or pyrogen free.
- the composition may be isotonic with respect to humans.
- pharmaceutical compositions of the invention are supplied in hermetically-sealed containers.
- compositions present in several forms of administration include, but are not limited to, those forms suitable for parenteral administration, e.g., by injection or infusion, for example by bolus injection or continuous infusion.
- the product may take the form of a suspension, solution or emulsion in an oi ly or aqueous vehicle and it may contain formulatory agents, such as suspending, preservative, stabi lizing and/or dispersing agents.
- the antibody molecule may be in dry form, for reconstitution before use with an appropriate sterile liquid.
- a vehicle is typically understood to be a material that is suitable for storing, transporting, and/or administering a compound, such as a pharmaceutically active compound, in particular the antibodies according to the present invention.
- the vehicle may be a physiologically acceptable liquid, which is suitable for storing, transporti ng, and/or administering a pharmaceutical ly active compound, in particular the antibodies according to the present invention.
- a pharmaceutical ly active compound in particular the antibodies according to the present invention.
- the compositions of the invention can be administered directly to the subject.
- the compositions are adapted for administration to mammalian, e.g., human subjects.
- compositions of this i nvention may be admi nistered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra-arterial, intramedullary, intraperitoneal, intrathecal, intraventricular, transdermal, transcutaneous, topical, subcutaneous, intranasal, enteral, sublingual, intravaginal or rectal routes. Hyposprays may also be used to administer the pharmaceutical compositions of the invention.
- the pharmaceutical composition may be prepared for oral administration, e.g. as tablets, capsules and the like, for topical administration, or as injectable, e.g. as liquid solutions or suspensions, whereby it is particularly preferred that the pharmaceutical composition is an injectable. Solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection are also be preferred, e.g. that the pharmaceutical composition is in lyophilized form.
- the active ingredient will preferably be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
- Preservatives, stabilizers, buffers, antioxidants and/or other additives may be included, as required.
- administration is preferably in a "prophylactically effective amount” or a “therapeutically effective amount” (as the case may be), this being sufficient to show benefit to the individual.
- a proliferativeally effective amount or a “therapeutically effective amount” (as the case may be)
- the actual amount administered, and rate and time-course of administration will depend on the nature and severity of what is being treated.
- the pharmaceutical composition according to the present invention may be provided for example in a pre-fii led syringe.
- inventive pharmaceutical composition as defined above may also be administered orally in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions.
- carriers commonly used include lactose and corn starch.
- Lubricating agents such as magnesium stearate, are also typically added.
- useful diluents include lactose and dried cornstarch.
- the active ingredient i.e. the inventive transporter cargo conjugate molecule as defined above, is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
- the inventive pharmaceutical composition may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, e.g. including diseases of the skin or of any other accessible epithelial tissue. Suitable topical formulations are readily prepared for each of these areas or organs.
- the inventive pharmaceutical composition may be formulated in a suitable ointment, containing the inventive pharmaceutical composition, particularly its components as defined above, suspended or dissolved in one or more carriers.
- Carriers for topical administration include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water.
- the inventive pharmaceutical composition can be formulated in a suitable lotion or cream.
- suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
- Dosage treatment may be a single dose schedule or a multiple dose schedule.
- the pharmaceutical composition may be provided as single-dose product.
- the amount of the antibody in the pharmaceutical composition - in particular if provided as single-dose product - does not exceed 200 mg, more preferably does not exceed 100 mg, and even more preferably does not exceed 50 mg.
- the pharmaceutical composition according to the present invention may be administered daily, e.g. once or several times per day, e.g. once, twice, three times or four times per day, preferably once or twice per day, more preferable once per day, for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 1 5, 1 6, 1 7, 18, 19, 20 or 21 or more days, e.g. daily for 1 , 2, 3, 4, 5, 6 months.
- the pharmaceutical composition according to the present invention may be administered weekly, e.g. once or twice per week, for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 1 5, 16, 1 7, 1 8, 1 9, 20 or 21 or more weeks, e.g.
- the pharmaceutical composition according to the present invention may be preferably administered monthly, e.g. once per month or, more preferably, every second month for 1 , 2, 3, 4, or 5 or more years. It is also preferred that the administration continues for the lifetime.
- one single administration only is also envisaged, in particular in respect to certain indications, e.g. for prevention of Zika virus infection in case of accidental exposure, e.g. in non-immunised subjects.
- the most preferred treatment schedule is postexposure prophylaxis (PEP), wherein one or more single doses are administered as soon as possible after Zika infection.
- PEP postexposure prophylaxis
- a prophylactic setting wherein one or more single doses are administered to prevent Zika infection (i.e. before Zika infection, in particular in non-Zika- immunised subjects) is also preferred.
- the amount of the antibody, or the antigen binding fragment thereof, in the pharmaceutical composition according to the present invention does not exceed 1 g, preferably does not exceed 500 mg, more preferably does not exceed 200 mg, even more preferably does not exceed 100 mg, and particularly preferably does not exceed 50 mg.
- compositions typically include an "effective" amount of one or more antibodies of the invention, i.e. an amount that is sufficient to treat, ameliorate, attenuate or prevent a desired disease or condition, or to exhibit a detectable therapeutic effect.
- Therapeutic effects also include reduction or attenuation in pathogenic potency or physical symptoms.
- the precise effective amount for any particular subject will depend upon their size, weight, and health, the nature and extent of the condition, and the therapeutics or combination of therapeutics selected for administration. The effective amount for a given situation is determined by routine experimentation and is within the judgment of a clinician.
- an effective dose will generally be from about 0.005 to about 100 mg/kg, preferably from about 0.0075 to about 50 mg/kg, more preferably from about 0.01 to about 10 mg/kg, and even more preferably from about 0.02 to about 5 mg/kg, of the antibody of the present invention (e.g. amount of the antibody in the pharmaceutical composition) in relation to the bodyweight (e.g., in kg) of the individual to which it is administered.
- the pharmaceutical composition according to the present invention may also comprise an additional active component, which may be a further antibody or a component, which is not an antibody.
- the additional active component is preferably a checkpoint inhibitor.
- a ZIKV neutralizing antibody, or an antigen binding fragment thereof, as described herein is combined with a ZIKV NS1 -binding antibody, or an antigen binding fragment thereof, as described herein as additional active component (co-agent).
- additional active component co-agent
- the pharmaceutical composition according to the present invention may comprise one or more of the additional active components, e.g. as described as co-agents below in the context of a combination therapy.
- the antibody, or the antigen binding fragment, according to the present invention can be present either in the same pharmaceutical composition as the additional active component or, preferably, the antibody, or the antigen binding fragment, according to the present invention is comprised by a first pharmaceutical composition and the additional active component is comprised by a second pharmaceutical composition different from the first pharmaceutical composition. Accordingly, if more than one additional active component is envisaged, each additional active component and the antibody, or the antigen binding fragment, according to the present invention is preferably comprised by a different pharmaceutical composition. Such different pharmaceutical compositions may be administered either combined/simultaneously or at separate times or at separate locations (e.g. separate parts of the body).
- antibody, or the antigen binding fragment, according to the present invention and the additional active component provide an additive therapeutic effect or, preferably, a synergistic therapeutic effect.
- the term “synergy” is used to describe a combined effect of two or more active agents that is greater than the sum of the individual effects of each respective active agent.
- the combined effect of two or more agents results in “synergistic inhibition” of an activity or process, it is intended that the inhibition of the activity or process is greater than the sum of the inhibitory effects of each respective active agent.
- the term “synergistic therapeutic effect” refers to a therapeutic effect observed with a combination of two or more therapies wherein the therapeutic effect (as measured by any of a number of parameters) is greater than the sum of the individual therapeutic effects observed with the respective individual therapies.
- a pharmaceutical composition comprising the antibody according to gZKA190, gZKA64, gZKA230, gZKA185, gZKA78 or an antigen binding fragment thereof, and a pharmaceutically acceptable carrier is preferred.
- a composition of the invention may include antibodies of the invention, wherein the antibodies may make up at least 50% by weight (e.g., 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more) of the total protein in the composition.
- the antibodies are preferably in purified form.
- the present invention also provides a method of preparing a pharmaceutical composition comprising the steps of: (i) preparing an antibody of the invention; and (ii) admixing the purified antibody with one or more pharmaceutically-acceptable carriers.
- a method of preparing a pharmaceutical composition comprises the step of: admixing an antibody with one or more pharmaceutically-acceptable carriers, wherein the antibody is a monoclonal antibody that was obtained from a transformed B cell or a cultured plasma cell of the invention.
- nucleic acid typically DNA
- Suitable gene therapy and nucleic acid delivery vectors are known in the art.
- compositions may include an antimicrobial particularly if packaged in a multiple dose format. They may comprise detergent e.g., a Tween (polysorbate), such as Tween 80. Detergents are generally present at low levels e.g., less than 0.01 %. Compositions may also include sodium salts (e.g., sodium chloride) to give tonicity. For example, a concentration of 10 ⁇ 2mg/ml NaCI is typical.
- compositions may comprise a sugar alcohol (e.g., mannitol) or a disaccharide (e.g., sucrose or trehalose) e.g., at around 15-30 mg ml (e.g., 25 mg/ml), particularly if they are to be lyophilized or if they include material which has been reconstituted from lyophilized material.
- the pH of a composition for lyophilization may be adjusted to between 5 and 8, or between 5.5 and 7, or around 6.1 prior to lyophilization.
- the compositions of the invention may also comprise one or more immunoregulatory agents.
- one or more of the immunoregulatory agents include(s) an adjuvant.
- the present invention provides the use of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention in (i) prevention and/or treatment of Zika virus infection; or in (ii) diagnosis of Zika virus infection.
- Such samples may be isolated from a subject, for example an isolated tissue sample taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancreas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain, skin or blood, preferably plasma or serum.
- the methods of diagnosis may also include the detection of an antigen/antibody complex, in particular following the contacting of an antibody or an antibody fragment with a sample.
- a detection step is typically performed at the bench, i.e. without any contact to the human or animal body. Examples of detection methods are well-known to the person skilled in the art and include, e.g., ELISA (enzyme- linked immunosorbent assay).
- prevention of Zika virus infection refers in particular to prophylactic settings, wherein the subject was not diagnosed with Zika virus infection (either no diagnosis was performed or diagnosis results were negative) and/or the subject does not show symptoms of Zika virus infection.
- prevention of Zika virus infection includes "post-exposure prophylaxis" (PEP), i.e. preventive treatment after a possible Zika virus infection, for example after a mosquito bite in a Zika virus affected area.
- PET post-exposure prophylaxis
- Prevention of Zika virus infection is in particular useful in high-risk subjects, such as in pregnant subjects and/or in subjects staying in Zika virus affected areas (such as subjects living in Zika virus affected areas or travelling to Zika virus affected areas).
- the subject is typically infected by Zika virus, diagnosed with Zika virus infection and/or showing symptoms of Zika virus i nfection.
- treatment and therapy'V'therapeutic of ZIKV infection include (complete) cure as wel l as attenuation of ZIKV infection.
- the antibody, or an antigen bindi ng fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present i nvention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is preferably used for treatment of Zika virus infection in subjects diagnosed with Zika virus infection or in subjects showing symptoms of Zika infection.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plural ity of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used for prevention and/or treatment of Zika virus infection in asymptomatic subjects. Those subjects may be diagnosed or not diagnosed with Zika virus infection.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used for prevention and/or treatment of Zika virus infection in pregnant subjects, in particular to prevent congenital infection.
- this may be performed in a similar manner as for the prevention of HCMV congential infection as described in Nigro G, Adler SP, La Torre R, Best AM, Congenital Cytomegalovirus Collaborating Group: Passive immunization during pregnancy for congenital cytomegalovirus infection; N Engl J Med 2005, 353:1 350-1362.
- the antibody, or the antigen-binding fragment thereof, accordi ng to the present invention can pass the placenta through the interaction with FcRn, for example if administered to a pregnant subject, e.g. by (i.v.) injection or any other route of administration as described herein.
- FcRn the interaction of "LALA" variants of antibodies as described herein with FcRn is not compromised. It is believed that FcRn is already expressed in the first trimester in the placenta.
- the antibody, or the antigen-binding fragment thereof, or the (plurality of) nucleic acid molecule(s) according to the present invention may also be administered to the extra-amniotic space.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used for prevention and/or treatment of Zika virus infection, wherein the antibody, or the antigen binding fragment thereof, the nucleic acid, the vector, the plurality of nucleic acids, the plurality of vectors, the cell, or the pharmaceutical composition is administered up to seven days after (a possible) Zika virus infection, preferably up to five days after (a possible) Zika virus infection, more preferably up to four days after (a possible) Zika virus infection, even more preferably up to three days after (a possible) Zika virus infection, and most preferably up to one day or two days after (a possible) Zika virus infection.
- Such a treatment schedule may be useful in therapeutic settings as well as in prophylactic settings, in particular in post-exposure prophylaxis (PEP).
- PEP typically the first administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present i nvention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is as soon as possible after a possible ZIKV infection, e.g. after a mosquito bite in a ZIKV affected area.
- the first administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is typically up to one or more days after (a possible) ZIKV infection, as described above.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used for prevention and/or treatment of Zika virus infection, wherein the antibody, or the antigen binding fragment thereof, the nucleic acid, the vector, the plural ity of nucleic acids, the plurality of vectors, the cel l, or the pharmaceutical composition is administered up to three months before (a possible) Zika virus infection, preferably up to one month before (a possible) Zika virus infection, more preferably up to two weeks before (a possible) Zika virus infection, even more preferably up to one week before (a possible) Zika virus infection, and most preferably up to one day before (a possible) Zika virus infection.
- a treatment schedule refers in particular to a prophylactic setting.
- nucleic acid molecule according to the present invention In general - and in particular in PEP - after the first administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention, one or more subsequent administrations may follow, preferably a single dose per day or per every second day for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, 1 1 , 1 2, 1 3, 1 , 1 5, 1 6, 1 7, 1 8, 1 9, 20, or 21 days.
- one or more subsequent admi nistrations may fol low, preferably a single dose once or twice per week for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, 1 1 , 12, 1 3, 1 , 1 5, 1 6, 1 7, 1 8, 1 9, 20, or 21 weeks.
- one or more subsequent administrations may follow, preferably a single dose every 2 or 4 weeks for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 1 3, 1 , ⁇ 5, 1 6, 1 7, 1 8, 19, 20, or 21 weeks.
- nucleic acid molecule according to the present invention it is also preferred that after the first administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention, one or more subsequent administrations may follow, preferably a single dose every two or four months for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 1 3,
- nucleic acid molecule according to the present invention the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention, one or more subsequent administrations may follow, preferably a single dose once or twice per year for 1 ,
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is administered at a (single) dose of 0.005 to 100 mg/kg bodyweight, preferably at a (single) dose of 0.0075 to 50 mg/kg bodyweight, more preferably at a (single) dose of 0.01 to 10 rng/kg bodyweight, even more preferably at a (single) dose of 0.05 to 5 mg kg bodyweight, and particularly preferably at a (single) dose of 0.1 to 1 mg/kg bodyweight.
- a (single) dose of 0.005 to 100 mg/kg bodyweight preferably at a (single) dose of 0.0075 to 50 mg/kg bodyweight, more preferably at a (single)
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention may be administered by any number of routes such as oral, intravenous, intramuscular, intra-arterial, intramedullary, intraperitoneal, intrathecal, intraventricular, transdermal, transcutaneous, topical, subcutaneous, intranasal, enteral, sublingual, intravaginal or rectal routes. Intravenous administration, or subcutaneous administration or intramuscular administration are preferred and intravenous administration or subcutaneous administration are more preferred.
- the antibody, or an antigen binding fragment thereof, or the (plurality of) nucleic acid molecule(s) according to the present invention may also be administered intra- or extra-amniotic, e.g. by injection.
- the present invention also provides a method of preventing and/or treating Zika virus infection in a subject, wherein the method comprises administering to a subject in need thereof the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention.
- Preferred embodiments of this method correspond to preferred embodiments of the medical use as described above (and below, regarding combination therapy).
- a preferred subject in this method is a subject diagnosed with Zika virus infection or showing symptoms of Zika virus infection.
- Another preferred subject in this method is a pregnant subject.
- the administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention in the methods and uses according to the invention can be carried out alone or in combination with a co-agent (also referred to as "additional active component" herein), which is in particular useful for preventing and/or treating ZI V infection.
- a co-agent also referred to as "additional active component” herein
- the invention encompasses the administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention, wherein it is administered to a subject prior to, simultaneously or sequentially with other therapeutic regimens or co-agents useful for treating and/or preventing ZIKV infection.
- Said antibody, nucleic acid, vector, cell or pharmaceutical composition, that is administered simultaneously with said co-agents can be administered in the same or different composition(s) and by the same or different route(s) of administration.
- Said other therapeutic regimens or co-agents may be, for example, a checkpoint inhibitor.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is administered in combination with a checkpoint inhibitor for the (medical) uses as described herein.
- Preferred checkpoint inhibitors are directed to a blockade of PD-1 /PD-L1 and/or of CTLA4 and, thus, include anti-PD-1 antibodies, anti-PD-L1 antibodies and anti-CTLA4 antibodies.
- the pharmaceutical composition according to the present invention may comprise one or more of the additional active components.
- a ZIKV neutralizing antibody, or an antigen binding fragment thereof, as described herein is combined with a ZIKV NS1 -binding antibody, or an antigen binding fragment thereof, as additional active component (co-agent).
- additional active component co-agent
- each additional active component (co-agent) is preferably comprised by a different pharmaceutical composition.
- Such different pharmaceutical compositions may be administered either combined/simultaneously or at separate times or at separate locations (e.g. separate parts of the body).
- the antibody, or the antigen binding fragment, according to the present invention and the additional active component (co-agent) provide an additive therapeutic effect or, preferably, a synergistic therapeutic effect.
- the term "synergy" is used to describe a combined effect of two or more active agents that is greater than the sum of the individual effects of each respective active agent.
- the combined effect of two or more agents results in “synergistic inhibition" of an activity or process
- the inhibition of the activity or process is greater than the sum of the inhibitory effects of each respective active agent.
- the term “synergistic therapeutic effect” refers to a therapeutic effect observed with a combination of two or more therapies wherein the therapeutic effect (as measured by any of a number of parameters) is greater than the sum of the individual therapeutic effects observed with the respective individual therapies.
- the present invention also provides the use of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plural ity of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention for monitoring the quality of an anti-Zika vaccine by checking that the antigen of said vaccine contains the specific epitope in the correct conformation.
- Preferred antigens comprised by such an anti-Zika vaccine to be checked include ZIKV envelope protein or any other molecule/complex comprising or consisting of (i) domain III of ZIKV E protein (EDI il) as described above or (ii) a quaternary ZIKV epitope as described above.
- the present invention also provides the use of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention in ⁇ in vitro) diagnosis of Zika virus infection.
- an isolated blood sample e.g., whole blood, serum and/or plasma
- methods of diagnosis may include contacting an antibody or an antibody fragment with a sample.
- samples may be isolated from a subject, for example an isolated tissue sample taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancreas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain, skin or blood, preferably serum or plasma.
- the methods of diagnosis may also include the detection of an antigen/antibody complex, in particular following the contacting of an antibody or an antibody fragment with a sample.
- a detection step is typically performed at the bench, i.e. without any contact to the human or animal body. Examples of detection methods are well-known to the person skilled in the art and include, e.g., ELISA (enzyme-linked immunosorbent assay).
- the present invention also provides a kit of parts comprising at least one antibody, or antigen binding fragment thereof, according to the present invention, at least one nucleic acid according to the present invention, the plurality of nucleic acids according to the present invention, at least one vector according to the present invention, the plurality of vectors according to the present invention, at least one cell according to the present invention, and/or at least one pharmaceutical composition according to the present invention.
- the kit may comprise means for administration of of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid molecule according to the present invention, the vector according to the present invention, the plurality of nucleic acid molecules according to the present invention, the plurality of vectors according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention, such as a syringe or a vessel, a leaflet, and/or a co-agent to be administered as described above.
- Figure 1 shows the reactivity (ELISA) and ZIKV and DENV1 neutralizing activity of antibodies derived from four ZIKV immune donors (ZKA, ZKB, ZKC and ZKD) to E protein of ZIKV and DENV1 -4 and to EDIII-domain of ZIKV E protein; NNB - neutralizing, non-E-protein binding antibodies.
- Figure 2 shows the binding of ⁇ 90, ZKA78 and ZKA64 antibodies to ZIKV and
- Figure 3 shows the binding of ZKA185 and ⁇ 90 antibodies to ZIKV E, DENV1 VLP and to ZIKV EDIII proteins as measured by ELISA.
- Figure 4 shows for Example 3 the neutralizing activity of ZKA1 90, ZKA64, ZKA64- LALA, ZKA230 and ZKA78 antibodies against ZIKV (H/PF/2013 strain) and
- Figure 5 shows for Example 3 the neutralizing activity of ZKA1 90, ZKA64, ZKA1 85,
- Figure 6 shows for Example 4 the infection enhancing activity (ADE, antibody-dependent enhancement) of ZKA1 90, ZKA64, ZKA64-LALA, ZKA1 85, ZKA230 and ZKA78 antibodies for ZIKV (H/PF/2013 strain) on non-permissive K562 cells as measured by flow-cytometry (% of infected cells).
- AD infection enhancing activity
- Figure 7 shows for Example 4 that four ZIKV-immune plasma and one DENV-immune plasma showed similar capacity to enhance ZIKV infection of K562 cells (upper panel). This ADE effect was completely blocked in all five immune plasma by the EDIII-specific ZKA64-LALA antibody (lower panel).
- Figure 8 shows the amino acid alignment of the EDIII region of 39 ZIKV strains from the Asian lineage since 2013 (including the prototypic strain MR766 of the African lineage isolated in 1947).
- Figure 9 shows for Example 3 the neutralizing activity of ZKA190 and ZKA190-LALA antibody against three strains of ZIKV (H/PF/2013, MR766 and MRS_OPY_Martinique_PaRikos2015) on Vero cells as measured by flow- cytometry (% of infected cells).
- Figure 10 shows for Example 5 neutralization of ZKA190 and C8 mAbs tested against a panel of four strains of ZI V, as determined by the percentage of infected Vero cells in the presence of increasing amounts of the mAbs (A). Shown are also the IC50 values (B) and statistics (C). Data are representative of at least two independent experiments.
- Figure 1 1 shows for Example 6 the neutralization and enhancement of ZIKV infection by antibody ZKA1 90.
- A Neutralization of ZIKV PRVABC59 strain infection of hNPCs by ZKA1 90, ZKA190-LALA and a control mAb as determined by plaque assay on Vero cells (left panel) and indirect immunofluorescence of infected hNPCs using fluorophore-labelled anti-E antibody (right panel).
- B B
- ADE of ZIKV infection of non-permissive K562 cells by ZKA190 and ZKA1 90- LALA (C) ADE induced in K562 cells when ZIKV is pre-incubated with serial dilutions of plasma serum from different ZlKV-positive patients (left panel). When ZKA1 90 LALA is added to the ZIKV-serum complexes, ADE is inhibited (right panel).
- D ADE induced in K562 cells when ZIKV is pre-incubated with serial dilutions of a prM cross-reactive mAb (DV62) derived from a DENV- immune donor.
- DV62 prM cross-reactive mAb
- ZKA190-LALA inhibits ADE of ZIKV when complexed with prM-reactive antibody DV62.
- E Effect on ADE induced by peak enhancing dilution of a DENV2 plasma (left panel) or anti-prM DV62 mAb (right panel) by serial dilutions of indicated mAbs. shows for Example 7 the identification of ZKA190 epitope and analysis of its conservation in ZIKV strains.
- A Overlay of [ ⁇ N HJ-HSQC spectra of "relabeled ZIKV EDIII in absence (black) or presence (red) of unlabelled ZKA1 90 Fab. Differences identify EDIII residues affected by antibody binding.
- the chemical shift perturbation (CSP, y-axis) is plotted against the EDIII residue number. Residues affected by antibody binding are in red.
- (C) Residues in FG loop identified by NMR epitope mapping is partially hidden in E protein mol A but largely exposed in mols B and C. EDIII of E protein was coloured in blue. Residues identified by NMR epitope mapping are coloured in magenta except those in the FG loop are coloured in green. Adjacent E proteins are shown as grey surface.
- Figure 1 4 shows for Examples 7 and 1 0 the binding of wt or mutated EDIII to ZKA1 90 IgG. SPR data and binding kinetics are shown. EDIII mutants that affect (red highlights) or do not affect binding are shown as indicated in the figure.
- Figure 1 5 shows for Example 8 the results of the confocal microscopy experiments. ZIKV incubated with a concentration exceeding 1 0'000-fold the IC50 value of either ZKA1 90 Fab or ful l IgG were added to Vero cells. The ZIKViantibocly complex is detected inside the cel ls (green) and co-localizes with endosomes (red, yellow overlay). Endosomes and acidic organelles are marked by Lysotracker red; Alexa-488 conjugated ZKA1 90 is in green. Nuclei are stained with DAPI
- Figure 1 6 shows for Example 9 prophylactic and therapeutic efficacy of ZKA190.
- ZKA1 90 is strongly protective against ZIKV infection when administered prophylactically to mice (A129 in (A) and AG1 29 in (B)) challenged with a lethal dose of ZIKV strain MP1 7451 .
- N 4-8 mice per group.
- Kaplan-Meier survival curves are shown (A). Significance was determined by using the Mantel-Cox log-rank test.
- Panel A top right: Morbidity score of mice monitored over a 14-1 5 day period (two different scoring methods were used; see (Dowall, S.D., Graham, V.A., Rayner, E., Atkinson, B., Hal l, G., Watson, R.J., Bosworth, A., Bonney, L.C., Kitchen, S., and Hewson, R. (201 6). A Susceptible Mouse Model for Zika Virus Infection. PLoS Negl Trop Dis 1 0, e0004658-1 3). Panel A, lower panels: body weight of mice. Panels B: ZKA1 90 or ZKA1 90-LALA were administered at 1 5 mg/kg at different time-points after ZIKV infection.
- Panel B top right: Morbidity score of mice monitored over a 14-day according to (Dowall et al., 201 6). Mice were monitored over a 1 4 clay period for body weight loss (Panel B, lower panels).
- Control antibody is MPE8 specific for RSV F protein (Corti, D., et al. Cross-neutralization of four paramyxoviruses by a human monoclonal antibody. Nature 501 , 439-443 (2013)).
- Figure 1 7 shows for Example 9 the prophylactic efficacy of the anti-ZIKV EDIII-specific mAb ZKA190 against ZIKV strains MP1 741 .
- D Human serum IgG concentration in day 5 blood samples. Significance was determined compared to control antibody treatment by nonparametric unpaired Mann-Whitney U test. *p ⁇ 0.05; **p ⁇ 0.01 ; ***p ⁇ 0.001 .
- Figure 1 8 shows for Example 9 the therapeutic efficacy of the anti-ZIKV EDIII-specific mAb ZKA1 90.
- Viral loads were measured as PFUs on day 5 in blood of all animals.
- Viral loads were measured as genomic copies by qPCR on day 5 in blood of all animals and in blood and indicated tissues when animals were culled at the end of the study or when the human end points were met.
- C ZKA190, ZKA1 85 and ZKA230 were tested for neutralization of H/PF/2013 (wt) and MARMs 1 -4.
- D Surface representation of two E protein dimers bound by ZKA1 90 (green); the ZKA1 90 NMR derived epitope is in red; positions mutated in MARMs are indicated in yellow (E370), blue (T335), orange (D67) and magenta (K84).
- E Model of FIT- 1 . The natural linkers between inner and outer Fabs allow a flexible movement of Fabs in the FIT-1 antibody. The variable regions of ZKA185 and ZKA1 90 are highlighted in blue and green, respectively.
- mice Morbidity score of mice monitored over a 21 day period (Dowall et al., 201 6).
- C Viral loads were measured as PFUs on day 5 in blood of all animals.
- D Mice were monitored over a 21 day period for body weight loss.
- Control mAb in panel A is MPE8 mAb (specific for RSV F protein (Corti, D., et al. Cross-neutralization of four paramyxoviruses by a human monoclonal antibody. Nature 501 , 439- 443 (2013)).
- Viral loads were measured as genomic copies by qPCR on day 5 in blood of all animals and in blood and indicated tissues when animals were culled at the end of the study or when the human end points were met. Significance was determined compared to control antibody treatment by nonparametric unpaired Mann-Whitney U test. *p ⁇ 0.05; **p ⁇ 0.01 .
- Example 1 Isolation of ZI V-specific antibodies and production of monoclonal antibodies lgG+ memory B cel ls were isolated from cryopreserved peripheral blood mononuclear cel ls (PBMCs) of four ZIKV-infected donors (ZKA, ZKB, ZKC and ZKD) using CD22 microbeads (Mi ltenyi Biotec), followed by depletion of cells carrying IgM, IgD and IgA by cell sorting.
- PBMCs peripheral blood mononuclear cel ls
- ZKA ZKB
- ZKC ZKD
- CD22 microbeads Microbeads
- Memory B cells from the ZIKV-infected donors were then immortalized with EBV (Epstein Barr Virus) and CpG (CpG oligodeoxynucleotide 2006) in multiple replicate wells as previously described (Traggiai, E.
- Neutralization assays were undertaken on Vera cells.
- ZIKV H/PF/201 3 that resulted in an infection rate (m.o.i, multiplicity of infection) of 0.35 was incubated with superntanants for 1 h at 37% (5% C02) before the addition to pre-seedecl 5 ⁇ 00 Vero cells. These were incubated for a further 5 days, after which supernatant was removed and WST-1 reagent (Roche) was added. Positive cultures were collected and expanded. From positive cultures the VH and VL sequences were retrieved by RT-PCR.
- Antibodies were cloned i nto human IgGI and Ig kappa or Ig lambda expression vectors (kindly provided by Michel Nussenzweig, Rockefeller University, New York, US) essentially as described (Ti ller T, Meffre E, Yurasov S, Tsuiji M, Nussenzweig MC, Wardemann H (2008) Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning. J Immunol Methods 329: 1 1 2-1 24). Monoclonal antibodies were produced from EBV-immortalized B cel ls or by transient transfection of 293 Freestyle cells (Invitrogen).
- Figure 1 provides an overview over selected ZIKV neutralizing antibodies (cf. Tables 1 and 2 for the amino acid sequences of their CDRs and heavy/light chain variable regions). The last two columns of Figure 1 provide the neutralization activities fICso) of ZIKV and DENV1 (if tested).
- the other columns provide binding activities (EC 5 o) of the antibodies to ZIKV E protei n (ZIKV E), DENVl E protein (DENV1 E), DENV2 E protein (DENV2 E), DENV3 E protei n (DENV3 E), DENV4 E protein (DENV4 E), DENV1 virus-like particle (DENVl VLP), DENV2 virus-like particle (DENV2 VLP), DENV3 virus-like particle (DENV3 VLP), DENV4 virus-like particle (DENV4 VLP), and to EDIII-domain of ZIKV E protein (Dill ZKA).
- Example 2 Characterization of antibodies ZKA190, ZKA1 85, ZKA230, ZKA64 and ZKA78
- Example 1 a large number of ZIKV-neutralizing antibodies were identified and characterized for their specificity to ZIKV, in particular ZIKV E protein and ZIKV EDIII as well as for their cross-reactivity towards DENV.
- Antibodies ZKA1 90 SEQ ID NOs: 1 - 1 8
- ZKA1 85 SEQ ID NOs: 1 9 - 36
- ZKA230 SEQ ID NOs: 37 - 54
- ZKA64 SEQ ID NOs: 73 - 90
- ZKA 78 SEQ ID NOs: 55 - 72
- ELISA ELISA plates were coated with ZIKV E protein at 1 or 3 pg/ml, blocked with 10% FCS in PBS, incubated with sera or human antibodies and washed. Bound antibodies were detected by i ncubation with AP-conjugated goat anti-human IgG (Southern Biotech). Plates were then washed, substrate (p-NPP, Sigma) was added and plates were read at 405 nm. The relative affinities of monoclonal antibody binding were determined by measuring the concentration of antibody (EC50) required to achieve 50% maximal binding at saturation.
- EC50 concentration of antibody
- results are shown i n Figures 3 and 4.
- ZKA64 and ZKA1 90 bound to ZIKV E and ZIKV EDIII ("Dill Zl") with low EC50 values, thereby indicating that ZKA64 and ZKA190 are binding to domai n II I of ZIKV E protein (EDIII).
- ZKA78 bound to ZIKV E, but not to ZIKV EDIII, indicating that ZKA78 is binding to ZIKV E, but not targeting the EDIII region.
- ZKA1 85 and ZKA230 did not show any detectable binding to ZIKV E and ZIKV EDI II (Fig. 3).
- ZKA185 and ZKA230 were referred to as "neutralizing-non-E-binding" (NNB) antibodies.
- NNB antibodies are assumed to recognize quaternary epitopes that are displayed on the ZI KV infectious virions but not on soluble proteins.
- ZKA1 90, ZKA1 85, ZKA230, and ZKA64 showed any detectable bindi ng to DENV E proteins ( Figure 1 , DENV1 -4 serotypes, and Figures 3 and 4), indicating that ZKA1 90, ZKA1 85, ZKA230, and ZKA64 are specific for ZIKV and not cross-reactive to dengue virus.
- ZKA78 in contrast, which is assumed to bind to ZIKV EDI/II, but not to ZIKV EDIII (cf. Fig. 2), bound to DENV E proteins ( Figures 1 and 3), indicating that ZKA78 is a cross-reactive antibody binding to both, ZIKV and DENV.
- ZKA64 and ZKA1 90 were additionally tested against E protein of dengue virus (DENV, serotypes number 1 - 4).
- ZKA64 and ZKA1 90 did not bind to DENV1 -4 E protein, thereby confirming that ZKA64 and ZKA1 90 are specific for ZIKV.
- ZKA78 in contrast, bound to DENV1 -4 E, confirming that ZKA78 is a cross-reactive antibody binding to the E protein of both ZIKV and DENV (cf. Fig. 1 ).
- Example 3 The isolated antibodies potently neutralize ZIKV infection
- the isolated antibodies ZKA1 90, ZKA1 85, ZKA230, ZKA64 and ZKA78 were tested for their abi lity to neutralize ZIKV and DENV1 infection in vitro.
- the cel ls were incubated with a goat anti- mouse IgG conjugated to Alexa Fluor488 (Jackson Immuno- Research, 1 1 54851 64) and analyzed by flow cytometry. In other cases the ZIKV neutralization data are also determined measuri ng cell viabil ity using the WST-1 reagent (Roche).
- the neutralization titer (50% inhibitory concentration [IC50]) was expressed as the antibody concentration that reduced the infection by 50% compared to cell-only control wells.
- Example 4 The "LALA” mutation inhibits antibody-dependent enhancement of ZIKV infection by serum antibodies
- Neutralizing antibodies were also tested for their ability to enhance the infection of ZIKV in the non-permissive K562 cells (antibody-dependent enhancement assay, ADE assay).
- ADE antibody-dependent enhancement assay
- ADE was measured by a flow based assay using K562 cells.
- Antibodies and ZIKV H/PF/201 3 (MOI 0.1 75) were mixed for ⁇ hour at 37°C and added to 5000 K562 cells/well. After four days, cells were fixed, permeabi lized, and stained with m4G2. The number of infected cells was determined by flow cytometry.
- LALA variant In view thereof it was investigated whether ADE could be also induced by immune sera and whether this could be blocked by neutral izing antibodies delivered as a "LALA variant".
- each of the heavy chains was mutated at amino acids 4 and 5 of CH2 domain by substituting an alanine in place of the natural leucine using site-directed mutagenesis.
- LALA variants (of human lgG1 antibodies) do not bind to Fc-gamma-receptors and complement.
- ZIKV ZIKV (MOI 0.1 75) was mixed with plasma from primary ZIKV- or DENV-infected donors for 30 minutes at 37°C ZKA64-LALA antibody was added at 50 pg/ml, mixed with 5000 K562 cells/well and incubated for three days. Cells were then stained with 4G2 and analyzed by flow cytometry.
- a potently neutralizing antibody such as ZKA1 90, ZKA230, ZKA1 85 or ZKA64, developed i n the "LALA" form, have a strong potential to be used in prophylactic or therapeutic settings to prevent congenital ZIKV infection, e.g. in pregnant women and/or in people living in high risk areas.
- the use of the LALA form avoids the risk of ZIKV ADE and, as shown above, could also block ADE of pre-existing cross-reactive antibodies, such as in the case of patients already immune to DENV.
- the cells were incubated with a goat anti-mouse IgG conjugated to Alexa Fluor488 (Jackson Immuno- Research, 1 1 54851 64) and analyzed by flow cytometry.
- the neutralization titer (50% inhibitory concentration [IC50]) is expressed as the antibody concentration that reduced the infection by 50% compared to virus-only control wells.
- Results are shown in Figure 10.
- ZKA190 mAb potently neutralized African, Asian and American strains with an IC50 ranging from 0.6 to 8 ng/ml.
- prior art antibody C8 was about 24-fold less potent.
- the potency of antibody ZKA1 90 was further investigated in vitro and in vivo.
- the mAb was synthesized in lgG1 wild-type (wt) format and in an IgGI Fc-LALA format.
- VH and VL sequences were cloned into human Igy1 , Ig and IgA expression vectors (kindly provided by Michel Nussenzweig, Rockefeller University, New York, NY, USA), essentially as described (Tiller T, Meffre E, Yurasov S, Tsuiji M, Nussenzweig MC, Wardemann H: Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning.
- Recombinant mAbs were produced by transient transfection of EXPI293 cells (Invitrogen), purified by Protein A chromatography (GE Healthcare) and desalted against PBS. To obtain the LALA variant, each of the heavy chains was mutated at amino acids 4 and 5 of CH2 domain by substituting an alanine in place of the natural leucine using site-directed mutagenesis. As described above, LALA variants (of human IgGI antibodies) do not bind to Fc-gamma-receptors and complement. As shown in Figure 10A and described in Example 5, ZKA1 90 was tested against a panel of four ZIKV strains. ZKA1 90 mAb potently neutralized African, Asian and American strains with an IC50 ranging from 0.004 to 0.05 nM ( Figure 10A; 0.6 to 8 ng/ml).
- ZIKV has been shown to infect human neural progenitor cells (hNPC) leading to heightened cell toxicity, dysregulation of cell-cycle and reduced cell growth
- ZKA190 and ZKA1 90-LALA were tested in hNPCs.
- adult male fibroblasts obtained from the Movement Disorders Bio-Bank (Neurogenetics Unit of the Neurological Institute 'Carlo Besta', Milan) were reprogrammed using the CytoTune-iPS 2.0 Sendai kit (Life Technologies).
- hi PSCs were maintained in feeder-free conditions in mTeSRI (Stem Cell Technologies).
- EBs embryoid bodies
- dissociated hiPSCs were plated into low adhesion plates i n mTeSRI supplemented with N2 (0.5x) (ThermoFisher Scientific), human Noggin (0.5 mg/ml, R&D System), SB431 542 (5 ⁇ , Sigma), Y27632 (1 0 ⁇ , Mi ltenyi Biotec) and penicillin/streptomycin (1 %, Sigma) (as described in Marchetto MCN, Carromeu C, Acab A, Yu D, Yeo GW, Mu Y, Chen G, Gage FH, Muotri AR: A model for neural development and treatment of Rett syndrome using human induced pluripotent stem cells.
- EBs were plated after 1 0 days onto matri gel -coated plates (1 :1 00, matrigel growth factor reduced, Corning) in DMEM/F1 2 (Sigma) with N2 (1 :1 00), nonessential amino acids (1 %, ThermoFisher Scientific) and penicillin/streptomycin.
- cel ls were passaged with Accutase (Sigma) and seeded onto matrigel coatecl-flasks in NPC media contai ning DMEM/F12, N2 (0.25%), B27 (0.5%, ThermoFisher Scientific), penici llin/streptomyci n and FGF2 (20 ng/ml, ThermoFisher Scientific).
- hNPCs (3x1 04) were plated on coverslips in 24-well plates 3 days prior to infection with PRVABC59 strain. Virus stock was incubated with the mAbs 1 h prior to addition to hNPCs to obtain an MOI of 0.5.
- ADE was tested in the K562 cell l i ne as described in Example 4. Briefly, ADE was measured by a flow based assay using K562 cel ls. Briefly, for ZKA1 90, ZKA1 90 and ZI KV H/PF/201 3 (MOI 0.1 75) were mixed for 1 hour at 37°C and added to 5000 K562 cells/well. After four days, cells were fixed, permeabilized, and stained with mAb m4G2. The number of infected cells was determined by flow cytometry.
- ZIKV MOI 0.1 75
- ZKA1 90-LALA was added at 50 pg/ml, mixed with 5000 K562 cells/well and incubated for three days. Cells were then stained with 4G2 and analyzed by flow cytometry. Results are shown in Figure 1 1 B.
- ZKA190 supports ADE from 0.0001 to 1 nM; as expected, ZKA1 90-LALA did not show any ADE activity.
- the ability of ZKA1 90-LALA to inhibit ADE induced by plasma from four ZIKV-immune donors in K562 cells was also tested. Results are shown in Figure 1 1 C. It was found that ZKA1 90-LALA completely inhibited the ADE induced by plasma antibodies ( Figure 1 1 C).
- Anti-prM antibodies form part of the predominant antibodies elicited during the human immune response against flaviviruses and have been shown to enhance virus infection in vitro (Dejnirattisai, W., Jumnainsong, A., Onsirisakul, N., Fitton, P., Vasanawathana, S., Limpitikul, W., Puttikhunt, C, Edwards, C, Duangchinda, T., Supasa, S., et al. (2010). Cross-reacting antibodies enhance dengue virus infection in humans. Science 328, 745-748).
- K562 cells were pre-incubated with serial dilutions of prM cross-reactive antibody DV62 (Beltramello, M., Williams, K.L., Simmons, CP., Macagno, A., Simonelli, L., Quyen, N.T.H., Sukupolvi- Petty, S., Navarro-Sanchez, E., Young, P.R., de Silva, A.M., et al. (2010). The human immune response to Dengue virus is dominated by highly cross-reactive antibodies endowed with neutralizing and enhancing activity. Cell Host Microbe 8, 271 -283) derived from a DENV immune donor. Results are shown in Figure 1 1 D.
- ZKA1 90-LALA can fully block anti-prM DV62 mAb-induced ADE of immature or partially immature ZIKV particles ( Figure 1 1 D).
- ZKA190 at low concentrations increased the prM DV62-mediated ADE of ZIKV infection, consistent with its ability to promote the entry of both immature and mature virions, while at concentrations above 1 .3 nM (i.e., 200 ng/ml) ZKA1 90 blocked ADE induced by both DENV plasma and mAb DV62.
- ZKA1 90-LALA, as wel l as its Fab fragment reduced ADE at concentrations above 0.06 nM, indicating that both inhibited virus infection at a post-attachment step, such as fusion.
- Example 7 ZKA190 binds to a conserved and highly accessible region of EDM
- solution NMR spectroscopy was used as described in Bardel li, M., Livoti, E., Simonelli, L, Pedotti, M., Moraes, A., Valente, A. P., and Varani, L. (201 5). Epitope mapping by solution NMR spectroscopy. J. Mol. Recognit. 28, 393-400; Simonelli, L, Beltramello, M., Yudina, Z., Macagno, A., Calzolai, L, and Varani, L. (201 0). Rapid structural characterization of human antibody-antigen complexes through experimental ly validated computational docking.
- spectra were recorded on a Bruker Avance 700 MHz NMR spectrometer at 300 K.
- standard triple resonance experiments HNCO, HN(CA)CO, H N(CO)CACB, HNCACB were used, whi le sidechains were annotated using HCCH-TOCSY and HBHA(CO)NH experiments.
- All NMR experiments were processed using Topspin 2.1 (Bruker Biospin) and analysed with CARA. NOESY cross peaks were automatically assigned using the CYANA "noeassign" macro based on the manually assigned chemical shifts.
- the R1 and R2 relaxation rates were derived from least-squares fits of corresponding exponential functions to the measured data using home-written scripts.
- the relaxation data were analyzed in a model-free approach using the software package DYNAMICS.
- the program ROTDIF was used to calculate the overall correlation time from the relaxation data (8.5 ns).
- NMR epitope mapping was performed as previously described (Bardelli et al., 2015; Simonelli et al., 201 0; 2013). Briefly, overlay of 15 NHSQC spectra of labelled EDIII free or bound to ZKA190 Fab allowed identification of EDIII residues whose NMR signal changed upon complex formation, indicating that they were affected by ZKA190 binding.
- the abi lity of ZKA1 90 to efficiently neutralize the virus may involve inhibition of either cell attachment or membrane fusion.
- a further mechanism might involve virus inactivation through cross-linking of viral particles.
- Z A1 90 Fab can neutralize ZIKV, albeit less efficiently than the correspondi ng IgG.
- ZKA1 90 (both Fab and IgG) might inhibit the -70 degree rotation of Dill required for viral fusion to the host cell membrane (Bressanelli, S., Stiasny, K., Al lison, S.L., Stura, E.A., Duquerroy, S., Lescar, J., Heinz, F.X., and Rey, F.A. (2004). Structure of a flavivirus envelope glycoprotein in its low-pH-induced membrane fusion conformation.
- ZKA1 90 to inhibit membrane fusion is supported by confocal microscopy analysis.
- Vero cells were plated at 7,500 cells/well on 12 mm-diameter coverslips in 24-well plates and incubated overnight. Cells were infected with ZIKV H/PF/2013 (MOI of 1 00) in the presence or absence of neutralizing concentrations of Alexa-488 conjugated mAbs (0.7 ⁇ ) at 37°C for 3 h, washed with PBS, and fixed with 2% paraformaldehyde in PBS for 30 min at room temperature.
- Acidified endosome were identified with Lysotracker red (Invitrogen) by adding the dye (50 nM) to the cells for the last 30 min of the incubation prior to fixation. Fixation was followed by extensive washes in PBS and 50 mM glycine and finally the coverslips were prepared for microscopy analysis using Vectashield mounting medium for fluorescence with DAPI (Vector Laboratories). Samples were analyzed by confocal microscopy using a Leica TCS SP5 microscope with a 63 x/1 .4 N.A. objective. Image analysis and processing was performed with FIJI software.
- ZKA190 and ZKA190-LALA were tested in A129 mice challenged with a lethal dose of ZIKV strain MP1 751 (African lineage). To test their prophylactic potencies, ZKA190 and ZKA1 90-LALA were administered one day before virus challenge.
- mice Female A129 mice (IFN-alpha/beta receptor -/-) and wild-type 129Sv/Ev mice aged 5-8 weeks were administered mAbs (ZKA190, ZKA1 90-LALA and control antibody MPE8 (Corti, D., et al. Cross-neutralization of four paramyxoviruses by a human monoclonal antibody. Nature 501 , 439-443 (2013)) diluted in PBS at different doses via the intraperitoneal (i.p.) route in a volume of 500 ⁇ .
- MAbs were administered either 1 day before or 1 , 2, 3 or 4 days after virus challenge.
- Tissue samples from A129 mice were weighed and homogenized into PBS using ceramic beads and an automated homogenizer (Precellys, UK) using six 5 second cycles of 6500 rpm with a 30 second gap. Two hundred ⁇ of tissue homogenate or blood solution was transferred into 600 pL RLT buffer (Qiagen, UK) for RNA extraction using the RNeasy Mini extraction kit (Qiagen, UK); samples were passed through a QIAshredder (Qiagen, UK) as an initial step. A ZIKV specific realtime RT-PCR assay was utilized for the detection of viral RNA from subject animals.
- the primer and probe sequences were adopted from Quick et al., 201 7 (Quick, J, Grubaugh ND, Pullan ST, Claro IM, Smith AD, Gangavarapu K, Oliveira G, Robles-Sikisaka R, Rogers TF, Beutler NA, et al.: Multiplex PCR method for MinlON and lllumina sequencing of Zika and other virus genomes directly from clinical samples. Nat Protoc 201 7, 12:1261 - 1 276) with in-house optimization and validation performed to provide optimal mastermix and cycling conditions. Real-time RT-PCR was performed using the Superscript III Platinum One-step qRT-PCR kit (Life Technologies, UK).
- the final mastermix (1 5 ⁇ ) was comprised of 10 I of 2x Reaction Mix, 1 .2 ⁇ of PCR-grade water, 0.2 ⁇ of 50 mM MgS04, 1 ⁇ of each primer (ZIKV 1086 and ZIKV 1 1 62c both at 18 ⁇ working concentration), 0.8 ⁇ of probe (ZIKV 1 107-FAM at 25 ⁇ working concentration) and 0.8 ⁇ of SSI 11 enzyme mix. Five ⁇ of template RNA was added to the mastermix, yielding a final reaction volume of 20 ⁇ .
- the cycling conditions used were 50°C for 10 minutes, 95°C for 2 minutes, followed by 45 cycles of 95°C for 10 seconds and 60°C for 40 seconds, plus a final cooling step of 40°C for 30 seconds.
- Quantification analysis using fluorescence was performed at the end of each 60°C step. Reactions were run and analyzed on the 7500 Fast platform (Life Technologies, UK) using 7500 software version 2.0.6. Quantification of viral load in samples was performed using a dilution series of quantified RNA oligonucleotide (Integrated DNA Technologies).
- the oligonucleotide comprised the 77 bases of ZIKV RNA targeted by the assay, based on GenBank accession AY632535.2 and was synthesized to a scale of 250 nmol with HPLC purification.
- ZKA1 90 and ZKA1 90-LALA were shown to protect mice from mortality and morbidity at concentrations of 5, 1 or 0.2 mg/kg ( Figure 16A- B).
- Viral titers in blood and organs were reduced significantly compared to control antibody-treated animals, even in the presence of serum antibody levels below 1 pg/ml ( Figure 1 7A-D).
- ZKA190 and ZKA1 90- LALA were administered at different time-points following ZIKV infection.
- survival rates of 80%-100% were achieved, and the morbidity was greatly reduced even when treatment was given four days post-infection (Figure 1 6E-G).
- ZKA1 90 and ZKA1 90-LALA treatment at all post-infection time-points resulted in significantly reduced viral titers, compared to animals treated with control antibody, with a clear trend for greater reduction with earlier treatment (Figure 1 8A-1 6C).
- ZKA1 90-LALA showed a significantly reduced antiviral activity in the blood day 5 sample as compared to ZKA190 when mAbs were given four days post-infection, a result that might be related to the impaired ability of the LALA variant to facilitate rapid clearance of coated virions.
- MARM1 Monoclonal Antibody Resistant Mutant 1 , MARM1
- T335R an amino acid substitution in Dill
- le viruses from the other treated mice did not contain any E mutations.
- Introduction of the T335R mutation into recombinant DIM showed that it abrogated ZKA1 90 binding, as determined by SPR ( Figure 1 4; cf. Example 7 for experimental methods).
- Example 10 In vitro selection of ZIKV escape mutants Use of antibody therapeutics may result in the selection of escape mutants.
- ZIKV H/PF/2013
- ZIKV H/PF/2013
- TCID50 of H/PF/201 3 ZIKV in 500 ⁇ were incubated with 250 ⁇
- the mixture was incubated for 45 minutes at 37°C, followed by the addition of 250 ⁇ of a Vero cells suspension (3.2 x1 06 cells) and an incubation in a 24 wel l plate for three-four days at 37°C to allow virus propagation to occur.
- RNA extraction was done followed by a one-step-PCR to amplify and sequence the ZIKV E protein amplicon.
- Cell supernatant (1 40 ⁇ ) from the MARMs selection was used for RNA extraction with the QIAamp Viral RNA mini kit (Qiagen).
- cDNA synthesis and PCR amplification were performed together using the Superscript III One-Step RT-PCR with Platinium Taq (Invitrogen).
- reaction mix 8 ⁇ sterile water, 2 ⁇ of each primer, 1 ⁇ RNAse out (Life Technologies), 2 ⁇ Superscript III RT/Platinum TaqMix and 12 ⁇ RNA were used giving a final reaction volume of 50 ⁇ .
- the cycling conditions were 54°C for 40 minutes, 94°C for 2 min followed by 45 cycles of 94°C for 45 seconds, 50°C for 45 seconds and 68°C for 1 .5 minutes with a final elongation step at 68°C for 5 minutes and a final cooling step at 4°C.
- the PCR products were analyzed and extracted from a 1 .5 % agarose gel and further purified with the GFX PCR DNA and Gel Band Purification kit (GE Healthcare).
- GE Healthcare GFX PCR DNA and Gel Band Purification kit
- For the sequencing reaction 8 ⁇ of purified PCR product was mixed with 2 ⁇ primer in a final volume of 10 ⁇ 1 and sent for sequencing (Microsynth).
- E protein N-terminal products were sequenced with ZIKV-E-F2 5'- ACTTGGTCATGATACTGCTGATTGC-3' (SEQ ID NO: 270) and ZIKV-E-R2 5'- TCGGTTC AC AATCAAGTCCTAG GCT-3 ' (SEQ ID NO: 271 ), C-terminal PCR products with ZIKV-E-f2058 5'-GCTAACCCCGTAATCACTGAAAGCA-3' (SEQ ID NO: 272) and ZIKV-E- 1-2248 5'-AAGACTGCCATTCTCTTGGCACCTC-3' (SEQ ID NO: 273). Sequences were assembled and analyzed using CLC Main Workbench software (CLC Bio, version 5).
- Resistant mutant MARM2 was isolated after three rounds of selection, and its E protein showed a E370K mutation in Dill.
- the mutation abolished neutralization by ZKA1 90, although the antibody can bind to the mutated Dill ( Figure 14).
- the mutations in the in vivo (T335R) and in vitro(E370K) MARMS are located on the BC and DE loops of Dill, respectively, and are consistent with the epitope identified by NMR.
- Example 1 1 Development of bispecific antibodies according to the present invention Viral escape mutants can greatly hinder the efficacy of therapeutic antibodies. To overcome this problem, the present inventors hypothesized that the possibility of virus escaping would be greatly reduced when combining two highly neutralizing antibodies. In view thereof, a series of bispecific antibodies combining ZKA1 90 with other potently neutralizing mAbs directed towards distinct sites on the E protein was generated. Thereby, it was focused on two mAbs, ZKA185 and ZKA230, that are highly neutralizing and do not compete with ZKA190.
- ZKA1 85 and to a lesser extent ZKA230, potently neutralized African, Asian and American strains with an IC50 ranging from 0.02 to 0.62 nM (Figure 1 9A).
- ZKA185 binds with high affinity to recombinant ZIKV E protein and to Zika virus-like particles (VLP) but not to the isolated Dill ( Figure 1 9B).
- ZKA230 bound to ZIKV VLPs, but not to recombinant E or Dill, suggesting that it recognizes a quaternary epitope displayed only on the viral surface ( Figure 19B).
- ZKA1 85 IgG and Fab were shown to bind to E and VLP antigens with simi lar high affinity by ELISA.
- MARMs against ZKA185 (MARM3) and ZKA230 (MARM4) were isolated by passaging virus in the presence of sub-neutralizing antibody concentrations as described above.
- MARM3 contained substitutions at K84E and D67H, which are both located on Dll ( Figure 1 9D).
- MARM4 showed a mixture of different amino acid substitutions at position 84 (from K to G, E or R), confirmed in multiple sequencing experiments.
- MARMs 1 to 4 were tested against ⁇ 90, ZKA1 85 and ZKA230.
- ZKA1 90 neutralized ZKA185 and ZKA230 MARMs as well as the parental virus (Figure 19C).
- ZKA185 neutralized both ZKA1 90 and ZKA230 MARMs.
- ZKA230 neutralized only ZKA1 90 MARM2 and did not neutralize either ZKA1 90 MARM1 or ZKA1 85 MARM3.
- ZKA1 90 MARM2 (E370K) were serially passaged in the presence of ⁇ 85 or ZK230. Thereby, it was found that double MARMs emerged after 3 to 4 passages.
- ZKA230 introduced an extra K84E mutation while ZKA185, selected for a D76G mutation.
- ZKA1 85 was selected to be used together with ZKA1 90 for the development of a bispecific antibody since it potently cross-neutralizes ZIKV strains, binds to an alternative site, and does not compete with ZKA1 90.
- the bispecific antibody was produced in a tetravalent symmetric format called Fabs-in-tandem-lg (FIT-lg).
- FIT-lgs are described in detail, for example, in WO 2015/103072 A1 and in Gong S, Ren F, Wu D, Wu X, Wu C: Fabs-in- tandem immunoglobulin is a novel and versatile bispecific design for engaging multiple therapeutic targets.
- FIT-lg may be produced using three polypeptides.
- Polypeptide 1 usually comprises the light chain of the outer Fab fused, preferably without linkers, to the N-terminal region of the inner Fab heavy chain.
- Polypeptide 2 usually comprises the heavy chain variable and CH1 regions of the outer Fab, and polypeptide 3 usually comprises by the light chain of the inner Fab.
- an antibody of the FIT-lg format usually comprises an "inner Fab" and an "outer Fab".
- Two types of FIT-lgs were generated with ZKA1 90 Fab either in the outer or inner position.
- the three genes encoding for FIT-lg were codon optimized, synthesized by Genscript and cloned as follows: i) the VL of the outer Fab, followed by the full constant region (lambda or kappa), is fused with the VH of the inner and cloned into the Igy1 expression vector (modified to encode for the LALA mutation).
- the resulting polypeptide 1 is formed by VL and CL of the outer Fab, VH of the inner Fab fused to IgGI CH1 -hinge-CH2- CH3 domains; ii) the VH gene of the outer Fab (encoding for polypeptide 2 formed by VH and CH1 of the outer Fab) was cloned into the Fab expression vector (Igyl expression vector in which a stop codon is introduced after the codon encoding for the CH1 cysteine residue 220); iii) the VL gene of the inner Fab is cloned into the IgK or ⁇ gk expression vectors (encoding for polypeptide 3 formed by VL and CL of the inner Fab).
- FIT-lg mAbs were produced by transient transfection of EXPI293 cells (Invitrogen) using a molar ratio of 1 :3:3 of the three constructs described above (as described in WO 201 5/1 03072 A1 ), purified by Protein A chromatography (GE Healthcare) and desalted against PBS. The proteins were analyzed by SDS-PAGE in both reduced and non-reduced conditions and their concentrations determined by BCA (Pierce, Rockford, IL). In non-reduced conditions, FIT-lg migrated as a major single band of approximately 250 KDa.
- each of the FIT-lg proteins yielded two bands, one higher MW band is polypeptide 1 of approximately 75 KDa, and one lower MW band corresponds to both polypeptide 2 and 3 overlapped at approximately 25 KDa.
- size exclusion chromatography SEC was used to analyze each protein. Purified FIT-lg, in PBS, was applied on a Superdex 200 Increase 5/150 GL. All proteins were determined using UV detection at 280 nm and 214 nm. FIT-lg proteins exhibited a single major peak, demonstrating physical homogeneity as monomeric proteins.
- Example 12 In vitro characterization of an antibody according to the present invention
- FIT-1 The FIT-lg bispecific antibody (here designated FIT-1 ) with ZKA1 90 in the outer and ZKA1 85 in the inner Fab positions ( Figure 19E) was selected and further characterized.
- ELISA showed FIT-1 to bind Dill, E and VLP ( Figure 1 9F).
- FIT-1 retained high neutralizing potency against ZIKV strains, with IC50 values largely similar to those of the parental ZKA190 and ZKA1 85 antibodies ( Figure 1 9G).
- FIT-1 was produced using the backbone lgG1 antibody in the LALA format, thereby eliminating any possibility of causing ADE.
- FIT-1 bound to E protein with higher affinity than either the parental ZKA1 90 and ZKA185 antibodies (KD values: ZKA1 85 1 .8 nM, ZKA1 90 9.3 nM and FIT-1 KD ⁇ 1 pM due to slower dissociation rate, presumably through avidity effects).
- FIT-1 effectively neutralized all the ZKA190, ZKA185 and ZKA230 MARMs (Figure 1 9H) in contrast to the individual mAbs.
- the neutralizing activity of the Fab fragment of FIT-1 (each comprising one ZKA1 90 and one ZKA185) was reduced only by about 6-fold ( Figure 1 91, right panel).
- the ability of FIT-1 to select MARMs was tested (as described above).
- FIT-1 as ZKA190, likely inhibits virus infection at a post-attachment step, likely fusion (Fig. 1 9J).
- FIT-1 as well as its Fab fragment, blocked ADE of human anti-DENV2 plasma or DV62 at concentrations above 0.1 nM and 10 nM, respectively ( Figure 1 9K), demonstrating that FIT-1 did not cause ADE and could block ADE of monocytic cells by poorly neutralizing cross-reactive antibodies.
- Example 13 In vivo therapeutic potential of FIT-1
- three different doses (1 5, 5 and 1 mg/kg) were administered at three different time-points to female A129 mice following ZIKV infection. Briefly, female A129 mice were assigned to 10 distinct groups (control and three different doses with three different administration time points for each dose). All animals were challenged subcutaneously with 102 pfu ZIKV (strain MP1 751 ) and followed for 14 days. Mice of the nine treatment groups were administered with bispecific antibody FIT-1 diluted in PBS at 1 5, 5 or 1 mg/kg via the intraperitoneal (i.p.) route in a volume of 500 ⁇ on clay 1 , day 2, or day 3 after ZIKV virus challenge.
- i.p. intraperitoneal route
- VL 9 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKRGQAPR
- CDRH2 1 1 atatcatatgagggaagtaataaa
- CDRL1 1 3 cagagtgttagtagcagttac
- CDRL3 1 6 cagcagtatggtaggtcaaggtggaca VH 17 caggtgcagctggtggagtctgggggaggcgtggtccagc ctgggaggtcctgagactctcctgtgcagcctctggatt caccttcagtaaatatggcatgcactgggtccgccaggct ccaggcaaggggctggagtgggtggcagttatatcatatg agggaagtaataaatattatgcagactccgtgaagggccg attcaccatctccagagacaattccaagaacacgctgtat ctgtgcaaatgaacagcctgagagctgaggacacggcagtgtgt a11actgtgcgaaatcggggacccaatactatgatactac
- CDRL2 24 VIYEDNKRP
- VH 26 EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWITWVRQMPGKGLE
- CDRL3 43 A WDDSLGGLV
- CDRL2 51 ctcatctgtattaatgatcaccggccc
- CDRL3 52 gcaacatgggatgacagcctgggtggccttgta VH 53 caggtgcagctgcaggagtcgggcccaggcctggtgaagcc ttcggagaccctgtccctcacctgcgcagtctctggtggct ccatcagtagtgactactggagctggatccggcagccccca gggaagggactggagtggattgggtatatctattacagtgg gagcaccaactacaacccctccctcaagagtcgagtcacca tatcagtagacacgtccaagaaccacttctcccctgaagctg aactctgtgaccgctgcggacacggccgtgtattactgtgc gaggaggaggagtatgattcccttg
- VL 54 cagtctgtgctgactcagccaccctcagcgtctgggacccc cgggcagagggtcaccatctcttgttctggaagcagctcca acatcggaggtaattatgtatactggtaccagcagctccca ggaacggcccccaaactcctcatctgtattaatgatcaccg gccctcaggggtccctgaccgattctctggctccaagtctg gcacctcagcctcccctggccatcagtgggctccagtccgag gatgaggctgattattactgtgcaacatgggatgacagcctgtattactgtgcaacatgggatgacagccctttactgtgcaacatgggatgacagcctgtattactg
- CDRL1 58 QSVLYRSNNK Y
- VH 62 EVQLAESGGGLVQPGGSLTLSCSGSGFTFSNYAMVWARQAPGKGLE
- VL 63 DIV TQSPDSLAVSLGERATINCKSSQSVLYRSNNKNYLSWYQQKP
- CDRL1 67 cagtccgtgctgtaccgctctaacaacaagaattac
- CDRL2 69 ctgatctattgggcttcaacccgggaa
- CDRL3 70 cagcagtactattctagtcctcgaact
- CDRL2 87 ctgatctatggagcatcctccagggct
- CDRL3 88 cagcagtacaatgattggccccctatcaca
- VH 89 caggtgcagctggtccagagcggagcagaggtgaagaaacc cggcgcctcagtgaaggtcagetgcaaagettccggctaca ccttcacagggtatcacatcgactgggtgaggcaggcaaga ggacagggactggaatggatgggacggattaaccctaattc tggcgggaccaactacgcccagaagtttcagggccgagtga ctatgaccagagacaccagcatctccacagcttatatgcag ctgtcccggctgagatctgacgatagtgccgtctactattg tgagctcggatgagctctctattggggcttcgatcattggg ggcagggaacactggtgtcagttt
- VH 102 EVQLAESGGGLVQPGGSLRLSCSGSGFIFSNYAMVWARQAP
- VH 106 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYVMHWVRQAP
- VH 1 22 DERLVESGGGLVQPGGSLRLVCSASGFTFSAHAMH VRQPP
- VH 1 30 QLQLQESGPGLVKPSETLSLTCTVSGGSIRRTNSYWGWIRQ
- VH 1 34 EVQLVQSGAEVKKPGESLRISCKASGYSFTSSWIN VRQMP
- VH 1 38 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAP
- VH 1 42 QVQLVESGGGWQPGRSLRLSCAASGFTFSRSGMHWVRQAP
- VH 1 46 QVQLVQSGAEVKKPGASLKVSCKASGYTFDDYYIH VRQAP
- VH 1 50 EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWISWVRQMP
- VH 1 54 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMH VRQTP
- VH 1 62 QVQLVESGGGVVQPGRSLRLSCAASGFTFTSYGMHWVRQTP
- VH 1 66 QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMH VRQAP
- VH 178 EVQLVESGGDLVQPGGSLRLSCVASGFTFSDHFMDWVRQAP
- VH 1 86 EVQLVESGGGLVQPGGSLRLSCVASGFTFSDHFMDWVRQAP
- VH 1 90 QVHLVQSGAEVKKPGSSVNVSCKASGGTFSAYAIS VRQAP
- GQGPEWVG WINTNTGNPTYAQGFTGRFVLSLDTSVSTAFLQ ISSLKAEDTAVYYCARVIVPYAFDI GQGTMVTVSS
- VH 21 4 QVQLVQSGTEVKKPGASVKVSCKASGYTFTGYYMHWVRQAP
- VH 222 EVQLVQSGAEVKKPGKSLRISCKGSGYIFTRYWIS VRQMP
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Hematology (AREA)
- Physics & Mathematics (AREA)
- General Engineering & Computer Science (AREA)
- Urology & Nephrology (AREA)
- Microbiology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Analytical Chemistry (AREA)
- Cell Biology (AREA)
- Plant Pathology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Tropical Medicine & Parasitology (AREA)
- Food Science & Technology (AREA)
Priority Applications (25)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2017/071891 WO2019042555A1 (en) | 2017-08-31 | 2017-08-31 | MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF |
| BR112020000619-0A BR112020000619A2 (pt) | 2017-08-31 | 2018-08-31 | anticorpos multiespecíficos que se ligam especificamente a epítopos do zika vírus e usos dos mesmos |
| CA3070780A CA3070780A1 (en) | 2017-08-31 | 2018-08-31 | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof |
| CR20200087A CR20200087A (es) | 2017-08-31 | 2018-08-31 | Anticuerpos multiespecíficos que se unen específicamente a los epítopos del virus del zika y usos de los mismos |
| CN202310134988.XA CN116693668A (zh) | 2017-08-31 | 2018-08-31 | 特异性结合至寨卡病毒表位的多特异性抗体及其用途 |
| EA202090559A EA202090559A1 (ru) | 2017-08-31 | 2018-08-31 | Мультиспецифические антитела, специфичные в отношении эпитопов вируса зика, и их применение |
| US16/640,622 US11926658B2 (en) | 2017-08-31 | 2018-08-31 | Multispecific antibodies specifically binding to Zika virus epitopes |
| MYPI2019007495A MY201774A (en) | 2017-08-31 | 2018-08-31 | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof |
| AU2018322842A AU2018322842A1 (en) | 2017-08-31 | 2018-08-31 | Multispecific antibodies specifically binding to Zika virus epitopes and uses thereof |
| EP18762834.2A EP3676290A1 (en) | 2017-08-31 | 2018-08-31 | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof |
| PE2020000287A PE20200888A1 (es) | 2017-08-31 | 2018-08-31 | Anticuerpos biespecificos que se unen a los epitopos del virus del zika |
| KR1020207007493A KR20200042499A (ko) | 2017-08-31 | 2018-08-31 | 지카 바이러스 에피토프에 특이적으로 결합하는 다중특이적 항체 및 이의 용도 |
| PCT/EP2018/073489 WO2019043166A1 (en) | 2017-08-31 | 2018-08-31 | MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF |
| MX2020002181A MX2020002181A (es) | 2017-08-31 | 2018-08-31 | Anticuerpos multiespecificos que se unen especificamente a los epitopos del virus del zika y usos de los mismos. |
| JP2020507007A JP7244489B2 (ja) | 2017-08-31 | 2018-08-31 | ジカウイルスエピトープに特異的に結合する多重特異性抗体及びその使用 |
| CN201880057824.9A CN111344302B (zh) | 2017-08-31 | 2018-08-31 | 特异性结合至寨卡病毒表位的多特异性抗体及其用途 |
| SG11202000206SA SG11202000206SA (en) | 2017-08-31 | 2018-08-31 | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof |
| IL271515A IL271515A (en) | 2017-08-31 | 2019-12-17 | Multispecific antibodies that specifically bind to Zika virus epitopes and their uses |
| PH12020550025A PH12020550025A1 (en) | 2017-08-31 | 2020-01-16 | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof |
| DO2020000043A DOP2020000043A (es) | 2017-08-31 | 2020-02-26 | Anticuerpos multiespecíficos que se unen específicamente a los epítopos del virus del zika y usos de los mismos |
| CL2020000467A CL2020000467A1 (es) | 2017-08-31 | 2020-02-26 | Anticuerpos multiespecíficos que se unen específicamente a los epítopos del virus del zika y usos de los mismos. |
| CONC2020/0002060A CO2020002060A2 (es) | 2017-08-31 | 2020-02-26 | Anticuerpos multiespecíficos que se unen específicamente a los epítopos del virus del zika y usos de los mismos |
| ECSENADI202014362A ECSP20014362A (es) | 2017-08-31 | 2020-02-27 | Anticuerpos multiespecíficos que se unen específicamente a los epítopos del virus del zika y usos de los mismos |
| JP2023036084A JP2023071956A (ja) | 2017-08-31 | 2023-03-09 | ジカウイルスエピトープに特異的に結合する多重特異性抗体及びその使用 |
| US18/584,654 US20240254207A1 (en) | 2017-08-31 | 2024-02-22 | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2017/071891 WO2019042555A1 (en) | 2017-08-31 | 2017-08-31 | MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019042555A1 true WO2019042555A1 (en) | 2019-03-07 |
Family
ID=59811299
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2017/071891 Ceased WO2019042555A1 (en) | 2017-08-31 | 2017-08-31 | MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF |
| PCT/EP2018/073489 Ceased WO2019043166A1 (en) | 2017-08-31 | 2018-08-31 | MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2018/073489 Ceased WO2019043166A1 (en) | 2017-08-31 | 2018-08-31 | MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF |
Country Status (21)
| Country | Link |
|---|---|
| US (2) | US11926658B2 (https=) |
| EP (1) | EP3676290A1 (https=) |
| JP (2) | JP7244489B2 (https=) |
| KR (1) | KR20200042499A (https=) |
| CN (2) | CN116693668A (https=) |
| AU (1) | AU2018322842A1 (https=) |
| BR (1) | BR112020000619A2 (https=) |
| CA (1) | CA3070780A1 (https=) |
| CL (1) | CL2020000467A1 (https=) |
| CO (1) | CO2020002060A2 (https=) |
| CR (1) | CR20200087A (https=) |
| DO (1) | DOP2020000043A (https=) |
| EA (1) | EA202090559A1 (https=) |
| EC (1) | ECSP20014362A (https=) |
| IL (1) | IL271515A (https=) |
| MX (1) | MX2020002181A (https=) |
| MY (1) | MY201774A (https=) |
| PE (1) | PE20200888A1 (https=) |
| PH (1) | PH12020550025A1 (https=) |
| SG (1) | SG11202000206SA (https=) |
| WO (2) | WO2019042555A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20210082306A (ko) * | 2019-12-24 | 2021-07-05 | 강원대학교산학협력단 | 지카바이러스 재조합 서브유닛 백신의 개발 및 이의 제조방법 |
| WO2021236845A1 (en) * | 2020-05-20 | 2021-11-25 | Takeda Vaccines, Inc. | Method for detection of zika virus specific antibodies |
| US11730802B2 (en) | 2017-11-03 | 2023-08-22 | Takeda Vaccines, Inc. | Zika vaccines and immunogenic compositions, and methods of using the same |
| US11975062B2 (en) | 2017-11-30 | 2024-05-07 | Takeda Vaccines, Inc. | Zika vaccines and immunogenic compositions, and methods of using the same |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019042555A1 (en) * | 2017-08-31 | 2019-03-07 | Humabs Biomed Sa | MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF |
| JP7725465B2 (ja) * | 2019-11-07 | 2025-08-19 | 中国科学院微生物研究所 | ジカ・デングワクチン及びその使用 |
| WO2021236225A1 (en) * | 2020-05-20 | 2021-11-25 | Takeda Vaccines, Inc. | Method for detection of zika virus specific antibodies |
| CN115697392B (zh) * | 2020-06-28 | 2026-03-13 | 神州细胞工程有限公司 | 一种降低病毒ade效应的方法 |
| US20240002479A1 (en) * | 2020-11-23 | 2024-01-04 | The Regents Of The University Of Michigan | Single-chain antibody against flavivirus ns1 protein |
| CN114958747B (zh) * | 2022-06-08 | 2024-08-20 | 中国科学院动物研究所 | 一种多能干细胞诱导产生兴奋性和抑制性神经元的方法 |
| WO2025107050A1 (pt) * | 2023-11-23 | 2025-05-30 | Imunotera Soluções Terapêuticas Ltda | Anticorpo monoclonal, vetor de expressão, uso, composição farmacêutica, processo para produção, método de prevenção e/ou tratamento de infecções por flavivírus e kit para a detecção de vírus da zika e da dengue |
| CN119119256B (zh) * | 2024-09-28 | 2025-07-18 | 宁波大学 | 一种乙型脑炎病毒和寨卡病毒的单克隆抗体及其应用 |
Citations (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3766162A (en) | 1971-08-24 | 1973-10-16 | Hoffmann La Roche | Barbituric acid antigens and antibodies specific therefor |
| US3791932A (en) | 1971-02-10 | 1974-02-12 | Akzona Inc | Process for the demonstration and determination of reaction components having specific binding affinity for each other |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4233402A (en) | 1978-04-05 | 1980-11-11 | Syva Company | Reagents and method employing channeling |
| US4495285A (en) | 1981-10-30 | 1985-01-22 | Kimihiro Shimizu | Plasminogen activator derivatives |
| US4609546A (en) | 1982-06-24 | 1986-09-02 | Japan Chemical Research Co., Ltd. | Long-acting composition |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US4831175A (en) | 1986-09-05 | 1989-05-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| US5595721A (en) | 1993-09-16 | 1997-01-21 | Coulter Pharmaceutical, Inc. | Radioimmunotherapy of lymphoma using anti-CD20 |
| WO2000052031A2 (en) | 1999-03-01 | 2000-09-08 | Idec Pharmaceuticals Corporation | Kit for radiolabeling proteins with yttrium-90 |
| WO2000052473A2 (en) | 1999-03-01 | 2000-09-08 | Idec Pharmaceuticals Corporation | Radiolabeling kit and binding assay |
| US20050163783A1 (en) | 2003-06-27 | 2005-07-28 | Biogen Idec Ma Inc. | Purification and preferential synthesis of binding molecules |
| WO2008143954A2 (en) | 2007-05-14 | 2008-11-27 | Biogen Idec Ma Inc. | Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto |
| WO2015103072A1 (en) | 2013-12-30 | 2015-07-09 | Epimab Biotherapeutics | Fabs-in-tandem immunoglobulin and uses thereof |
Family Cites Families (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2980099A1 (en) * | 2014-07-31 | 2016-02-03 | Bernhard-Nocht-Institut für Tropenmedizin | Compositions and methods for detecting flaviviridae infections |
| UA126548C2 (uk) | 2015-07-16 | 2022-11-02 | Бхарат Біотек Інтернешнл Лімітед | Вакцинна композиція для профілактики абровірусних інфекцій |
| AU2017230112A1 (en) | 2016-03-11 | 2018-10-04 | The Johns Hopkins University | Live attenuated Zika virus vaccine |
| CN105954512A (zh) | 2016-06-01 | 2016-09-21 | 卢氏实验室公司 | 一种快速免疫层析法检测塞卡病毒Zika virus的检测条 |
| WO2018010789A1 (en) | 2016-07-13 | 2018-01-18 | Humabs Biomed Sa | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
| TW201815821A (zh) * | 2016-07-18 | 2018-05-01 | 美商再生元醫藥公司 | 抗茲卡病毒抗體及使用方法 |
| CN110172095B (zh) | 2016-08-10 | 2020-09-04 | 中国科学院微生物研究所 | 一种高中和活性的寨卡病毒人源单克隆抗体及其应用 |
| WO2018081754A1 (en) * | 2016-10-29 | 2018-05-03 | University Of Miami | Anti-zika virus antibodies |
| EP3534953A4 (en) * | 2016-11-02 | 2020-10-07 | Vanderbilt University | ANTIBODIES AGAINST HUMAN ZIKA VIRUS AND THEIR USE PROCEDURES |
| CN106841601A (zh) | 2016-12-30 | 2017-06-13 | 广州市达瑞生物技术股份有限公司 | 寨卡病毒多片段融合蛋白的制备及IgG/IgM抗体检测试剂盒 |
| CN106885903B (zh) | 2017-03-08 | 2018-12-28 | 中国人民解放军军事医学科学院基础医学研究所 | 一种寨卡病毒e抗原及其在检测抗寨卡病毒抗体中的应用 |
| WO2019042555A1 (en) * | 2017-08-31 | 2019-03-07 | Humabs Biomed Sa | MULTISPECIFIC ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF |
-
2017
- 2017-08-31 WO PCT/EP2017/071891 patent/WO2019042555A1/en not_active Ceased
-
2018
- 2018-08-31 AU AU2018322842A patent/AU2018322842A1/en not_active Abandoned
- 2018-08-31 MX MX2020002181A patent/MX2020002181A/es unknown
- 2018-08-31 CN CN202310134988.XA patent/CN116693668A/zh active Pending
- 2018-08-31 KR KR1020207007493A patent/KR20200042499A/ko not_active Abandoned
- 2018-08-31 JP JP2020507007A patent/JP7244489B2/ja active Active
- 2018-08-31 PE PE2020000287A patent/PE20200888A1/es unknown
- 2018-08-31 CN CN201880057824.9A patent/CN111344302B/zh active Active
- 2018-08-31 CA CA3070780A patent/CA3070780A1/en active Pending
- 2018-08-31 BR BR112020000619-0A patent/BR112020000619A2/pt not_active IP Right Cessation
- 2018-08-31 EA EA202090559A patent/EA202090559A1/ru unknown
- 2018-08-31 WO PCT/EP2018/073489 patent/WO2019043166A1/en not_active Ceased
- 2018-08-31 EP EP18762834.2A patent/EP3676290A1/en not_active Withdrawn
- 2018-08-31 SG SG11202000206SA patent/SG11202000206SA/en unknown
- 2018-08-31 CR CR20200087A patent/CR20200087A/es unknown
- 2018-08-31 MY MYPI2019007495A patent/MY201774A/en unknown
- 2018-08-31 US US16/640,622 patent/US11926658B2/en active Active
-
2019
- 2019-12-17 IL IL271515A patent/IL271515A/en unknown
-
2020
- 2020-01-16 PH PH12020550025A patent/PH12020550025A1/en unknown
- 2020-02-26 CO CONC2020/0002060A patent/CO2020002060A2/es unknown
- 2020-02-26 DO DO2020000043A patent/DOP2020000043A/es unknown
- 2020-02-26 CL CL2020000467A patent/CL2020000467A1/es unknown
- 2020-02-27 EC ECSENADI202014362A patent/ECSP20014362A/es unknown
-
2023
- 2023-03-09 JP JP2023036084A patent/JP2023071956A/ja not_active Withdrawn
-
2024
- 2024-02-22 US US18/584,654 patent/US20240254207A1/en active Pending
Patent Citations (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3791932A (en) | 1971-02-10 | 1974-02-12 | Akzona Inc | Process for the demonstration and determination of reaction components having specific binding affinity for each other |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3766162A (en) | 1971-08-24 | 1973-10-16 | Hoffmann La Roche | Barbituric acid antigens and antibodies specific therefor |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4233402A (en) | 1978-04-05 | 1980-11-11 | Syva Company | Reagents and method employing channeling |
| US4495285A (en) | 1981-10-30 | 1985-01-22 | Kimihiro Shimizu | Plasminogen activator derivatives |
| US4495285B1 (https=) | 1981-10-30 | 1986-09-23 | Nippon Chemiphar Co | |
| US4609546A (en) | 1982-06-24 | 1986-09-02 | Japan Chemical Research Co., Ltd. | Long-acting composition |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4831175A (en) | 1986-09-05 | 1989-05-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| US5595721A (en) | 1993-09-16 | 1997-01-21 | Coulter Pharmaceutical, Inc. | Radioimmunotherapy of lymphoma using anti-CD20 |
| WO2000052031A2 (en) | 1999-03-01 | 2000-09-08 | Idec Pharmaceuticals Corporation | Kit for radiolabeling proteins with yttrium-90 |
| WO2000052473A2 (en) | 1999-03-01 | 2000-09-08 | Idec Pharmaceuticals Corporation | Radiolabeling kit and binding assay |
| US20050163783A1 (en) | 2003-06-27 | 2005-07-28 | Biogen Idec Ma Inc. | Purification and preferential synthesis of binding molecules |
| WO2008143954A2 (en) | 2007-05-14 | 2008-11-27 | Biogen Idec Ma Inc. | Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto |
| WO2015103072A1 (en) | 2013-12-30 | 2015-07-09 | Epimab Biotherapeutics | Fabs-in-tandem immunoglobulin and uses thereof |
Non-Patent Citations (107)
| Title |
|---|
| A. L. ROTHMAN: "Dengue: defining protective versus pathologic immunity", J CLIN INVEST, vol. 113, 2004, pages 946 - 951 |
| A. S. FAUCI; D. M. MORENS: "Zika Virus in the Americas - Yet Another Arbovirus Threat", N ENGL J MED, 2016 |
| ANONYMOUS: "C01864M Data Sheet", INTERNET CITATION, 3 May 2016 (2016-05-03), XP002767869, Retrieved from the Internet <URL:http://www.amsbio.com/datasheets/C01864M-1.pdf> [retrieved on 20170307] * |
| ANONYMOUS: "C01865M Datasheet", INTERNET CITATION, 23 June 2016 (2016-06-23), XP002767870, Retrieved from the Internet <URL:http://www.amsbio.com/datasheets/C01865M-1.pdf> [retrieved on 20160307] * |
| ANONYMOUS: "C01866M Datasheet", INTERNET CITATION, 26 April 2016 (2016-04-26), XP002767871, Retrieved from the Internet <URL:http://www.amsbio.com/datasheets/C01866M-1.pdf> [retrieved on 20170307] * |
| ANONYMOUS: "Choose the best ZIKA virus antibodies", INTERNET CITATION, 7 March 2017 (2017-03-07), pages 1 - 5, XP002767866, Retrieved from the Internet <URL:https://www.arigobio.com/news/view/Zika_Virus> [retrieved on 20170307] * |
| ANONYMOUS: "Zika virus antigens and antibodies", INTERNET CITATION, 7 March 2017 (2017-03-07), pages 1 - 3, XP002767868, Retrieved from the Internet <URL:http://www.amsbio.com/zika-virus-antigens-antibodies.aspx> [retrieved on 20170307] * |
| ARMOUR, K. L. ET AL., EUR. /, IMMUNOL., vol. 29, 1999, pages 2613 - 2624 |
| BALDWIN ET AL.: "Monoclonal Antibodies for Cancer Detection and Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, and Future Prospective of the Therapeutic Use of Radiolabeled Antibody in Cancer Therapy", pages: 303 - 316 |
| BARBA-SPAETH G; DEJNIRATTISAI W; ROUVINSKI A; VANEY MC; MEDITS I; SHARMA A; SIMON-LORIERE E; SAKUNTABHAI A; CAO-LORMEAU VM; HAOUZ: "Structural basis of potent Zika-dengue virus antibody cross-neutralization", NATURE, vol. 536, no. 7614, 4 August 2016 (2016-08-04), pages 48 - 53, XP055328133, DOI: doi:10.1038/nature18938 |
| BARDELLI, M.; LIVOTI, E.; SIMONELLI, L.; PEDOTTI, M.; MORAES, A.; VALENTE, A.P.; VARANI, L.: "Epitope mapping by solution NMR spectroscopy", J. MOL. RECOGNIT., vol. 28, 2015, pages 393 - 400 |
| BELTRAMELLO, M.; WILLIAMS, K.L.; SIMMONS, C.P.; MACAGNO, A.; SIMONELLI, L.; QUYEN, N.T.H.; SUKUPOLVI-PETTY, S.; NAVARRO-SANCHEZ, E: "The human immune response to Dengue virus is dominated by highly cross-reactive antibodies endowed with neutralizing and enhancing activity", CELL HOST MICROBE, vol. 8, 2010, pages 271 - 283, XP055071759, DOI: doi:10.1016/j.chom.2010.08.007 |
| BOERNER, P. ET AL., IMMUNOL., vol. 147, 1991, pages 86 - 95 |
| BRESSANELLI, S.; STIASNY, K.; ALLISON, S.L.; STURA, E.A.; DUQUERROY, S.; LESCAR, J.; HEINZ, F.X.; REY, F.A.: "Structure of a flavivirus envelope glycoprotein in its low-pH-induced membrane fusion conformation", EMBO J, vol. 23, 2004, pages 728 - 738, XP002988861, DOI: doi:10.1038/sj.emboj.7600064 |
| BRUGGEMANN, M. ET AL., YEAR IMMUNOL, vol. 7, 1993, pages 3340 |
| BURTON, D. R., MOL. LMMUNOL., vol. 22, 1985, pages 161 - 206 |
| BYRNE H. ET AL., TRENDS BIOTECH, vol. 31, no. 11, 2013, pages 621 - 632 |
| CAPEL, P. J. ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34 |
| CHAN, A.C.; CARTER, P.J., NAT REV IMMU, vol. 10, 2010, pages 301 - 316 |
| CHU, S. ET AL.: "Accelerated Clearance of IgE In Chimpanzees Is Mediated By Xmab7195, An Fc-Engineered Antibody With Enhanced Affinity For Inhibitory Receptor FcyRllb", AM J RESPIR CRIT, AMERICAN THORACIC SOCIETY INTERNATIONAL CONFERENCE ABSTRACTS, 2014 |
| CHU, S. Y. ET AL.: "Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD19 and FcgammaRllb with Fc-engineered antibodies", MOLECULAR IMMUNOLOGY, vol. 45, 2008, pages 3926 - 3933 |
| COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77 |
| CORTI, D. ET AL.: "Cross-neutralization of four paramyxoviruses by a human monoclonal antibody", NATURE, vol. 501, 2013, pages 439 - 443, XP055254414, DOI: doi:10.1038/nature12442 |
| D. A. MULLER; P. R. YOUNG: "The flavivirus NS1 protein: molecular and structural biology, immunology, role in pathogenesis and application as a diagnostic biomarker", ANTIVIRAL RES, vol. 98, 2013, pages 192 - 208, XP028531675, DOI: doi:10.1016/j.antiviral.2013.03.008 |
| D. L. HEYMANN ET AL.: "Zika virus and microcephaly: why is this situation a PHEIC?", LANCET, vol. 387, 2016, pages 719 - 721, XP029436766, DOI: doi:10.1016/S0140-6736(16)00320-2 |
| D. MUSSO ET AL.: "Potential sexual transmission of Zika virus", EMERG INFECT DIS, vol. 21, 2015, pages 359 - 361 |
| D. MUSSO; E. J. NILLES; V.-M. CAO-LORMEAU: "Rapid spread of emerging Zika virus in the Pacific area", CLIN. MICROBIOL. INFECT., vol. 20, 2014, pages 0595 - 6 |
| D. MUSSO; VAN MAI CAO-LORMEAU; D. J. GUBLER: "Zika virus: following the path of dengue and chikungunya?", THE LANCET., vol. 386, 2015, pages 243 - 244 |
| D. SIROHI ET AL.: "The 3.8 Å resolution cryo-EM structure of Zika virus", SCIENCE, 2016, pages aaf5316 |
| DAI L; SONG J; LU X; DENG YQ; MUSYOKI AM; CHENG H; ZHANG Y; YUAN Y; SONG H; HAYWOOD J: "Structures of the Zika Virus Envelope Protein and Its Complex with a Flavivirus Broadly Protective Antibody", CELL HOST MICROBE, vol. 19, no. 5, 11 May 2016 (2016-05-11), pages 696 - 704, XP055352074, DOI: doi:10.1016/j.chom.2016.04.013 |
| DATABASE Nucleotide [O] 23 November 2010 (2010-11-23), "Zika virus strain MR 766, complete genome", Database accession no. AY632535.2 |
| DE HAAS, M. ET AL., JLAB. CLIN. MED., vol. 126, 1995, pages 330 - 341 |
| DEJNIRATTISAI W; SUPASA P; WONGWIWAT W; ROUVINSKI A; BARBA-SPAETH G; DUANGCHINDA T; SAKUNTABHAI A; CAO-LORMEAU VM; MALASIT P; REY: "Dengue virus sero-cross-reactivity drives antibody-dependent enhancement of infection with zika virus", NAT IMMUNOL, 23 June 2016 (2016-06-23) |
| DEJNIRATTISAI, W.; JUMNAINSONG, A.; ONSIRISAKUL, N.; FITTON, P.; VASANAWATHANA, S.; LIMPITIKUL, W.; PUTTIKHUNT, C.; EDWARDS, C.; D: "Cross-reacting antibodies enhance dengue virus infection in humans", SCIENCE, vol. 328, 2010, pages 745 - 748 |
| DIGIAMMARINO E; GHAYUR T; LIU J: "Design and generation of DVD-lgTM molecules for dual-specific targeting", METHODS MOL BIOL, vol. 899, 2012, pages 145 - 56, XP009169361, DOI: doi:10.1007/978-1-61779-921-1_9 |
| DIOGO M. MAGNANI ET AL: "A human inferred germline antibody binds to an immunodominant epitope and neutralizes Zika virus", PLOS NEGLECTED TROPICAL DISEASES, vol. 11, no. 6, E0005655, 12 June 2017 (2017-06-12), pages 1 - 17, XP055435535, DOI: 10.1371/journal.pntd.0005655 * |
| DOWALL, S.D.; GRAHAM, V.A.; RAYNER, E.; ATKINSON, B.; HALL, G.; WATSON, R.J.; BOSWORTH, A.; BONNEY, L.C.; KITCHEN, S.; HEWSON, R.: "A Susceptible Mouse Model for Zika Virus Infection", PLOS NEGL TROP DIS, vol. 10, 2016, pages e0004658 - 13 |
| DUNCAN, A. R.; WINTER, G., NATURE, vol. 332, 1988, pages 738 - 740 |
| E. J. RUBIN; M. F. GREENE; L. R. BADEN: "Zika Virus and Microcephaly", N ENGL J MED, 2016 |
| F. N. MACNAMARA: "Zika virus: a report on three cases of human infection during an epidemic of jaundice in Nigeria", TRANS. R. SOC. TRAP. MED. HYG., vol. 48, 1954, pages 139 - 145, XP023299042, DOI: doi:10.1016/0035-9203(54)90006-1 |
| G. CALVET; R. S. AGUIAR; A. MELO; S. A. SAMPAIO: "Detection and sequencing of Zika virus from amniotic fluid of fetuses with microcephaly in Brazil: a case study", LANCET INFECT DIS, 2016 |
| G. SCREATON; J. MONGKOLSAPAYA; S. YACOUB; C. ROBERTS: "New insights into the immunopathology and control of dengue virus infection", NAT REV IMMUNOL, vol. 15, 2015, pages 745 - 759 |
| G. W. A. DICK; S. F. KITCHEN; A. J. HADDOW: "Zika virus. I. Isolations and serological specificity", TRANS. R. SOC. TROP. MED HYG., vol. 46, 1952, pages 509 - 520, XP023299618, DOI: doi:10.1016/0035-9203(52)90042-4 |
| GANESAN, L. P. ET AL.: "FcyRllb on liver sinusoidal endothelium clears small immune complexes", JOURNAL OF IMMUNOLOGY, vol. 189, 2012, pages 4981 - 4988, XP002724347, DOI: doi:10.4049/jimmunol.1202017 |
| GENNARO: "Remington: The Science and Practice of Pharmacy, 20th edition,", 2000, ISBN: 0683306472 |
| GESSNER, J. E. ET AL., ANN. HEN7ATOL., vol. 76, 1998, pages 231 - 248 |
| GIOVANNA BARBA-SPAETH ET AL: "Structural basis of potent Zika-dengue virus antibody cross-neutralization", NATURE, vol. 536, no. 7614, 23 June 2016 (2016-06-23), pages 48 - 53, XP055328133, ISSN: 0028-0836, DOI: 10.1038/nature18938 * |
| GONG S; REN F; WU D; WU X; WU C: "Fabs-in-tandem immunoglobulin is a novel and versatile bispecific design for engaging multiple therapeutic targets", MABS, 2017 |
| GOPAL SAPPARAPU ET AL: "Neutralizing human antibodies prevent Zika virus replication and fetal disease in mice", NATURE, vol. 540, no. 7633, 7 November 2016 (2016-11-07), pages 443 - 447, XP055412748, ISSN: 0028-0836, DOI: 10.1038/nature20564 * |
| GREVYS A; BERN M; FOSS S; BRATLIE DB; MOEN A; GUNNARSEN KS; AASE A; MICHAELSEN TE; SANDLIE I; ANDERSEN JT, FC ENGINEERING OF HUMAN IGGI FOR ALTERED BINDING TO THE NEONATAL FC RECEPTOR AFFECTS FC EFFECTOR FUNCTIONS, vol. 194, 2015, pages 5497 - 5508 |
| H. TANG ET AL.: "Zika Virus Infects Human Cortical Neural Progenitors and Attenuates Their Growth", STEM CELL, 2016, pages 1 - 5 |
| HESSELL AJ; HANGARTNER L; HUNTER M; HAVENITH CEG; BEURSKENS FJ; BAKKER JM; LANIGAN CMS; LANDUCCI G; FORTHAL DN; PARREN PWHI ET AL.: "Fc receptor but not complement binding is important in antibody protection against HIV", NATURE, vol. 449, 2007, pages 101 - 104, XP055077687, DOI: doi:10.1038/nature06106 |
| HOOGENBOOM, H. R.; WINTER, G., J. MOL. BIOL., vol. 227, 1992, pages 381 - 388 |
| J. A. SWANSTROM ET AL: "ABSTRACT", MBIO, vol. 7, no. 4, 19 July 2016 (2016-07-19), pages e01123 - 16, XP055436611, DOI: 10.1128/mBio.01123-16 * |
| J. KIM ET AL., ZIKA VIRUS NS1 STRUCTURE REVEALS DIVERSITY OF ELECTROSTATIC SURFACES AMONG FLAVIVIRUSES, 2016, pages 1 - 6 |
| J. MLAKAR: "Zika Virus Associated with Microcephaly", N ENGL J MED., vol. 374, 2016, pages 951 - 958, XP055314102, DOI: doi:10.1056/NEJMoa1600651 |
| JAKOBOVITS, A. ET AL., NATURE, vol. 362, 1993, pages 255 - 258 |
| JAKOBOVITS, A. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551 - 2555 |
| K. STETTLER ET AL: "Specificity, cross-reactivity, and function of antibodies elicited by Zika virus infection", SCIENCE, vol. 353, no. 6301, 19 August 2016 (2016-08-19), pages 823 - 826, XP055352097, ISSN: 0036-8075, DOI: 10.1126/science.aaf8505 * |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1983, U.S. DEPT. HEALTH AND HUMAN SERVICES |
| KOSTYUCHENKO VA; LIM EX; ZHANG S; FIBRIANSAH G; NG TS; OOI JS; SHI J; LOK SM: "Structure of the thermally stable Zika virus", NATURE, vol. 533, no. 7603, 19 May 2016 (2016-05-19), pages 425 - 8 |
| L. DAI ET AL.: "Structures of the Zika Virus Envelope Protein and Its Complex with a Flavivirus Broadly Protective Antibody", CELL HOST MICROBE, 2016 |
| L. R. BADEN; L. R. PETERSEN; D. J. JAMIESON; A. M. POWERS; M. A. HONEIN: "Zika Virus", N. ENGL. J. MED., vol. 374, 2016, pages 1552 - 1563 |
| LEFRANC, M.-P. ET AL., NUCLEIC ACIDS RES., vol. 37, 2009, pages D1006 - D1012 |
| LEI YU ET AL: "Delineating antibody recognition against Zika virus during natural infection", JCI INSIGHT, vol. 2, no. 12, 15 June 2017 (2017-06-15), XP055387424, DOI: 10.1172/jci.insight.93042 * |
| LI J; HU D-M; DING X-X; CHEN Y; PAN Y-X; QIU L-W; CHE X-Y: "Enzyme-linked immunosorbent assay-format tissue culture infectious dose-50 test for titrating dengue virus", PLOS ONE, vol. 6, 2011, pages e22553 |
| LIANPAN DAI ET AL: "Structures of the Zika Virus Envelope Protein and Its Complex with a Flavivirus Broadly Protective Antibody", CELL HOST & MICROBE, vol. 19, no. 5, 1 May 2016 (2016-05-01), NL, pages 696 - 704, XP055352074, ISSN: 1931-3128, DOI: 10.1016/j.chom.2016.04.013 * |
| M. R. DUFFY ET AL.: "Zika virus outbreak on Yap Island, Federated States of Micronesia", N ENG/ J MED, vol. 360, 2009, pages 2536 - 2543 |
| MARCHETTO MCN; CARROMEU C; ACAB A; YU D; YEO GW; MU Y; CHEN G; GAGE FH; MUOTRI AR: "A model for neural development and treatment of Rett syndrome using human induced pluripotent stem cells", CELL, vol. 143, 2010, pages 527 - 539, XP028931103, DOI: doi:10.1016/j.cell.2010.10.016 |
| MARKS, J. D. ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597 |
| MARTINA BELTRAMELLO ET AL: "The Human Immune Response to Dengue Virus Is Dominated by Highly Cross-Reactive Antibodies Endowed with Neutralizing and Enhancing Activity", CELL HOST & MICROBE, vol. 8, no. 3, 1 September 2010 (2010-09-01), pages 271 - 283, XP055071759, ISSN: 1931-3128, DOI: 10.1016/j.chom.2010.08.007 * |
| MODIS, Y.; OGATA, S.; CLEMENTS, D.; HARRISON, S.C.: "Structure of the dengue virus envelope protein after membrane fusion", NATURE, vol. 427, 2004, pages 313 - 319, XP008094797, DOI: doi:10.1038/nature02165 |
| NIGRO G; ADLER SP; LA TORRE R; BEST AM: "Congenital Cytomegalovirus Collaborating Group: Passive immunization during pregnancy for congenital cytomegalovirus infection", N ENGL J MED, vol. 353, 2005, pages 1350 - 1362 |
| PEREZ LG; COSTA MR; TODD CA; HAYNES BF; MONTEFIORI DC: "Utilization of immunoglobulin G Fc receptors by human immunodeficiency virus type 1: a specific role for antibodies against the membrane-proximal external region of gp41", J VIROL, vol. 83, 2009, pages 7397 - 7410 |
| PICCOLI L; CAMPO I; FREGNI CS; RODRIGUEZ BMF; MINOLA A; SALLUSTO F; LUISETTI M; CORTI D; LANZAVECCHIA A: "Neutralization and clearance of GM-CSF by autoantibodies in pulmonary alveolar proteinosis", NAT COMMUN, vol. 6, 2015, pages 1 - 9 |
| PINCHERA ET AL.: "Monoclonal Antibodies '84: Biological and Clinical Applications", 1985, article THORPE ET AL.: "Antibody Carriers of Cytotoxic Agents in Cancer Therapy: A Review", pages: 475 - 506 |
| QUICK, J; GRUBAUGH ND; PULLAN ST; CLARO IM; SMITH AD; GANGAVARAPU K; OLIVEIRA G; ROBLES-SIKISAKA R; ROGERS TF; BEUTLER NA ET AL.: "Multiplex PCR method for MiniON and lllumina sequencing of Zika and other virus genomes directly from clinical samples", NAT PROTOC, vol. 12, 2017, pages 1261 - 1276 |
| RAVETCH, J. V.; KINET, J. P., ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492 |
| REISFELD ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, INC., article ARNON ET AL.: "Monoclonal Antibodies for Immunotargeting of Drugs in Cancer Therapy", pages: 243 - 256 |
| ROBINSON ET AL.: "Controlled Drug Delivery, 2d ed;", 1987, MARCEL DEKKER, INC., article HELLSTROM ET AL.: "Antibodies for Drug Delivery", pages: 623 - 653 |
| S. B. HALSTEAD ET AL.: "Dengue hemorrhagic fever in infants: research opportunities ignored", EMERGING INFECT DIS, vol. 8, 2002, pages 1474 - 1479 |
| S. B. HALSTEAD: "Dengue Antibody-Dependent Enhancement: Knowns and Unknowns", MICROBIOL SPECTR, vol. 2, 2014, pages 249 - 271 |
| S. B. HALSTEAD: "Neutralization and antibody-dependent enhancement of dengue viruses", ADV VIRUS RES, vol. 60, 2003, pages 421 - 467 |
| S. B. HALSTEAD: "Neutralization and antibody-dependent enhancement of dengue viruses", ADV VIRUS RES., vol. 60, 2003, pages 421 - 467 |
| SHIELDS, R. L. ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591 - 6604 |
| SIMONELLI, L.; BELTRAMELLO, M.; YUDINA, Z.; MACAGNO, A.; CALZOLAI, L.; VARANI, L.: "Rapid structural characterization of human antibody-antigen complexes through experimentally validated computational docking", J MOL BIOL, vol. 396, 2010, pages 1491 - 1507, XP026906472, DOI: doi:10.1016/j.jmb.2009.12.053 |
| SIMONELLI, L.; PEDOTTI, M.; BELTRAMELLO, M.; LIVOTI, E.; CALZOLAI, L.; SALLUSTO, F.; LANZAVECCHIA, A.; VARANI, L.: "Rational Engineering of a Human Anti-Dengue Antibody through Experimentally Validated Computational Docking", PLOS ONE, vol. 8, 2013, pages e55561 |
| SPIESS C.; ZHAI Q.; CARTER P.J., MOLECULAR IMMUNOLOGY, vol. 67, 2015, pages 95 - 106 |
| T. H. NGUYEN ET AL.: "Dengue hemorrhagic fever in infants: a study of clinical and cytokine profiles", J INFECT DIS, vol. 189, 2004, pages 221 - 232 |
| THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 158 |
| TILLER T; MEFFRE E; YURASOV S; TSUIJI M; NUSSENZWEIG MC; WARDEMANN H: "Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning", J IMMUNOL METHODS, vol. 329, 2008, pages 112 - 124, XP022389335 |
| TRAGGIAI E; BECKER S; SUBBARAO K; KOLESNIKOVA L; UEMATSU Y; GISMONDO MR; MURPHY BR; RAPPUOLI R; LANZAVECCHIA A: "An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus", NAT MED., vol. 10, no. 8, 2004, pages 871 - 5, XP002385893 |
| TRAGGIAI, E. ET AL., NAT. MED., vol. 10, 2004, pages 871 - 875 |
| V.-M. CAO-LORMEAU ET AL.: "Guillain-Barré Syndrome outbreak associated with Zika virus infection in French Polynesia: a case-control study", LANCET, vol. 0, 2016 |
| V.-M. CAO-LORMEAU; D. MUSSO: "Emerging arboviruses in the Pacific", LANCET, vol. 384, 2014, pages 1571 - 1572 |
| VAN DIJK, M. A.; VAN DE WINKEL, J. G., CURR. OPIN. CHEM. BIOL., vol. 5, 2001, pages 368 - 374 |
| WANG JIAQI ET AL: "A Human Bi-specific Antibody against Zika Virus with High Therapeutic Potential", CELL, vol. 171, no. 1, 21 September 2017 (2017-09-21), pages 229 - e15, XP002776943, DOI: 10.1016/j.cell.2017.09.002 * |
| WARD, E. S.; GHETIE, V., THER. LMMUNOL., vol. 2, 1995, pages 77 - 94 |
| WEIDLE U.H. ET AL., CANCER GENOMICS AND PROTEOMICS, vol. 10, 2013, pages 1 - 18 |
| WILLIS ELINOR ET AL: "Characterization of Zika virus binding and enhancement potential of a large panel of flavivirus murine monoclonal antibodies", VIROLOGY, vol. 508, 2 May 2017 (2017-05-02), ELSEVIER, AMSTERDAM, NL, pages 1 - 6, XP085068375, ISSN: 0042-6822, DOI: 10.1016/J.VIROL.2017.04.031 * |
| WINES, B.D. ET AL., J. IMMUNOL., vol. 164, 2000, pages 5313 - 5318 |
| WINES, B.D., J. IMMUNOL., vol. 164, 2000, pages 5313 - 5318 |
| WINKEL, J. G.; ANDERSON, C. L., J. LEUKOC. BIOL., vol. 49, 1991, pages 511 - 524 |
| WU C; YING H; GRINNELL C; BRYANT S; MILLER R; CLABBERS A; BOSE S; MCCARTHY D; ZHU RR; SANTORA L: "Simultaneous targeting of multiple disease mediators by a dual-variable-domain immunoglobulin", NAT BIOTECHNOL., vol. 25, no. 11, November 2007 (2007-11-01), pages 1290 - 7, XP009110104, DOI: doi:10.1038/nbt1345 |
| WU CHENGBIN ET AL: "Simultaneous targeting of multiple disease mediators by a dual-variable-domain immunoglobulin", NATURE BIOTECHNOLOGY (ADVANCE ONLINE PUBLICATION), vol. 25, no. 11, 1 November 2007 (2007-11-01), GALE GROUP INC, pages 1290 - 1297, XP009110104, ISSN: 1087-0156, DOI: 10.1038/NBT1345 * |
| ZHAO HAIYAN ET AL: "Structural Basis of Zika Virus-Specific Antibody Protection", CELL, vol. 166, no. 4, 27 July 2016 (2016-07-27), CELL PRESS, US, pages 1016 - 1027, XP029682895, ISSN: 0092-8674, DOI: 10.1016/J.CELL.2016.07.020 * |
| ZHAO, H.; FERNANDEZ, E.; DOWD, K.A.; SPEER, S.D.; PLATT, D.J.; GORMAN, M.J.; GOVERO, J.; NELSON, C.A.; PIERSON, T.C.; DIAMOND, M.S: "Structural Basis of Zika Virus-Specific Antibody Protection", CELL, vol. 166, no. 4, 2016, pages 1016 - 27, XP029682895, DOI: doi:10.1016/j.cell.2016.07.020 |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11730802B2 (en) | 2017-11-03 | 2023-08-22 | Takeda Vaccines, Inc. | Zika vaccines and immunogenic compositions, and methods of using the same |
| US11964008B2 (en) | 2017-11-03 | 2024-04-23 | Takeda Vaccines, Inc. | Method for inactivating zika virus and for determining the completeness of inactivation |
| US11975062B2 (en) | 2017-11-30 | 2024-05-07 | Takeda Vaccines, Inc. | Zika vaccines and immunogenic compositions, and methods of using the same |
| KR20210082306A (ko) * | 2019-12-24 | 2021-07-05 | 강원대학교산학협력단 | 지카바이러스 재조합 서브유닛 백신의 개발 및 이의 제조방법 |
| KR102365464B1 (ko) | 2019-12-24 | 2022-02-22 | 강원대학교산학협력단 | 지카바이러스 재조합 서브유닛 백신의 개발 및 이의 제조방법 |
| WO2021236845A1 (en) * | 2020-05-20 | 2021-11-25 | Takeda Vaccines, Inc. | Method for detection of zika virus specific antibodies |
Also Published As
| Publication number | Publication date |
|---|---|
| CO2020002060A2 (es) | 2020-06-09 |
| IL271515A (en) | 2020-02-27 |
| KR20200042499A (ko) | 2020-04-23 |
| WO2019043166A1 (en) | 2019-03-07 |
| CL2020000467A1 (es) | 2020-06-19 |
| US11926658B2 (en) | 2024-03-12 |
| JP2020531000A (ja) | 2020-11-05 |
| CN111344302B (zh) | 2023-03-10 |
| PE20200888A1 (es) | 2020-09-03 |
| US20200317755A1 (en) | 2020-10-08 |
| BR112020000619A2 (pt) | 2020-07-14 |
| AU2018322842A1 (en) | 2020-01-16 |
| SG11202000206SA (en) | 2020-03-30 |
| EP3676290A1 (en) | 2020-07-08 |
| EA202090559A1 (ru) | 2020-06-17 |
| JP7244489B2 (ja) | 2023-03-22 |
| MY201774A (en) | 2024-03-16 |
| DOP2020000043A (es) | 2020-09-15 |
| ECSP20014362A (es) | 2020-04-22 |
| CR20200087A (es) | 2020-08-07 |
| CN116693668A (zh) | 2023-09-05 |
| MX2020002181A (es) | 2020-07-20 |
| CA3070780A1 (en) | 2019-03-07 |
| CN111344302A (zh) | 2020-06-26 |
| US20240254207A1 (en) | 2024-08-01 |
| JP2023071956A (ja) | 2023-05-23 |
| PH12020550025A1 (en) | 2021-02-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11912757B2 (en) | Antibodies specifically binding to Zika virus epitopes and uses thereof | |
| US20240254207A1 (en) | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof | |
| AU2016334735A1 (en) | Antibodies that potently neutralize hepatitis B virus and uses thereof | |
| CN104350069A (zh) | 中和rsv、mpv和pvm的抗体和其应用 | |
| HK40002097B (en) | Novel antibodies specifically binding to zika virus epitopes and uses thereof | |
| HK40002097A (en) | Novel antibodies specifically binding to zika virus epitopes and uses thereof | |
| EA046175B1 (ru) | Выделенное антитело или его антигенсвязывающий фрагмент, которые специфически связываются с эпитопом вируса зика, их получение и применения | |
| HK40025147A (en) | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof | |
| HK40025147B (en) | Multispecific antibodies specifically binding to zika virus epitopes and uses thereof | |
| EA043940B1 (ru) | Мультиспецифические антитела, специфичные в отношении эпитопов вируса зика, и их применение | |
| BR122024006890A2 (pt) | Anticorpo isolado, ou um fragmento de ligação ao antígeno do mesmo, molécula de ácido nucleico, vetor, célula, composição farmacêutica, uso dos mesmos, kit de partes, bem como ensaio de bloqueio de ligação para diagóstico in vitro de infecção por zika vírus | |
| HK40006233A (en) | Novel antibodies specifically binding to zika virus epitopes and uses thereof | |
| HK40006233B (en) | Novel antibodies specifically binding to zika virus epitopes and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17764354 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 17764354 Country of ref document: EP Kind code of ref document: A1 |