WO2019035649A1 - EGFRvIII에 대한 항체를 포함하는 항체 약물 접합체 - Google Patents
EGFRvIII에 대한 항체를 포함하는 항체 약물 접합체 Download PDFInfo
- Publication number
- WO2019035649A1 WO2019035649A1 PCT/KR2018/009362 KR2018009362W WO2019035649A1 WO 2019035649 A1 WO2019035649 A1 WO 2019035649A1 KR 2018009362 W KR2018009362 W KR 2018009362W WO 2019035649 A1 WO2019035649 A1 WO 2019035649A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- solvate
- pharmaceutically acceptable
- acceptable salt
- alkyl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 COC(C(C(C1O*)O*)O*)OC1C(O*)=O Chemical compound COC(C(C(C1O*)O*)O*)OC1C(O*)=O 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
Definitions
- the present invention relates to novel antibody-drug conjugates (ADCs) targeting EGFRvIII, active metabolites of these ADCs, methods for making these ADCs, use of these ADCs for the treatment and /
- the invention also relates to the use of these ADCs for the production of medicaments for the treatment and / or prophylaxis of diseases, more particularly hyperproliferative and / or angiogenic diseases, such as cancer, and more particularly to the use of these EGFRvIII (Epidermal Growth Factor Receptor Variant III) or an antigen-binding fragment thereof, and a pharmaceutical composition comprising the antibody-drug conjugate.
- ADCs antibody-drug conjugates
- Cancer is a disease caused by abnormally grown lumps due to autonomous overgrowth of body tissues and is the result of uncontrolled cell growth in various tissues. Early stage tumors can be removed by surgical and radiotherapy, and metastasized tumors usually undergo palliative treatment by chemotherapeutic agents.
- chemotherapeutic agents can induce serious effects of unwanted side effects and even toxicity as a result of systemic administration, and thus, through improved application of these chemotherapeutic agents in tumor cells or adjacent tissues, Has focused on the development of novel chemotherapeutic agents to simultaneously increase drug efficacy and minimize toxicity / side effects.
- ADCs Antibody-drug conjugates
- ADCs are target-directed new technologies that bind toxins or drugs to an antibody that binds to an antigen and then release toxic substances inside the cells, leading to the death of cancer cells. It is a technology that can exert more efficacy than antibody therapy itself and greatly reduce the risk of side effects compared to existing anticancer drugs because it allows drugs to be delivered precisely to target cancer cells while minimally affecting healthy cells and released only under specific conditions.
- the basic structure of this antibody-drug conjugate is composed of " antibody-linker-low molecular drug (toxin) ".
- the linker not only has a functional role of linking the antibody and the drug, but also stably reaches the target cell in the body, and after the antibody-drug conjugate enters the cell, the antibody-drug dissociation phenomenon (for example, The result is that the drug is well-cleaved by the drug, and the drug is effective against the target cancer cells.
- Linkers play an important role in the safety of antibody-drug conjugates and systemic toxicity, depending on the stability of the linker (Discovery Medicine 2010, 10 (53): 329-39).
- the inventors of the present invention have developed a linker that contains an effective self-immolative group that is more stable in plasma and stable even in the circulation in the body and can easily release drugs in cancer cells to exhibit drug efficacy. (Korean Registered Patent No. 1,628,872, etc.).
- Monoclonal antibodies are suitable for target-directed addressing of tumor tissues and tumor cells.
- Antibody drug conjugates have become powerful and novel therapeutic options for the treatment of lymphoma and solid cancer, and immunosuppressive antibodies have recently achieved considerable clinical success.
- the development of therapeutic antibodies is based on cancer serology, protein engineering techniques and their function, mechanisms of resistance, and a deep understanding of the interaction between the immune system and cancer cells.
- an antigen expressed on the cell surface of human cancer refers to a wide range of targets that are overexpressed or mutated and selectively expressed compared to normal tissues.
- the key problem is to identify the appropriate antigen for antibody-based therapies. These agents mediate changes in antigen or receptor function (ie, function as antagonists, as stimulants), regulate the immune system through Fc and T cell activation, and mediate the delivery of specific drugs that bind to antibodies targeted to specific antigens Effective. Molecular techniques that can alter antibody pharmacokinetics, function, size, and immunostimulation have emerged as key elements in the development of new antibody-based therapies.
- Evidence from clinical trials of therapeutic antibodies directed against cancer patients suggests that optimized antibodies, including affinity and binding of the target antigen and antibodies, antibody structure selection, therapeutic approaches (signaling blocking or immune function) It emphasizes the importance of approaches for selection.
- EGFR epithelial growth factor receptor
- EGFR epithelial growth factor receptor
- the sequence of the EGFR gene is known.
- the EGFR gene was originally a cellular homolog of the erbB oncogene identified in avian erythroblastosis virus. Activation of the oncogene by gene amplification was observed in a variety of human tumors.
- EGFR is overexpressed for various types of human solid tumors. EGFR overexpression was observed in some lungs, breast, colon, stomach, brain, bladder, head and neck, ovary, kidney and prostate carcinoma. Epidermal growth factor (EGF) and transforming growth factor-alpha (TGF-alpha) have been shown to bind to EGFR and to induce cell proliferation and tumor growth. Size mutant EGFR genes and amplification have also been reported in some human cancers.
- EGF epidermal growth factor
- TGF-alpha transforming growth factor-alpha
- EGFR mutants are caused by gene rearrangement accompanied by EGFR gene amplification.
- (Iv) EGFRvIV comprises deletion in the cytoplasmic domain of EGFR
- (Vi) EGFR.TDM / 2-7 comprises the replication of exons 2-7 in the extracellular domain of EGFR
- (vii) EGFR.TDM / 18-25 contains deletion in the cytoplasmic domain of EGFR
- (Viii) EGFR.TDM / 18-26 includes a copy of exons 18-26 in the tyrosine kinase of EGFR.
- EGFRvIII is a variant of epithelial growth factor (EGF), which is the most commonly occurring in human cancers, and is expressed in about 30% of patients with glioblastoma (GBM) and is not expressed in normal tissues.
- EGF epithelial growth factor
- GBM glioblastoma
- Such variants of the EGFR receptor contribute to tumor progression through structural signaling in a ligand independent manner.
- Mutations or rearrangements of genes that potentially induce tumorigenesis can be identified in many cancers. It has been reported that cancer-causing proteins can contribute to the pathways associated with cancer stem cells. The products of these altered genes suggest evidence that they can be used to identify and potentially target cancer stem cells. In fact, this approach is not an easy method because these major mutations exist throughout cancer cells and do not exist only in specific cancer cell subtypes. Therefore, mutant proteins generally do not play a direct role in cancer stem cells, but they generally promote tumor growth. In addition, most modified proteins are internal to the cell.
- EGFRvIII Adiabatic tumors are known to frequently express EGFRvIII, an EGFR variant expressed through gene rearrangement and amplification. Since the tyrosine phosphorylation site is always present in an activated form, it exhibits strong tumorigenicity. However, despite this modification, the expression of EGFRvIII is limited. Cancer stem cells are defined as EGFRvIII is highly expressed with CD133 and EGFRvIII + / CD133 + cells have high regeneration and tumor initiation capability. EGFRvIII + cells were associated with stem / precursor markers whereas differentiation markers were found in EGFRvIII- cells. EGFRvIII expression was lost in normal cell culture but maintained in tumor protoplast culture and cell cultured cells simultaneously express and regenerate EGFRvIII + / CD133 + and have tumor-initiating ability.
- an anti-EGFRvIII antibody capable of binding with high affinity to EGFRvIII and inhibiting the growth of cancer cells is required.
- Antibody therapeutic agents such as Cetuximab, which specifically binds specifically to EGFR, have been developed. However, these antibody therapeutic agents have a problem that antigen specificity against EGFRvIII mutant cancer cells is very low, and inhibition of cancer cell growth is not shown.
- the inventors of the present invention have made efforts to develop an antibody for chemotherapy which specifically binds to EGFRvIII.
- the present inventors have developed an anti-EGFRvIII antibody that binds to EGFRvIII with high affinity using phage display technology, and confirmed that such anti-EGFRvIII antibody can significantly inhibit the growth of cancer cells.
- the present invention includes an effective self-immolative group that is more stable in plasma and stable even in the circulation in order to further enhance the effect of the antibody and can easily release the drug in cancer cells (ADC) that targets EGFRvIII effective for the treatment and / or prevention of hyperproliferative and / or metastatic cancer diseases can be provided by applying a linker that specifically binds to EGFRvIII, And the present invention has been completed.
- ADC cancer cells
- the present invention is intended to provide novel antibody-linker drug conjugates or salts, solvates thereof, targeting EGFRvIII.
- the present invention provides an antibody-drug conjugate comprising an antibody that specifically binds to EGFRvIII and a drug that binds to the antibody, and a pharmaceutical composition comprising the same.
- the present invention also relates to a linker technique which is more stable in plasma and stable even in the body and which includes a self-sacrifice which can be easily released in cancer cells to maximize the drug efficacy, so that the drug and / Ligand-linker-drug (toxin) system which can stably reach the cell, effectively exhibiting the drug efficacy, while greatly reducing the toxicity.
- Ab is an antibody that binds to EGFRvIII (Epidermal Growth Factor Receptor Variant III) or an antigen-binding fragment thereof,
- Linker is a linker
- D is a drug or toxin
- n is an integer of 1 to 20;
- the antibody or antigen-binding fragment thereof that binds to EGFRvIII is an antibody or an antigen-binding fragment thereof which is characterized in that it binds to an epitope of EGFRvIII having the sequence of SEQ ID NO:
- the antibody or antigen-binding fragment thereof that binds to EGFRvIII comprises a CDR (complementarity determining region) having a sequence selected from the group consisting of SEQ ID NOS: 2, 3, 17, 18, CDRH2 having a sequence selected from the group consisting of H1, SEQ ID NOs: 4, 5, 19, 20 and 33, and SEQ ID NOs: 6, 7, 21, 22 and 34
- a heavy chain variable region comprising CDRH3 having a sequence;
- a light chain variable region comprising CDRL3 having the sequence represented by SEQ ID NO: 12, 27,
- the antibody or antigen-binding fragment thereof that binds to EGFRvIII comprises a heavy chain variable region having the sequence of SEQ ID NO: 13, 28 or 38.
- the antibody or antigen-binding fragment thereof that binds to EGFRvIII comprises a light chain variable region having the sequence of SEQ ID NO: 14, 29 or 39.
- sequence information is as follows:
- G is sugar, sugar acid, or sugar derivatives
- W is -C (O) -, -C ( O) NR'-, -C (O) O-, -S (O) 2 NR'-, -P (O) R''NR'-, -S (O) and NR'-, or -PO 2 NR'-,
- Each Z are each independently hydrogen, (C 1 -C 8) alkyl, halogen, cyano or nitro,
- n is an integer of 1 to 3
- n 0 or 1
- At least one branching unit (BR) and at least one connection unit are At least one branching unit (BR) and at least one connection unit,
- R 1 and R 2 are each independently hydrogen, (C 1 -C 8 ) alkyl or (C 3 -C 8 ) cycloalkyl, or
- R 1 and R 2 together with the carbon atoms to which they are attached form a (C 3 -C 8 ) cycloalkyl ring,
- the * indicates the site to which the drug or toxin is linked.
- the sugar or the saccharic acid is a monosaccharide.
- G is a compound of the formula (IIIa) structure:
- R < 3 > is hydrogen or a carboxyl protecting group
- Each R < 4 > is independently hydrogen or a hydroxyl protecting group.
- R < 3 > is hydrogen and each R < 4 > is hydrogen.
- W is -C (O) NR'-, wherein C (O) is connected to a phenyl ring and NR 'is connected to a linker.
- Z is hydrogen and n is 3.
- R 1 and R 2 are each hydrogen.
- G is a compound having the structure of the formula (IIIa)
- R < 3 > is hydrogen or a carboxyl protecting group
- Each R < 4 > is independently hydrogen or a hydroxyl protecting group
- W is -C (O) NR'-, where is C (O) phenyl ring is connected to NR 'is connected with the Linker, each Z is hydrogen, n is 3, m is 1, R 1, and R < 2 > are each hydrogen.
- the at least one branching unit is alkylene having from 1 to 100 carbon atoms, wherein the carbon atom of the alkylene is optionally substituted with one or more heteroatoms selected from the group consisting of N, O and S And the alkylene may be further substituted with one or more alkyl having 1 to 20 carbon atoms.
- the at least one branching unit is a hydrophilic amino acid.
- the hydrophilic amino acid may be arginine, aspartate, asparagine, glutamate, glutamine, histidine, lysine, ornithine, proline, serine, or threonine.
- the hydrophilic amino acid may be an amino acid comprising a side chain having a moiety having charge at neutral pH in an aqueous solution.
- the hydrophilic amino acid is aspartate or glutamate.
- the hydrophilic amino acid is ornithine or lysine.
- the hydrophilic amino acid is arginine.
- At least one branching unit is -C (O) -, -C ( O) NR'-, -C (O) O-, -S (O) 2 NR'-, -P ( O) R''NR'-, -S (O) NR'-, or -PO 2 NR'-, and, R 'and R''are each independently hydrogen, (C 1 -C 8) alkyl, (C 3 -C 8) cycloalkyl, (C 1 -C 8) alkoxy, (C 1 -C 8) alkylthio, mono- or di - (C 1 -C 8) alkylamino, (C 3 -C 20) heteroaryl aryl, or (C 6 -C 20) aryl.
- At least one of the branching units is -C (O) NR'- and R 'is hydrogen.
- connection unit is - (CH 2 ) r (V (CH 2 ) p ) q -, where r is an integer from 0 to 10, p is an integer from 0 to 12 , q is an integer of 1 to 20, and V is a single bond, -O- or -S-.
- r is 2.
- p is 2.
- q is an integer from 6 to 20.
- r is 2
- p is 2
- q is 2, 5 or 11
- V is -O-.
- the at least one connection unit is at least one polyethylene glycol unit, or .
- the at least one connection unit is 1 to 12-OCH 2 CH 2 - units, or 5 to 12 -OCH 2 CH 2 - units, or 6 to 12 -OCH 2 CH 2 - units.
- the at least one connection unit is - (CH 2 CH 2 X) w-,
- X is a single bond, -O-, (C 1 -C 8 ) alkylene, or -NR 21 -;
- R 21 is hydrogen, (C 1 -C 6 ) alkyl, (C 1 -C 6 ) alkyl (C 6 -C 20 ) aryl or (C 1 -C 6 ) alkyl (C 3 -C 20 ) heteroaryl ,
- w is an integer of 1 to 20, specifically 1, 3, 6, or 12;
- X is -O- and w is an integer of 6 to 20.
- the linker can be a 1,3-dipolar cycloaddition reaction, a hetero-Diels-Alder reaction, a nucleophilic substitution reaction, a non-aldol carbonyl reaction, carbon-carbon multiple bond, oxidation, or a click reaction.
- the binding unit is formed by a reaction between acetylene and an azide, or a reaction between an aldehyde or ketone group and a hydrazine or alkoxyamine.
- L 1 is a single bond or alkylene having 1 to 30 carbon atoms
- R 11 is hydrogen or alkyl having 1 to 10 carbon atoms, specifically methyl,
- L 2 is alkylene having 1 to 30 carbon atoms.
- the branching unit or to be.
- the at least one isoprenyl unit is a substrate of an isoprenoid transferase or a product of an isoprenoid transferase.
- the isoprenyl unit of the Linker is covalently bonded to the antibody by a thioether linkage, and the thioether linkage includes the cysteine sulfur of the antibody.
- the antibody comprises an amino acid motif recognized by an isoprenoid transferase, and the thioether bond comprises a cysteine sulfur atom of an amino acid motif.
- the antibody or antigen-binding fragment thereof that binds to EGFRvIII comprises an amino acid motif recognized by an isoprenoid transferase, wherein the thioether bond comprises a cysteine sulfur atom of an amino acid motif.
- the amino acid motif is a sequence selected from the group consisting of CXX, CXC, XCXC, XXCC, and CYYX, wherein C represents cysteine; Y represents in each case independently an aliphatic amino acid; X independently in each occurrence represents glutamine, glutamate, serine, cysteine, methionine, alanine, or leucine; The thioether bond includes the cysteine sulfur atom of the amino acid motif.
- the amino acid motif is the CYYX sequence and Y is independently in each case alanine, isoleucine, leucine, methionine or valine.
- the amino acid motif is a CVIM or CVLL sequence.
- At least one of the seven amino acids preceding the amino acid motif is glycine.
- three or more of the seven amino acids preceding the amino acid motif may be independently selected from glycine, arginine, aspartic acid, and serine.
- one to ten amino acids preceding the amino acid motif are glycine, in particular at least 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acids Is glycine.
- the antibody may comprise the amino acid sequence of GGGGGGGCVIM.
- connection unit connects the trigger unit and the binding unit, the trigger unit and the branching unit or the branching unit and the binding unit,
- the one or more trigger units are capable of releasing one or more drugs or toxins
- the branching unit connects the connection unit and the trigger unit, or the connection unit to another connection unit.
- the trigger unit has the structure of the following formula (IIb):
- G is sugar, sugar acid, or sugar derivatives
- W is -C (O) -, -C ( O) NR'-, -C (O) O-, -S (O) 2 NR'-, -P (O) R''NR'-, -S (O) and NR'-, or -PO 2 NR'-,
- Each Z are each independently hydrogen, (C 1 -C 8) alkyl, halogen, cyano or nitro,
- n is an integer of 1 to 3
- n 0 or 1
- R 1 and R 2 are each independently hydrogen, (C 1 -C 8 ) alkyl or (C 3 -C 8 ) cycloalkyl, or
- R 1 and R 2 together with the carbon atoms to which they are attached form a (C 3 -C 8 ) cycloalkyl ring.
- the sugar or the saccharic acid is a monosaccharide.
- G is a compound of the formula (IIIa) structure:
- R < 3 > is hydrogen or a carboxyl protecting group
- Each R < 4 > is independently hydrogen or a hydroxyl protecting group.
- R < 3 > is hydrogen and each R < 4 > is hydrogen.
- W is -C (O) NR'-, wherein C (O) is connected to the phenyl ring and NR 'is connected to the connection unit.
- Z is hydrogen
- R 1 and R 2 are each hydrogen.
- connection unit is - (CH 2) r (V (CH 2) p) q -, - ((CH 2) p V) q -, - (CH 2) r (V (CH 2 ) p) q Y-, - ( (CH 2) p V) q (CH 2) r -, -Y ((CH 2) p V) q - or - (CH 2) r (V (CH 2) p ) q YCH 2 - it becomes expressed as,
- r is an integer from 0 to 10;
- p is an integer from 1 to 10;
- q is an integer of 1 to 20
- V and Y are each independently a single bond, -O-, -S-, -NR 21 -, -C (O) NR 22 -, -NR 23 C (O) -, -NR 24 SO 2 - SO 2 NR < 25 > -,
- R 21 to R 25 are each independently hydrogen, (C 1 -C 6) alkyl, (C 1 -C 6) alkyl (C 6 -C 20) aryl or (C 1 -C 6) alkyl (C 3 -C 20 ) heteroaryl.
- r is 2.
- p is 2.
- q is an integer from 6 to 20.
- q is 2, 5, or 11.
- V and Y are each independently -O-.
- the branching unit comprises:
- L 1 , L 2 , and L 3 are each independently a direct bond or -C n H 2n -
- n is an integer from 1 to 30,
- G 1 , G 2 and G 3 are each independently a direct bond, ego,
- R 3 is hydrogen or C 1 -C 30 alkyl
- R 4 is hydrogen or -L 4 -COOR 5 , wherein L 4 is a direct bond or -C n H 2n - wherein n is an integer from 1 to 10 and R 5 is hydrogen or C 1 -C Lt; / RTI >
- the branching unit ego
- L & lt ; 1 > is a direct bond or alkylene having from 1 to 30 carbon atoms
- R 11 is hydrogen or alkyl having 1 to 10 carbon atoms, specifically methyl,
- L 2 is alkylene having 1 to 30 carbon atoms
- the branching unit connects the connection unit and the antibody.
- L < 1 > is alkylene having 12 carbon atoms.
- R < 11 > is methyl.
- L < 2 > is alkylene having 11 carbon atoms.
- the branching unit or to be.
- the binding unit is covalently bonded to the antibody by a thioether bond, and the thioether bond comprises a cysteine sulfur atom of the antibody.
- the antibody comprises an amino acid motif recognized by an isoprenoid transferase, and the thioether bond comprises a cysteine sulfur atom of an amino acid motif.
- the amino acid motif is a sequence selected from the group consisting of CXX, CXC, XCXC, XXCC, and CYYX, wherein C represents cysteine; Y represents in each case independently an aliphatic amino acid; X independently in each occurrence represents glutamine, glutamate, serine, cysteine, methionine, alanine, or leucine; The thioether bond includes the cysteine sulfur atom of the amino acid motif.
- the amino acid motif is the CYYX sequence and Y is independently in each case alanine, isoleucine, leucine, methionine or valine.
- the amino acid motif is a CVIM or CVLL sequence.
- At least one of the seven amino acids preceding the amino acid motif is glycine.
- three or more of the seven amino acids preceding the amino acid motif may be independently selected from glycine, arginine, aspartic acid, and serine.
- one to ten amino acids preceding the amino acid motif are glycine, in particular at least 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acids Is glycine.
- the antibody may comprise the amino acid sequence of GGGGGGGCVIM.
- an antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof, wherein said D is a prophylactic or therapeutic agent for hyperproliferative, cancerous or angiogenic diseases.
- D may be selected from the following list, but is not limited to:
- Aclacinomysins actinomycin, antrmycin, azaserine, bleomycins, cactinomycin, carabicin, carnino Carninomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubucin, 6-diazo-5-oxo-L 6-diazo-5-oxo-L-norleucine, doxorubicin, But are not limited to, morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubucin, liposomal doxorubicin, deoxydoxirubicin, (eg, deoxydoxorubicin, epirubicin, esorubicin, marcellomycin, mitomycin C, mycophenolic acid, nogalamycin, olivomycin, the compounds of the present invention may be used in combination with other drugs such as olivomycins,
- affinity ligand selected from the group consisting of a substrate, an inhibitor, an activator, a neurotransmitter, a radioisotope, or a combination thereof;
- radioactive label 32P, 35S, fluorescent dye, electron dense reagent, enzyme, biotin, streptavidin, dioxigenin, hapten, An immunogenic protein, a nucleic acid molecule with a sequence complementary to a target, or a combination thereof;
- an immunomodulatory compound an anti-cancer agent, an anti-viral agent, an anti-bacterial agent, an anti-fungal agent, agents, and anti-parasitic agents, or combinations thereof;
- a pharmaceutical composition for preventing or treating hyperproliferative, cancer, or angiogenic diseases which comprises an antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof as an active ingredient.
- composition further comprising an inert, non-toxic, or pharmaceutically acceptable excipient.
- composition further comprising at least one anti-hyperplasia, cytostatic or cytotoxic agent.
- an antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof in the manufacture of a medicament for the prophylaxis or treatment of hyperproliferative, cancerous or angiogenic diseases.
- a pharmaceutical composition for preventing or treating hyperproliferative, cancer, or angiogenic diseases which comprises an antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof as an active ingredient,
- a method of preventing or treating hyperproliferative, cancer, or angiogenic diseases is provided, wherein a method of administering one or more anti-hypertrophy, cytostatic or cytotoxic agents in combination is also provided.
- the antibody-drug conjugate according to the present invention includes an anti-EGFRvIII antibody that specifically binds to EGFRvIII expressing cells and is internalized into cells, thereby effectively and specifically and selectively delivering the drug, and the drug is stably bound to the antibody Saccharide, which is capable of exhibiting the desired cytotoxicity while maintaining in vivo stability, is more stable in plasma, stable even in the circulation in the body, and capable of easily releasing the drug in cancer cells to maximize the drug efficacy
- Linker-ligand system capable of stably reaching the target cells, effectively exhibiting the drug effect, and greatly reducing the toxicity, by introducing the linker technology to the target cell.
- Conjugates refers to cell binding agents that are covalently linked to one or more molecules of a cytotoxic compound.
- cell binding agent is a molecule having affinity for a biological target, for example, a ligand, a protein, an antibody, specifically a monoclonal antibody, a protein or antibody fragment, a peptide, an oligonucleotide or an oligosaccharide , The binding agent serves to direct the biologically active compound to the biological target.
- the conjugate can be designed to target tumor cells through cell surface antigens.
- the antigen may be a cell surface antigen that is overexpressed or expressed in an abnormal cell type.
- the target antigen may be expressed only on proliferative cells (e.g., tumor cells).
- Target antigens may be selected based on different expression, usually between proliferative and normal tissues.
- a ligand is bonded to a linker.
- " refers to a compound that covalently attaches a cytotoxic compound to a binding agent.
- the linker disclosed in Korean Patent Laid-Open Nos. 2015-0137015, PCT / US2016 / 063564, and PCT / US2016 / 063595 may be used.
- EGFRvIII refers to a mutant form of epidermal growth factor receptor that is recognized by MR1 scFv and is characterized by an 801 basepair infrequent deletion of 2-7 exons near the amino terminus. Is highly expressed in about 50-60% of glioblastoma and appears to be present in about 70-80% of breast and ovarian carcinomas and about 16% of non-small cell lung carcinomas. Mutant receptors are expressed on the cell surface and produce new tumor-specific cell surface epitopes at the deletion junctions.
- antibody means an anti-EGFRvIII antibody that specifically binds to EGFRvIII.
- the scope of the present invention encompasses not only the complete antibody form specifically binding to EGFRvIII but also antigen binding fragments of the antibody molecule.
- a complete antibody is a structure having two full-length light chains and two full-length heavy chains, each light chain linked by a disulfide bond with a heavy chain.
- the heavy chain constant region has gamma (gamma), mu (mu), alpha (alpha), delta (delta) and epsilon (epsilon) types and subclasses gamma 1 (gamma 1), gamma 2 ), Gamma 4 (gamma 4), alpha 1 (alpha 1) and alpha 2 (alpha 2).
- the constant region of the light chain has kappa (kappa) and lambda (lambda) types.
- An antigen binding fragment or an antibody fragment of an antibody refers to a fragment having an antigen binding function and includes Fab, F (ab ') 2, F (ab') 2 and Fv.
- Fabs in the antibody fragment have one antigen-binding site in a structure having a variable region of a light chain and a heavy chain, a constant region of a light chain, and a first constant region (CH1) of a heavy chain.
- the F (ab ') 2 antibody is produced when the cysteine residue of the hinge region of the Fab' forms a disulfide bond.
- Such an antibody fragment can be obtained using a protein hydrolyzing enzyme (for example, when the whole antibody is cleaved with papain, a Fab can be obtained, and when cut with pepsin, an F (ab ') 2 fragment can be obtained) It can also be produced through recombinant technology.
- a protein hydrolyzing enzyme for example, when the whole antibody is cleaved with papain, a Fab can be obtained, and when cut with pepsin, an F (ab ') 2 fragment can be obtained
- It can also be produced through recombinant technology.
- Heavy chain means both the variable length domain VH comprising the amino acid sequence with sufficient variable region sequence to confer specificity to the antigen and the full length heavy chain comprising the three constant region domains CHl, CH2 and CH3, and fragments thereof .
- Light chain refers to both full length light chains and fragments thereof, including variable region domains VL and constant region domains CL comprising amino acid sequences with sufficient variable region sequences to confer specificity to the antigen.
- Antibody variable domain refers to the light and heavy chain portions of an antibody molecule comprising the amino acid sequences of the complementarity determining regions (CDRs; i.e., CDR1, CDR2, and CDR3), and the framework region (FR).
- CDRs complementarity determining regions
- FR framework region
- VH refers to the variable domain of the heavy chain.
- VL refers to the variable domain of the light chain.
- CDRs i.e., CDR1, CDR2, and CDR3
- CDR1, CDR2, and CDR3 refer to the amino acid residues of an antibody variable domain that are necessary for antigen binding.
- Each variable domain typically has three CDR regions identified as CDR1, CDR2 and CDR3.
- the CDR region can be determined using Kabat, IMGT method, Chothia method, AbM method, and the present invention uses the Kabat, IMGT method to determine the CDR region.
- a "framework region” is a variable domain residue other than a CDR residue.
- Each variable domain typically has four FRs identified as FR1, FR2, FR3, and FR4.
- Fv fragment is an antibody fragment that contains complete antibody recognition and binding sites. This region consists of one heavy chain variable domain and one light chain variable domain, for example dimers substantially tightly covalently associated with scFv.
- a “Fab” fragment contains the variable and constant domains of the light chain and the variable and first constant domain (CH1) of the heavy chain.
- F (ab ') 2 antibody fragments generally comprise a pair of Fab fragments covalently linked by their hinge cysteine near their carboxy ends.
- a " single chain Fv " or " scFv " antibody fragment comprises the VH and VL domains of an antibody, which domains are within a single polypeptide chain.
- the Fv polypeptide may further comprise a polypeptide linker between the VH domain and the VL domain such that the scFv can form the desired structure for antigen binding.
- therapeutic agent is an agent that exerts cytotoxicity, cell proliferation inhibition and / or immunomodulatory effects on cancer cells or activated immune cells.
- therapeutic agents include cytotoxic agents, chemotherapeutic agents, cell proliferation inhibitors, and immunomodulators.
- drug or toxin is a chemical compound useful in the treatment of cancer.
- unsubstituted or substituted refers to a parent group that may be unsubstituted or substituted
- substituted refers to a parent group having one or more substituents
- substitutetuent refers to a mosquito refers to a chemical moiety covalently bonded to a parent group or fused to a parent group.
- halo or halogen refers to fluorine, chlorine, bromine, iodine, and the like.
- alkyl is a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of an aliphatic or alicyclic, saturated or unsaturated (unsaturated, fully unsaturated) hydrocarbon compound.
- saturated alkyls include methyl, ethyl, Butyl, n-pentyl (amyl), n-hexyl, n-heptyl and the like, saturated cyclic alkyl groups such as methyl, ethyl, Isopropyl, isobutyl, sec-butyl, tert-butyl, isopentyl, neopentyl and the like.
- alkoxy means -OR where R is an alkyl group, and examples include methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, sec-butoxy, isobutoxy, tert-butoxy, and the like.
- aryl means a monovalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound having a ring atom.
- alkenyl is at least one carbon - an alkyl having a carbon double bond
- alkylene refers to a divalent atomic group except two hydrogen atoms bonded to two other carbon atoms of an aliphatic saturated hydrocarbon, represented by the general formula C n H 2n -, and includes ethylene, propylene, butyl Naphthalene, naphthalene, and the like.
- heteroaryl refers to aryl containing one or more heteroatoms, such as pyridine, pyrimidine, benzothiophene, furyl, dioxolanyl, pyrrolyl, oxazolyl, pyridyl, pyridazinyl, More specifically benzofuran, isobenzofuran, indole, isoindole, indolizine, indolin, isoindoline, purine (adenine or guanine), benzimidazole, indazole, benzoxazole, benzisoxazole, benzodioxole, benzofuran, benzotriazole, benzo thio furan, benzothiazole, benzo thiadiazole a 20,000 C 9, chromene, iso-chromene, chroman, iso croissant having two fused rings, derived from benzo Two fused rings derived from dioxane, quino
- an acid addition salt modified by a pharmaceutically acceptable free acid can be used, and as the free acid, an organic acid or an inorganic acid can be used.
- the organic acids include, but are not limited to, citric, acetic, lactic, tartaric, maleic, fumaric, formic, propionic, oxalic, trifluoroacetic, benzoic, gluconic, methosulfonic, glycolic, succinic, Glutamic acid and aspartic acid.
- the inorganic acid also includes, but is not limited to, hydrochloric acid, bromic acid, sulfuric acid, and phosphoric acid.
- a salt may be formed with a suitable cation.
- suitable inorganic cations include, but are not limited to, alkali metal ions such as Na + and K + , alkaline earth metal cations such as Ca 2+ and Mg 2+ and other cations such as Al 3+ .
- suitable organic cations include an ammonium ion (i.e., NH 4 +) and substituted ammonium ions (e.g. NH 3 R +, NH 2 R 2 +, NHR 3 +, NR 4 +) , but is not limited to this.
- substituted ammonium ions examples include those derived from ethylamine, diethylamine, dicyclohexylamine, triethylamine, butylamine, ethylenediamine, ethanolamine, diethanolamine, piperazine, benzylamine , Phenylbenzylamine, choline, meglumine and tromethamine, as well as amino acids such as lysine and arginine.
- An example of a typical quaternary ammonium ion is N (CH 3 ) 4 + .
- a salt may be formed with a suitable anion.
- suitable inorganic anions include, but are not limited to, those derived from the following inorganic acids: hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, sulfuric acid, nitric acid, nitrous acid, phosphoric acid and phosphorous acid.
- Suitable organic anions include, but are not limited to, those derived from organic acids such as: 2-acetoxybenzoic acid, acetic acid, ascorbic acid, aspartic acid, benzoic acid, camphorsulfonic acid, cinnamic acid, citric acid, But are not limited to, disulfonic acid, ethanesulfonic acid, fumaric acid, glutaronic acid, gluconic acid, glutamic acid, glycolic acid, hydroxymaleic acid, hydroxynaphthalenecarboxylic acid, isethionic acid, lactic acid, But are not limited to, malic acid, methanesulfonic acid, mucilous acid, oleic acid, oxalic acid, palmitic acid, pamic acid, pantothenic acid, phenylacetic acid, phenylsulfonic acid, propionic acid, pyruvic acid, salicylic acid, stearic acid, succinic acid, sulfanilic acid, tarta
- solvate refers to a molecular complex between a compound according to the present invention and solvent molecules, examples of which include water, isopropanol, ethanol, methanol, dimethylsulfoxide but are not limited to, compounds according to the invention in combination with dimethylsulfoxide, ethyl acetate, acetic acid, ethanolamine or a mixed solvent thereof.
- solvate is used herein in its conventional sense to refer to solutes (such as active compounds, salts of active compounds) and complexes of solvents.
- solutes such as active compounds, salts of active compounds
- complexes of solvents such as water
- the solvate may conveniently be referred to as a hydrate, such as monohydrate, dihydrate, trihydrate, and the like.
- the pharmaceutical composition of the present invention may comprise a pharmaceutically acceptable carrier.
- Pharmaceutically acceptable carriers may include macromolecules that are typically metabolized slowly, such as proteins, polysaccharides, polylactic acid, polyglycolic acid, polymeric amino acids, amino acid copolymers, lipid aggregates, and the like, Acceptable carriers may be appropriately selected and used by those skilled in the art.
- composition comprising a pharmaceutically acceptable carrier can be of various oral or parenteral formulations.
- a diluent or excipient such as a filler, an extender, a binder, a wetting agent, a disintegrant, or a surfactant is usually used.
- Solid formulations for oral administration include tablets, pills, powders, granules, capsules and the like, which may contain at least one excipient such as starch, calcium carbonate, sucrose or lactose, gelatin, .
- excipients such as starch, calcium carbonate, sucrose or lactose, gelatin, .
- lubricants such as magnesium stearate, talc, and the like may also be used.
- the protein or peptide is extinguished. Therefore, when formulating the composition in the form of an oral composition, it is necessary to protect the active ingredient from being coated or decomposed at the top.
- Liquid preparations for oral administration include suspensions, solutions, emulsions, syrups and the like.
- excipients such as wetting agents, sweeteners, fragrances, preservatives and the like may be included in addition to water and liquid paraffin, which are simple diluents commonly used. have.
- Formulations for parenteral administration include sterilized aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations, and suppositories.
- the non-aqueous solvent and the suspending agent include propylene glycol, polyethylene glycol, vegetable oil such as olive oil, and injectable ester such as ethyl oleate.
- the suppository base include witepsol, macrogol, tween 61, cacao paper, laurin, glycerogelatin and the like.
- the pharmaceutical composition may be selected from the group consisting of injections, tablets, pills, powders, granules, capsules, suspensions, solutions, emulsions, syrups, sterilized aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze- Or < / RTI >
- the active ingredient may be in the form of an acceptable aqueous solution for parenteral administration, which is pyrogen-free and has suitable pH, isotonicity and stability.
- suitable solutions using isotonic vehicles such as, for example, aqueous sodium chloride solution, Ringer's solution, lactate Ringer's solution and the like, and may be included as needed with preservatives, stabilizers, buffers, antioxidants or other additives.
- Solid forms suitable for injection may also be prepared as emulsions or in the form of polypeptides encapsulated in liposomes.
- the conjugate according to the present invention may be administered by any device capable of moving the active substance to the target cell.
- the phrase " effective amount " or " therapeutically effective amount” refers to the amount required to achieve the desired therapeutic result (for dose and duration and means of administration).
- An effective amount is at least the minimum amount of active agent required to confer a therapeutic benefit to a subject, and is less than the toxic amount.
- the dosage can be administered in the range of about 100 ng to about 100 mg / kg per patient, more typically in the range of about 1 ⁇ g / kg to about 10 mg / kg.
- the active compound is a salt, an ester, an amide, a prodrug, etc.
- the dosage is calculated on the basis of the parent compound, so that the actual weight used is proportionally increased.
- the drug or toxin may be formulated to include, but is not limited to, 0.01 mg to 3000 mg, 0.1 mg to 2000 mg, and 1 mg to 1000 mg of the active ingredient per unit dosage form.
- the active ingredient may be administered to obtain a peak plasma concentration of the active compound of from about 0.05 [mu] M to 100 [mu] M, 1 [mu] M to 50 [mu] M, 5 [mu] M to 30 [mu] M.
- a peak plasma concentration of the active compound of from about 0.05 [mu] M to 100 [mu] M, 1 [mu] M to 50 [mu] M, 5 [mu] M to 30 [mu] M.
- a peak plasma concentration of the active compound of from about 0.05 [mu] M to 100 [mu] M, 1 [mu] M to 50 [mu] M, 5 [mu] M to 30 [mu] M.
- a 0.1 w / v% to 5 w / v% solution of the active
- the concentration of the active compound in the pharmaceutical composition may be determined by absorption, inactivation and release rates of the drug and other factors known to those skilled in the art.
- the dosage may vary depending on the severity of the condition / disorder.
- the dose and the dosage regimen for a specific patient can be adjusted according to the occupational judgment of the administration supervisor taking into consideration the degree of the patient's symptom / disorder, necessity, age, response to the drug, etc., The scope is merely exemplary and is not intended to limit the embodiments of the claimed composition to these.
- the active ingredient may be administered once, or a smaller dose may be administered several times.
- Antibody-linker-drug (toxin) conjugate compounds according to the present invention may be used to treat a proliferative disease, particularly cancer.
- proliferative disease refers to undesirable or uncontrolled cell proliferation of undesirable excessive or abnormal cells, such as neoplastic or hyperplastic growth, in vitro or in vivo.
- Proliferative disorders include, but are not limited to, neoplasms, tumors, cancers, leukemias, psoriasis, bone diseases, fibrosing disorders, atherosclerosis, and the like, including benign, total malignant or malignant cell proliferation .
- the cancer is selected from the group consisting of lung cancer, small cell lung cancer, gastrointestinal cancer, colorectal cancer, breast cancer, breast cancer, ovarian cancer, prostate cancer, testicular cancer, liver cancer, kidney cancer, bladder cancer, pancreatic cancer, But is not limited thereto.
- Cancer that overexpresses EGFRvIII refers to a cancer that has EGFRvIII on the cancer cell surface at a significantly higher level compared to non-cancerous cells of the same tissue type.
- Cancer the disease to which the conjugate according to the present invention is applied, may be an overexpressing cancer of EGFRvIII, and may be, for example, glioblastoma, astrocytoma, glioma, neuroblastoma, testicular cancer, colon cancer, melanoma, pancreatic cancer, lung cancer, breast cancer, , Lung cancer, ovarian cancer, prostate cancer, and squamous cell cancer.
- the compound of Formula 1 was prepared according to the method described in Korean Patent No. 1,628,872 (Example 8).
- the compounds 2, 3, 4, 5, 6, 7, 8 and 9 were prepared by the method described in WO2017-189895.
- Antibody-drug conjugates were prepared using the compounds 1, 2, 3, 4, 5, 6, 7, 8 and 9 as described in WO2017-189895.
- the ADC was named as follows according to the combination of each antibody and compound.
- DKMG glioblastoma cell line
- PDC brain cancer patient derived cell line
- Each cancer cell line was seeded on a 96-well plate at 5,000 cells per well and cultured for 4 hours (PDC) or 24 hours (CDC), and treated with the drug. After 72 hours or 168 hours the living cells were measured by the CellTiter-Glo ® Luminescent Cell Viability Assay (Promega, G7570). Evaluation of efficacy at 72 hours was shown in Table 4, and evaluation of efficacy at 168 hours was shown in Table 5 and Table 6, respectively.
- EGFRvIII is expressed in the patient-derived cells and cancer cells in the unit nM showed excellent efficacy below.
- the normal cell NT352T1 not expressing EGFRvIII no toxicity was observed up to 100 nM, and it was confirmed that the selectivity was excellent. Therefore, it can be seen that the antibody-drug conjugate according to the present invention has a sufficient safety.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
본 발명은 EGFRvIII를 타겟팅하는 신규한 항체-약물 접합체(antibody-drug conjugate, ADC), 이들 ADC의 활성 대사물, 이들 ADC의 제조방법, 병의 치료 및/또는 예방을 위한 이들 ADC의 용도, 및 또한 병, 더 상세하게는 과증식 및/또는 혈관신생질환 예컨대, 암 질환의 치료 및/또는 예방을 위한 약제를 생산하기 위한 이들 ADC의 용도에 관한 것이며, 보다 구체적으로, EGFRvIII (Epidermal Growth Factor Receptor Variant III)에 결합하는 항체 또는 이의 항원 결합 단편을 포함하는 항체-약물 접합체 및 이를 포함하는 약학 조성물에 관한 것이다.
Description
본 발명은 EGFRvIII를 타겟팅하는 신규한 항체-약물 접합체(antibody-drug conjugate, ADC), 이들 ADC의 활성 대사물, 이들 ADC의 제조방법, 병의 치료 및/또는 예방을 위한 이들 ADC의 용도, 및 또한 병, 더 상세하게는 과증식 및/또는 혈관신생질환 예컨대, 암 질환의 치료 및/또는 예방을 위한 약제를 생산하기 위한 이들 ADC의 용도에 관한 것이며, 보다 구체적으로, EGFRvIII (Epidermal Growth Factor Receptor Variant III)에 결합하는 항체 또는 이의 항원 결합 단편을 포함하는 항체-약물 접합체 및 이를 포함하는 약학 조성물에 관한 것이다.
암(cancer)은 신체 조직의 자율적인 과잉 성장에 의해 비정상적으로 자라난 덩어리로 인한 질환을 말하며, 다양한 조직에서 조절되지 않는 세포 성장의 결과이다. 초기 단계 종양은 수술 및 방사선치료 조치에 의해 제거될 수 있으며, 전이된 종양의 경우 일반적으로 화학요법제에 의해 완화치료를 하게 된다.
비경구로 투여되는 대다수 화학요법제는 전신 투여의 결과로서 원치않는 부작용 및 심지어 독성이라는 심각한 효과를 유도할 수 있으며, 따라서 종양 세포 또는 바로 인접한 조직에서 이들 화학요법제의 개선되었으면서도 선택적인 적용을 통해 약효 증가 및 독성/부작용의 최소화를 동시에 이루기 위한 신규한 화학요법제의 개발에 초점이 맞추어져 왔다.
항체-약물 접합체(ADC, antibody-drug conjugate)는 항원과 결합하는 항체에 독소 또는 약물을 결합시킨 후 세포 내부에서 독성물질을 방출하면서 암세포 등을 사멸에 이르게 하는 표적지향성 신기술이다. 건강한 세포에는 최소한으로 영향을 주면서 약물을 타겟 암세포에 정확하게 전달하고, 특정한 조건하에서만 방출되도록 해주기 때문에 항체 치료제 자체보다 효능이 우수하고 기존의 항암제들에 비해 부작용의 위험성을 크게 낮출 수 있는 기술이다.
이러한 항체-약물 접합체의 기본 구조는 “항체-링커-저분자 약물(독소)”로 구성되어 있다. 여기서 링커는 단순히 항체와 약물을 연결시켜 주는 기능적인 역할뿐 아니라, 체내 순환시 안정하게 타겟 세포까지 도달 후 항체-약물 접합체가 세포 내로 들어가 항체-약물간 해리현상(예, 효소에 의한 가수분해에 의한 결과)에 의해 약물이 잘 떨어지면서 타겟 암세포에 약효를 나타내도록 해야 한다. 즉 링커의 안정성에 따라 항체-약물 접합체의 효능 및 전신독성(systemic toxicity) 등의 안전성 면에서 링커는 매우 중요한 역할을 한다 (Discovery Medicine 2010, 10(53): 329-39).
본 발명의 발명자는 혈장 내에서 보다 안정하고 체내 순환시에도 안정적이며 약물이 암세포 내에서 쉽게 방출되어 약효를 나타낼 수 있는 효과적인 자가-희생 기(self-immolative group)을 포함하는 링커를 개발하여 이에 대해 특허를 확보한 바 있다(한국등록특허 제1,628,872호 등).
한편 암 치료를 위한 단일클론 항체의 사용은 상당한 성공을 거두고 있다. 단일클론 항체는 종양 조직 및 종양 세포의 표적-지향된 어드레싱(addressing)에 적당하다. 항체 약물 접합체들은 림프종과 고형암 치료를 위해 강력하고 새로운 치료의 옵션이 되었으며, 최근 들어 면역 조절 항체들도 임상에서 상당한 성공을 거두고 있다. 치료 항체들의 개발은 암 혈청학, 단백질 엔지니어링 기술과 그 작용, 저항성의 기작들 및 면역 시스템과 암 세포들 간의 상호 작용에 대한 깊은 이해를 바탕으로 한다.
인간 암의 세포 표면에서 발현되는 항원의 정의는 정상 조직에 비해 과다 발현되거나 돌연변이 및 선택적으로 발현되는 광범위한 목표물들을 의미한다. 핵심적인 문제는 항체를 기반으로 한 치료법들에 적절한 항원을 동정하는 것이다. 이러한 치료제들은 항원이나 수용체 기능 (즉 자극제로서나 길항제로서의 기능)의 변화를 매개하고 Fc 과 T 세포 활성화를 통해 면역 시스템을 조절하며 특정한 항원을 목표로 하는 항체에 결합되는 특정한 약물의 전달을 통해 그 효능을 발휘한다. 항체 약동학 (pharmacokinetics), 작용 기능, 사이즈와 면역 자극성을 변화시킬 수 있는 분자 기술들은 새로운 항체를 기반으로 한 치료법들의 개발에서 핵심적인 요소로 등장하고 있다. 암 환자들을 대상으로 한 치료 항체들의 임상 시도에서 얻은 증거들은 목표 항원과 항체들의 친화성 및 결합성, 항체 구조의 선택, 치료적 접근법(신호전달 차단이나 면역 작용 기능)을 포함하는 최적화된 항체들의 선택을 위한 접근법들의 중요성을 강조하고 있다.
이와 관련하여 상피 성장 인자 수용체(EGFR)를 항원으로 하는 항체에 대한 연구가 진행되고 있다. EGFR은 원형-종양 유전자(proto-oncogene) c-erb B의 170 킬로달톤 막 지단백질 산물이다. EGFR 유전자의 서열은 알려져 있다. EGFR 유전자는 원래 조류 적아세포증(avian erythroblastosis) 바이러스에서 동정된 erbB 종양 유전자의 세포 동족체(homolog)이다. 유전자 증폭에 의한 상기 종양 유전자의 활성화는 다양한 인간 종양에서 관찰되었다.
EGFR은 다양한 유형의 인간 고형 종양에 대해 과발현된다. EGFR 과발현은 일부 폐, 유방, 결장, 위, 뇌, 방광, 두경부, 난소, 신장 및 전립선 암종에서 관찰되었다. 상피 성장 인자(EGF) 및 형질전환 성장 인자-알파(TGF-알파)는 EGFR에 결합하여 세포 증식 및 종양 성장을 유도하는 것으로 밝혀졌다. 또한, 크기 변이체 EGFR 유전자 및 증폭이 몇몇 인간 암에서 보고되기도 하였다.
EGFR 변이체는 EGFR 유전자 증폭에 의해 수반되는 유전자 재배열에 의해 유발된다. 다음과 같이 알려져 있는 8개의 주요 EGFR 변이체들이 있다: (i) EGFRvI은 EGFR의 세포외 도메인의 대부분이 결여되어 있고, (ii) EGFRvII는 EGFR의 세포외 도메인에서 83 aa 인-프레임(in-frame) 결실로 구성되어 있으며, (iii) EGFRvⅢ은 EGFR의 세포외 도메인에서 267 aa 인-프레임 결실로 구성되어 있고, (iv) EGFRvIV는 EGFR의 세포질 도메인에 결실을 포함하며, (v) EGFRvV는 EGFR의 세포질 도메인에 결실을 포함하고, (vi) EGFR.TDM/2-7은 EGFR의 세포외 도메인에 엑손 2-7의 복제를 포함하며, (vii) EGFR.TDM/18-25는 EGFR의 세포외 도메인에 엑손 18-26의 복제를 포함하고, (viii) EGFR.TDM/18-26는 EGFR의 티로신 키나아제에 엑손 18-26의 복제를 포함한다. 또한, 엑손 11 및 14의 접합부에서 신규한 히스티딘 잔기를 도입하는 제 2 결실을 갖는 희귀한 제 2의 EGFRvⅢ 돌연변이체(EGFRvⅢ/Δ12-13)가 있다.
EGFRvⅢ는 인간 암에서 가장 통상적으로 발생하는 상피 성장 인자(EGF)의 변이체로, 교모세포종(GBM) 환자 중 약 30%의 환자에서 발현되며, 정상조직에서는 발현되지 않는다. 이러한 EGFR 수용체의 변이체는 리간드 독립적인 방식으로 구조적 신호화(signaling)를 통해 종양 진행에 기여한다.
종양 형성을 잠재적으로 유도하는 유전자들의 돌연변이나 재배열은 많은 암들에서 동정될 수 있다. 암 발생 단백질들이 암 줄기 세포들과 연관된 경로들에 기여할 수 있다는 결과들이 발표된 바 있다. 이렇게 변형된 유전자들의 생산물은 암줄기 세포들을 동정하고 잠재적으로 목표화하는데 사용될 수 있다는 증거들을 제시하고 있다. 실제로 이러한 주된 돌연변이들은 암 세포들 전체에 걸쳐 존재하고 특정한 암세포 아형에만 존재하지 않기 때문에 이러한 접근법은 용이한 방법이 아니다. 따라서 돌연변이 단백질들은 암 줄기 세포들에서 어떠한 직접적인 역할을 하지 않고 종양 성장을 일반적으로 잠재화시킨다. 추가적으로 대부분의 변형된 단백질들은 세포 내부에 존재한다.
돌연변이 단백질들과 암 줄기 세포 간의 상관관계는 명확하지 않다. 교아세포 종양들은 유전자 재배열과 증폭을 통해 발현되는 EGFR 변형체인 EGFRvIII를 자주 발현한다고 알려져 있다. 항상 티로신 인산화 사이트가 활성화된 형태로 존재하기 때문에 강한 종양형성(tumorigenicity) 특성을 보인다. 그러나, 이러한 변형에도 불구하고 EGFRvIII의 발현은 제한적이다. 암 줄기 세포는 EGFRvIII이 CD133과 함께 높게 발현되어 있고 EGFRvIII+/CD133+ 세포를 높은 재생과 종양 개시 능력을 가지는 것으로 정의된다. EGFRvIII+ 세포는 줄기/전구체 마커들과 함께 연관되어 있는 반면 분화 마커들은 EGFRvIII- 세포들에서 발견되었다. EGFRvIII 발현은 정상적인 세포 배양에서 손실되었지만 종양 원형체 배양에서는 유지되었으며 또한 세포 배양된 세포들은 EGFRvIII+/CD133+를 동시에 발현하고 재생되며 종양 개시 능력을 가진다.
EGFRvIII을 과발현하는 암을 치료하기 위하여, EGFRvIII에 높은 친화력으로 결합하여 암세포의 성장을 저해할 수 있는 항-EGFRvIII 항체가 요구된다.
종래 EGFR에 특이적으로 결합하는 세툭시맙 (Cetuximab) 등과 같은 항체 치료제들이 개발되었다. 그러나 이러한 항체 치료제들은 EGFRvIII 돌연변이 암세포들에 대한 항원 특이성이 매우 떨어지고, 암세포 성장 억제능이 나타나지 않는 문제점이 있어 왔다.
이러한 기술적 배경하에서, 본 발명의 발명자는 EGFRvIII에 특이적으로 결합하는 항암 치료용 항체를 개발하기 위하여 노력하였다. 그 결과, 본 발명자들은 파지 디스플레이 기술을 이용하여 EGFRvIII에 높은 친화력으로 결합하는 항- EGFRvIII 항체를 개발하고, 이러한 항-EGFRvIII 항체가 암세포의 성장을 현저히 억제시킬 수 있음을 확인하였다.
본 발명에서는, 항체의 효과를 더욱 강화하기 위하여 혈장 내에서 보다 안정하고 체내 순환시에도 안정적이며 약물이 암세포 내에서 쉽게 방출되어 약효를 나타낼 수 있는 효과적인 자가-희생 기(self-immolative group)을 포함하는 링커를 EGFRvIII에 특이적으로 결합하는 항암 치료용 항체에 적용하여, 과증식 및/또는 전이암 질환의 치료 및/또는 예방에 효과적인 EGFRvIII를 타겟팅하는 신규한 항체-약물 접합체(ADC)를 제공할 수 있음을 확인하고, 본 발명을 완성하게 되었다.
본 발명은 EGFRvIII를 타겟팅하는 신규한 항체-링커 약물 접합체 또는 이의 염, 용매화물을 제공하고자 한다.
본 발명은 EGFRvIII에 특이적으로 결합하는 항체 및 이에 결합하는 약물을 포함하는 항체-약물 접합체 및 이를 포함하는 약학 조성물을 제공하고자 한다.
본 발명에서는 또한 혈장 내에서 보다 안정하고 체내 순환시에도 안정적이며, 약물이 암세포 내에서 쉽게 방출되어 약효를 극대화할 수 있는 자가-희생기를 포함하는 링커 기술을 접목시켜, 약물 및/또는 톡신이 표적 세포에 안정적으로 도달하여 약효를 효과적으로 발휘하면서도 독성을 크게 낮출 수 있는, 리간드-링커-약물(톡신) 시스템을 제공하고자 한다.
본 발명의 일 양태에서, 하기 일반식 I의 구조를 갖는 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물이 제공된다:
[일반식 I]
Ab - (Linker - D)n
상기 식에서,
Ab는 EGFRvIII (Epidermal Growth Factor Receptor Variant III)에 결합하는 항체 또는 이의 항원 결합단편이고,
Linker는 링커이며,
D는 약물 또는 톡신이고,
n은 1 내지 20의 정수이다.
본 발명의 일 양태에서, 상기 EGFRvIII에 결합하는 항체 또는 이의 항원 결합단편은, 서열번호 1로 기재되는 서열을 가지는 EGFRvIII의 에피토프에 결합하는 것을 특징으로 하는 항체 또는 이의 항원 결합단편이다.
본 발명의 일 양태에서, 상기 EGFRvIII에 결합하는 항체 또는 이의 항원 결합단편은, 서열번호 2, 3, 17, 18 및 32로 이루어진 군으로부터 선택되는 어느 하나로 기재되는 서열을 가지는 CDR(complementarity determining region)H1, 서열번호 4, 5, 19, 20 및 33으로 이루어진 군으로부터 선택되는 어느 하나로 기재되는 서열을 가지는 CDRH2, 및 서열번호 6, 7, 21, 22 및 34로 이루어진 군으로부터 선택되는 어느 하나로 기재되는 서열을 가지는 CDRH3을 포함하는 중쇄 가변영역; 및 서열번호 8, 9, 23, 24 및 35로 이루어진 군으로부터 선택되는 어느 하나로 기재되는 서열을 가지는 CDRL1, 서열번호 10, 11, 25, 26 및 36으로 이루어진 군으로부터 선택되는 어느 하나로 기재되는 서열을 가지는 CDRL2, 및 서열번호 12, 27 또는 37로 기재되는 서열을 가지는 CDRL3을 포함하는 경쇄 가변영역을 포함한다.
본 발명의 일 양태에서, 상기 EGFRvIII에 결합하는 항체 또는 이의 항원 결합단편은, 서열번호 13, 28 또는 38로 기재되는 서열을 가지는 중쇄 가변영역을 포함한다.
본 발명의 일 양태에서, 상기 EGFRvIII에 결합하는 항체 또는 이의 항원 결합단편은, 서열번호 14, 29 또는 39로 기재되는 서열을 가지는 경쇄 가변영역을 포함한다.
본 발명의 일 양태에서, 서열정보는 다음과 같다:
| 서열번호 | 설명 | 서열 |
| 1 | EGFRvIII의 에피토프 | LEEKKGNYVVTDHC |
| 2 | CDRH1(IMGT) | GFTFSSYG |
| 3 | CDRH1(KABAT) | SYGMH |
| 4 | CDRH2(IMGT) | ISSSGDST |
| 5 | CDRH2(KABAT) | AISSSGDSTYYADSVKG |
| 6 | CDRH3(IMGT) | ARDWSLMDV |
| 7 | CDRH3(KABAT) | DWSLMDV |
| 8 | CDRL1(IMGT) | NIGSKS |
| 9 | CDRL1(KABAT) | SGNNIGSKSVH |
| 10 | CDRL2(IMGT) | TTN |
| 11 | CDRL2(KABAT) | TTNNKHS |
| 12 | CDRL3(IMGT/KABAT) | AAWDDSLSGYV |
| 13 | VH | EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSAISSSGDSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDWSLMDVWGQGTLVTVSS |
| 14 | VL | QSVLTQPPSASGTPGQRVTISCSGNNIGSKSVHWYQQLPGTAPKLLIYTTNNKHSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSGYVFGGGTKLTVL |
| 15 | VH nucleotide | GAAGTGCAGCTGCTGGAAAGTGGAGGTGGACTGGTGCAGCCTGGCGGCAGCCTGCGCCTGAGCTGTGCCGCCAGCGGATTCACCTTCAGCAGCTATGGCATGCATTGGGTTCGCCAAGCACCTGGCAAAGGCCTGGAATGGGTGAGCGCCATCAGCAGCAGCGGCGATAGCACCTATTATGCCGATAGCGTGAAAGGCCGCTTTACCATCAGCCGCGATAACAGCAAAAACACCCTGTATCTGCAGATGAACAGCCTGCGCGCCGAGGACACCGCAGTCTACTACTGTGCCCGCGATTGGAGCCTGATGGATGTGTGGGGACAAGGTACTCTGGTGACCGTGAGCAGC |
| 16 | VL nucleotide | CAGAGCGTGCTGACCCAGCCTCCTAGCGCCTCCGGTACACCAGGACAGCGCGTGACTATTAGCTGTAGCGGCAACAACATCGGCAGCAAAAGCGTGCATTGGTACCAGCAACTGCCTGGAACTGCACCTAAGCTGCTGATCTATACCACCAACAACAAACATAGCGGCGTACCTGATCGCTTTAGCGGTAGCAAATCAGGCACCAGCGCCAGCCTGGCCATCAGCGGCCTTCGCTCCGAAGATGAAGCCGATTATTATTGTGCCGCCTGGGATGATAGCCTGAGCGGCTATGTGTTTGGTGGCGGTACCAAGCTGACCGTGCTG |
| 17 | CDRH1(IMGT) | GFTFSNYY |
| 18 | CDRH1(KABAT) | NYYMS |
| 19 | CDRH2(IMGT) | TSPNGGSK |
| 20 | CDRH2(KABAT) | GTSPNGGSKYYADSVKG |
| 21 | CDRH3(IMGT) | AKGRRKLRATRFDY |
| 22 | CDRH3(KABAT) | GRRKLRATRFDY |
| 23 | CDRL1(IMGT) | SSNIGNNY |
| 24 | CDRL1(KABAT) | TGSSSNIGNNYVS |
| 25 | CDRL2(IMGT) | SDS |
| 26 | CDRL2(KABAT) | SDSNRPS |
| 27 | CDRL3(IMGT/KABAT) | ATWDASLSAYV |
| 28 | VH | EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYYMSWVRQAPGKGLEWVSGTSPNGGSKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGRRKLRATRFDYWGQGTLVTVSS |
| 29 | VL | QSVLTQPPSASGTPGQRVTISCTGSSSNIGNNYVSWYQQHPGTAPKLLIYSDSNRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCATWDASLSAYVFGGGTKLTVL |
| 30 | VH nucleotide | gaggtgcagctgttggagtctgggggaggcttggtacagcctggggggtccctgagactctcctgtgcagcctctggattcacctttagcaattattatatgagctgggtccgccaggctccagggaaggggctggagtgggtctcagggacctctcctaatggtggtagtaaatattacgctgattctgtaaaaggtcggttcaccatctccagagacaattccaagaacacgctgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcgaaaggtcgtcgtaagctgcgggctactcggttcgactactggggccagggtacactggtcaccgtgagctca |
| 31 | VL nucleotide | cagtctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgtactggctcttcatctaatattggcaataattatgtctcctggtaccagcagcacccaggaacggcccccaaactcctcatctattctgatagtaatcggccaagcggggtccctgaccgattctctggctccaagtctggcacctcagcctccctggccatcagtgggctccggtccgaggatgaggctgattattactgtgctacttgggatgctagcctgagtgcttatgtcttcggcggaggcaccaagcttacggtccta |
| 32 | CDRH1 | SSYGMH |
| 33 | CDRH2 | SAISSSGESTYYADSVKG |
| 34 | CDRH3 | RDWSLMDV |
| 35 | CDRL1 | SGNNIGSKSVH |
| 36 | CDRL2 | TTNNKHS |
| 37 | CDRL3 | AAWDESLSGYV |
| 38 | VH | EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSAISSSGESTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDWSLMDVWGQGTLVTVSS |
| 39 | VL | QSVLTQPPSASGTPGQRVTISCSGNNIGSKSVHWYQQLPGTAPKLLIYTTNNKHSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDESLSGYVFGGGTKLTVL |
본 발명의 일 양태에서, Linker는 하기 화학식 IIa의 구조를 갖는다:[화학식 IIa]
상기 식에서,
G는 당(sugar), 당산(sugar acid), 또는 당 유도체(sugar derivatives)이고,
W는 -C(O)-, -C(O)NR'-, -C(O)O-, -S(O)2NR'-, -P(O)R''NR'-, -S(O)NR'-, 또는 -PO2NR'-이고,
C(O), S, 또는 P가 페닐환과 바로 연결되는 경우, R' 및 R''은 각각 독립적으로 수소, (C1-C8)알킬, (C3-C8)사이클로알킬, (C1-C8)알콕시, (C1-C8)알킬티오, 모노- 또는 디-(C1-C8)알킬아미노, (C3-C20)헤테로아릴, 또는 (C6-C20)아릴이며,
각 Z는 각각 독립적으로 수소, (C1-C8)알킬, 할로겐, 시아노 또는 니트로이고,
n은 1 내지 3의 정수이며,
m은 0 또는 1이고,
L은 부존재하거나, 또는
최소 하나의 브랜칭 유닛(branching unit, BR) 및 최소 하나의 커넥션 유닛(connection unit)을 함유하며,
R1 및 R2는 각각 독립적으로 수소, (C1-C8)알킬 또는 (C3-C8)사이클로알킬이거나, 또는
R1 및 R2는 이들이 부착된 탄소 원자와 함께 (C3-C8)사이클로알킬 환을 형성하며,
상기 식에서 물결표시는 항체와 연결되는 부위,
* 표시는 약물 또는 톡신과 연결되는 부위를 나타낸다.
본 발명의 일 양태에서, 상기 당 또는 당산은 모노사카라이드이다.
본 발명의 일 양태에서, G는 하기 화학식 (IIIa) 구조의 화합물이다:
화학식 (IIIa)
여기에서,
R3는 수소 또는 카르복실 보호기이고,
각 R4는 각각 독립적으로 수소 또는 하이드록실 보호기이다.
본 발명의 일 양태에서, R3는 수소이고, 각 R4는 수소이다.
본 발명의 일 양태에서, W는 -C(O)NR'-이고, 여기에서 C(O)가 페닐환과 연결되며, NR'은 Linker와 연결된다.
본 발명의 일 양태에서, Z는 수소이고, n은 3이다.
본 발명의 일 양태에서, R1 및 R2 는 각각 수소이다.
본 발명의 일 양태에서, G는 하기 화학식 (IIIa) 구조의 화합물이고:
화학식 (IIIa)
여기에서,
R3는 수소 또는 카르복실 보호기이고,
각 R4는 각각 독립적으로 수소 또는 하이드록실 보호기이며,
W는 -C(O)NR'-이고, 여기에서 C(O)가 페닐환과 연결되며 NR'은 Linker와 연결되고, 각 Z는 수소이며, n은 3이고, m은 1이며, R1 및 R2는 각각 수소이다.
본 발명의 일 양태에서, 최소 하나의 브랜칭 유닛은 1 내지 100개의 탄소 원자를 갖는 알킬렌이고, 여기에서 알킬렌의 탄소 원자는, N, O 및 S로 이루어진 그룹으로부터 선택되는 하나 또는 그 이상의 헤테로원자로 치환될 수 있으며, 알킬렌은 1 내지 20개의 탄소원자를 갖는 하나 이상의 알킬로 더 치환될 수 있다.
본 발명의 일 양태에서, 최소 하나의 브랜칭 유닛은 친수성 아미노산(hydrophilic amino acid)이다.
본 발명의 일 양태에서, 친수성 아미노산은 아르기닌, 아스파테이트, 아스파라긴, 글루타메이트, 글루타민, 히스티딘, 리신, 오르니틴, 프롤린, 세린, 또는 트레오닌일 수 있다.
본 발명의 일 양태에서, 친수성 아미노산은 수용액에서 중성 pH에서 전하를 갖는 잔기를 갖는 측쇄를 포함하는 아미노산일 수 있다.
본 발명의 일 양태에서, 친수성 아미노산은 아스파테이트 또는 글루타메이트이다.
본 발명의 일 양태에서, 친수성 아미노산은 오르니틴 또는 리신이다.
본 발명의 일 양태에서, 친수성 아미노산은 아르기닌이다.
본 발명의 일 양태에서, 최소 하나의 브랜칭 유닛은 -C(O)-, -C(O)NR'-, -C(O)O-, -S(O)2NR'-, -P(O)R''NR'-, -S(O)NR'-, 또는 -PO2NR'-이고, R' 및 R''은 각각 독립적으로 수소, (C1-C8)알킬, (C3-C8)사이클로알킬, (C1-C8)알콕시, (C1-C8)알킬티오, 모노- 또는 디-(C1-C8)알킬아미노, (C3-C20)헤테로아릴, 또는 (C6-C20)아릴이다.
본 발명의 일 양태에서, 최소 하나의 브랜칭 유닛은 -C(O)NR'- 이고, R'은 수소이다.
본 발명의 일 양태에서, 최소 하나의 커넥션 유닛은 -(CH2)r(V(CH2)p)q- 이고, 여기에서 r은 0 내지 10의 정수이며, p은 0 내지 12의 정수이고, q는 1 내지 20의 정수이며, V는 단일결합, -O- 또는 -S-이다.
본 발명의 일 양태에서, r은 2이다.
본 발명의 일 양태에서, p은 2이다.
본 발명의 일 양태에서, q는 6 내지 20의 정수이다.
본 발명의 일 양태에서, r은 2이고, p은 2이며, q는 2, 5 또는 11이고, V는 -O-이다.
본 발명의 일 양태에서, 최소 하나의 커넥션 유닛은 1 내지 12 -OCH2CH2-유닛, 또는 5 내지 12 -OCH2CH2-유닛, 또는 6 내지 12 -OCH2CH2-유닛이다.
본 발명의 일 양태에서, 최소 하나의 커넥션 유닛은 -(CH2CH2X)w-이고,
여기에서 X는 단일 결합, -O-, (C1-C8)알킬렌, 또는 -NR21-이고;
R21은 수소, (C1-C6)알킬, (C1-C6)알킬(C6-C20)아릴, 또는 (C1-C6)알킬(C3-C20)헤테로아릴이며,
w는 1 내지 20의 정수이고, 구체적으로는 1, 3, 6, 또는 12이다.
*본 발명의 일 양태에서 X는 -O-이고, w는 6 내지 20의 정수이다.
본 발명의 일 양태에서, Linker는 1,3-dipolar cycloaddition 반응, hetero-Diels-Alder 반응, 친핵성 치환(nucleophilic substitution) 반응, 비-알돌형 카르보닐 반응, 탄소-탄소 다중 결합 첨가(addition to carbon-carbon multiple bond), 산화 반응 또는 클릭 반응에 의해 형성된 바인딩 유닛을 추가로 포함한다.
본 발명의 일 양태에서, 바인딩 유닛은 아세틸렌 및 아자이드 사이의 반응, 또는 알데하이드 또는 케톤기 및 하이드라진 또는 알콕시아민 사이의 반응에 의해 형성된다.
본 발명의 일 양태에서, 바인딩 유닛은,
여기에서,
L1은 단일 결합 또는 1 내지 30개의 탄소원자를 갖는 알킬렌이고,
R11은 수소 또는 1 내지 10개의 탄소원자를 갖는 알킬이며, 구체적으로 메틸이고,
L2는 1 내지 30개의 탄소원자를 갖는 알킬렌이다.
본 발명의 일 양태에서, 최소 하나의 이소프레닐 유닛은 이소프레노이드 트랜스퍼라제의 기질 또는 이소프레노이드 트랜스퍼라제의 생성물이다.
본 발명의 일 양태에서, Linker의 이소프레닐 유닛은 티오에테르 결합에 의해 항체와 공유결합하며, 티오에테르 결합은 항체의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 항체는 이소프레노이드 트랜스퍼라제에 의해 인식되는 아미노산 모티프를 포함하고, 티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, EGFRvIII에 결합하는 항체 또는 이의 항원 결합단편은 이소프레노이드 트랜스퍼라제에 의해 인식되는 아미노산 모티프를 포함하고, 티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 아미노산 모티프는 CXX, CXC, XCXC, XXCC, 및 CYYX로 이루어진 그룹으로부터 선택되는 서열이고, 여기에서 C는 시스테인을 나타내며; Y는 각 경우 독립적으로 지방족 아미노산을 나타내고; X는 각 경우 독립적으로 글루타민, 글루타메이트, 세린, 시스테인, 메티오닌, 알라닌, 또는 루신을 나타내고; 티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 아미노산 모티프는 CYYX 서열이고, Y는 각 경우 독립적으로 알라닌, 이소루신, 루신, 메티오닌 또는 발린이다.
본 발명의 일 양태에서, 아미노산 모티프는 CVIM 또는 CVLL 서열이다.
본 발명의 일 양태에서, 아미노산 모티프에 선행하는 7개의 아미노산 중 적어도 하나는 글리신이다.
본 발명의 일 양태에서, 아미노산 모티프에 선행하는 7개의 아미노산 중 3개 이상이 글리신, 아르기닌, 아스파르트산 및 세린으로부터 각각 독립적으로 선택될 수 있다.
본 발명의 일 양태에서, 아미노산 모티프에 선행하는 1 내지 10개의 아미노산이 글리신, 구체적으로는 아미노산 모티프에 선행하는 최소 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10개의 아미노산은 글리신이다.
본 발명의 일 양태에서, 항체는 GGGGGGGCVIM의 아미노산 서열을 포함할 수 있다.
본 발명의 또 다른 일 양태에서, Linker는,
(a) 하나 이상의 브랜칭 유닛; (b) 하나 이상의 커넥션 유닛; (c) 하나 이상의 바인딩 유닛(binding unit, BU); 및 (d) 하나 이상의 트리거 유닛(trigger unit, TU)을 함유하는 것일 수 있다.
여기에서 커넥션 유닛은 트리거 유닛과 바인딩 유닛, 트리거 유닛과 브랜칭 유닛 또는 브랜칭 유닛과 바인딩 유닛을 연결하고,
여기에서 하나 이상의 트리거 유닛은 하나 이상의 약물 또는 톡신을 방출할 수 있으며,
여기에서 브랜칭 유닛은 커넥션 유닛과 트리거 유닛, 또는 커넥션 유닛을 또 다른 커넥션 유닛과 연결하는 것이다.
본 발명의 일 양태에서, 트리거 유닛은 다음 화학식 (IIb)의 구조를 갖는다:
상기 식에서,
G는 당(sugar), 당산(sugar acid), 또는 당 유도체(sugar derivatives)이고,
W는 -C(O)-, -C(O)NR'-, -C(O)O-, -S(O)2NR'-, -P(O)R''NR'-, -S(O)NR'-, 또는 -PO2NR'-이고,
C(O), S, 또는 P가 페닐환과 바로 연결되는 경우, R' 및 R''은 각각 독립적으로 수소, (C1-C8)알킬, (C3-C8)사이클로알킬, (C1-C8)알콕시, (C1-C8)알킬티오, 모노- 또는 디-(C1-C8)알킬아미노, (C3-C20)헤테로아릴, 또는 (C6-C20)아릴이며, W는 커넥션 유닛 또는 브랜칭 유닛과 연결되고,
각 Z는 각각 독립적으로 수소, (C1-C8)알킬, 할로겐, 시아노 또는 니트로이고,
n은 1 내지 3의 정수이며,
m은 0 또는 1이고,
R1 및 R2는 각각 독립적으로 수소, (C1-C8)알킬 또는 (C3-C8)사이클로알킬이거나, 또는
R1 및 R2는 이들이 부착된 탄소 원자와 함께 (C3-C8)사이클로알킬 환을 형성한다.
본 발명의 일 양태에서, 상기 당 또는 당산은 모노사카라이드이다.
본 발명의 일 양태에서, G는 하기 화학식 (IIIa) 구조의 화합물이다:
화학식 (IIIa)
여기에서,
R3는 수소 또는 카르복실 보호기이고,
각 R4는 각각 독립적으로 수소 또는 하이드록실 보호기이다.
본 발명의 일 양태에서, R3는 수소이고, 각 R4는 수소이다.
본 발명의 일 양태에서, W는 -C(O)NR'-이고, 여기에서 C(O)가 페닐환과 연결되며, NR'은 커넥션 유닛과 연결된다.
본 발명의 일 양태에서, Z는 수소이다.
본 발명의 일 양태에서, R1 및 R2는 각각 수소이다.
본 발명의 일 양태에서, 커넥션 유닛은 -(CH2)r(V(CH2)p)q-, -((CH2)pV)q-, -(CH2)r(V(CH2)p)qY-, -((CH2)pV)q(CH2)r-, -Y((CH2)pV)q- 또는 -(CH2)r(V(CH2)p)qYCH2-로 나타내지며,
여기에서,
r은 0 내지 10의 정수이고;
p는 1 내지 10의 정수이며;
q는 1 내지 20의 정수이고,
V 및 Y는 각각 독립적으로 단일결합, -O-, -S-, -NR21-, -C(O)NR22-, -NR23C(O)-, -NR24SO2-, 또는 -SO2NR25-이고,
R21 내지 R25는 각각 독립적으로 수소, (C1-C6)알킬, (C1-C6)알킬(C6-C20)아릴 또는 (C1-C6)알킬(C3-C20)헤테로아릴이다.
본 발명의 일 양태에서, r은 2이다.
본 발명의 일 양태에서, p는 2이다.
본 발명의 일 양태에서, q는 6 내지 20의 정수이다.
본 발명의 일 양태에서, q는 2, 5, 또는 11이다.
본 발명의 일 양태에서, V 및 Y는 각각 독립적으로 -O-이다.
본 발명의 일 양태에서, 브랜칭 유닛은,
이고,
여기에서,
L1, L2, 및 L3는 각각 독립적으로 직접 결합(direct bond) 또는 -CnH2n- 이고,
여기에서 n은 1 내지 30의 정수이며,
여기에서,
여기에서 R3는 수소 또는 C1-C30알킬이며,
여기에서 R4는 수소 또는 -L4-COOR5이고, 여기에서 L4는 직접 결합 또는 -CnH2n- 이고 여기에서 n은 1 내지 10의 정수이며, R5는 수소 또는 C1-C30 알킬이다.
여기에서 L1은 직접 결합 또는 1 내지 30개의 탄소원자를 갖는 알킬렌이고,
R11은 수소 또는 1 내지 10개의 탄소원자를 갖는 알킬이며, 구체적으로 메틸이고,
L2는 1 내지 30개의 탄소원자를 갖는 알킬렌이고,
여기에서 브랜칭 유닛은 커넥션 유닛과 항체를 연결한다.
본 발명의 일 양태에서, L1은 12개의 탄소원자를 갖는 알킬렌이다.
본 발명의 일 양태에서, R11은 메틸이다.
본 발명의 일 양태에서, L2는 11개의 탄소원자를 갖는 알킬렌이다.
본 발명의 일 양태에서, 바인딩 유닛은 티오에테르 결합에 의해 항체와 공유결합하며, 티오에테르 결합은 항체의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 항체는 이소프레노이드 트랜스퍼라제에 의해 인식되는 아미노산 모티프를 포함하고, 티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 아미노산 모티프는 CXX, CXC, XCXC, XXCC, 및 CYYX로 이루어진 그룹으로부터 선택되는 서열이고, 여기에서 C는 시스테인을 나타내며; Y는 각 경우 독립적으로 지방족 아미노산을 나타내고; X는 각 경우 독립적으로 글루타민, 글루타메이트, 세린, 시스테인, 메티오닌, 알라닌, 또는 루신을 나타내고; 티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 아미노산 모티프는 CYYX 서열이고, Y는 각 경우 독립적으로 알라닌, 이소루신, 루신, 메티오닌 또는 발린이다.
본 발명의 일 양태에서, 아미노산 모티프는 CVIM 또는 CVLL 서열이다.
본 발명의 일 양태에서, 아미노산 모티프에 선행하는 7개의 아미노산 중 적어도 하나는 글리신이다.
본 발명의 일 양태에서, 아미노산 모티프에 선행하는 7개의 아미노산 중 3개 이상이 글리신, 아르기닌, 아스파르트산 및 세린으로부터 각각 독립적으로 선택될 수 있다.
본 발명의 일 양태에서, 아미노산 모티프에 선행하는 1 내지 10개의 아미노산이 글리신, 구체적으로는 아미노산 모티프에 선행하는 최소 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10개의 아미노산은 글리신이다.
본 발명의 일 양태에서, 항체는 GGGGGGGCVIM의 아미노산 서열을 포함할 수 있다.
본 발명의 일 양태에서, 상기 일반식 I에서 D는 과증식, 암 또는 혈관신생질환의 예방 또는 치료제인 것인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물이 제공된다.
본 발명의 일 양태에서, D는 다음 리스트에서 선택되는 것일 수 있으나, 이로 한정되는 것은 아니다:
(a) 엘로티닙(erlotinib), 보르테조밉(bortezomib), 풀베스트란트(fulvestrant), 수텐트(sutent), 레트로졸(letrozole), 이마티닙 메실레이트(imatinib mesylate), PTK787/ZK 222584, 옥살리플라틴(oxaliplatin), 5-플루오로우라실(5-fluorouracil), 루코보린(leucovorin), 라파마이신(rapamycin), 라파티닙(lapatinib), 로나파르닙(lonafarnib), 소라페닙(sorafenib), 제피티닙(gefitinib), AG1478, AG1571, 티오테파(thiotepa), 사이클로포스파마이드(cyclophosphamide), 부술판(busulfan), 임프로술판(improsulfan), 피포술판(piposulfan), 벤조도파(benzodopa), 카르보콘(carboquone), 메츄도파(meturedopa), 유레도파(uredopa), 에틸렌이민(ethylenimine), 알트레타민(altretamine), 트리에틸렌멜라민(triethylenemelamine), 트리에틸렌포스포라미드(trietylenephosphoramide), 트리에틸렌티오포스포라미드(triethiylenethiophosphoramide), 트리메틸롤로멜라민(trimethylolomelamine), 불라타신(bullatacin), 불라타시논(bullatacinone), 캄토테신(camptothecin), 토포테칸(topotecan), 브리오스타틴(bryostatin), 칼리스타틴(callystatin), CC-1065, 아도젤레신(adozelesin), 카르젤레신(carzelesin), 비젤레신(bizelesin), 크립토피신 1(cryptophycin 1), 크립토피신 8(cryptophycin 8), 돌라스타틴(dolastatin), 듀오카마이신(duocarmycin), KW-2189, CB1-TM1, 엘루테로빈(eleutherobin), 판크라티스타틴(pancratistatin), 사르코딕티인(sarcodictyin), 스폰지스타틴(spongistatin), 클로람부실(chlorambucil), 클로르나파진(chlornaphazine), 클로로포스파미드(cholophosphamide), 에스트라무스틴(estramustine), 이포스파미드(ifosfamide), 메클로르에타민(mechlorethamine), 멜팔란(melphalan), 노벰비킨(novembichin), 페네스테린(phenesterine), 프레드니무스틴(prednimustine), 트로포스파미드(trofosfamide), 우라실 머스타드(uracil mustard), 카르무스틴(carmustine), 클로로코토신(chlorozotocin), 포테쿠스틴(fotemustine), 로무스틴(lomustine), 니무스틴(nimustine), 라니무스틴(ranimnustine), 칼리키아미신(calicheamicin), 칼리키아미신 감마 1(calicheamicin gamma 1), 칼리키아미신 오메가 1(calicheamicin omega 1), 디네미신(dynemicin), 디네미신 A(dynemicin A), 클로드로네이트(clodronate), 에스페르아미신(esperamicin), 네오카르지노스타틴 크로모포어(neocarzinostatin chromophore), 아클라시노마이신(aclacinomysins), 악티노마이신(actinomycin), 안트르마이신(antrmycin), 아자세린(azaserine), 블레오마이신(bleomycins), 칵티노마이신(cactinomycin), 카라비신(carabicin), 카르니노마이신(carninomycin), 카르지노필린(carzinophilin), 크로모마이신(chromomycins), 닥티노마이신(dactinomycin), 다우노루비신(daunorubicin), 데토루부신(detorubucin), 6-디아조-5-옥소-L-노르루신(6-diazo-5-oxo-L-norleucine), 독소루비신(doxorubicin), 모르폴리노-독소루비신(morpholino-doxorubicin), 시아노모르폴리노-독소루비신(cyanomorpholino-doxorubicin), 2-피롤리노-독소루비신(2-pyrrolino-doxorubucin), 리포소말 독소루비신(liposomal doxorubicin), 데옥시독소루비신(deoxydoxorubicin), 에피루비신(epirubicin), 에소루비신(esorubicin), 마르셀로마이신(marcellomycin), 미토마이신 C(mitomycin C), 미코페놀산(mycophenolic acid), 노갈라마이신(nogalamycin), 올리보마이신(olivomycins), 페플로마이신(peplomycin), 포트피로마이신(potfiromycin), 퓨로마이신(puromycin), 쿠엘라마이신(quelamycin), 로도루비신(rodorubicin), 스트렙토미그린(streptomigrin), 스트렙토조신(streptozocin), 투베르시딘(tubercidin), 우베니멕스(ubenimex), 지노스타틴(zinostatin), 조루비신(zorubicin), 5-플루오로우라신(5-fluorouracil), 데노프테린(denopterin), 메토트렉세이트(methotrexate), 프테로프테린(pteropterin), 트리메트렉세이트(trimetrexate), 플루다라빈(fludarabine), 6-머캅토퓨린(6-mercaptopurine), 티아미프린(thiamiprine), 티구아닌(thiguanine), 안시타빈(ancitabine), 아자시티딘(azacitidine), 6-아자유리딘(6-azauridine), 카르모푸르(carmofur), 시타라빈(cytarabine), 디데옥시유리딘(dideoxyuridine), 독시플루리딘(doxifluridine), 에노시타빈(enocitabine), 플록수리딘(floxuridine), 칼루스테론(calusterone), 드로모스타놀론(dromostanolone), 프로피오네이트(propionate), 에피티오스타놀(epitiostanol), 메피티오스테인(mepitiostane), 테스토락톤(testolactone), 아미노글루테티미드(aminoglutethimide), 미토테인(mitotane), 트릴로스테인(trilostane), 폴린산(folinic acid), 아세글라톤(aceglatone), 알도포스파미드 글리코사이드(aldophosphamide glycoside), 아미노레불린산(aminolevulinic acid), 에닐우라실(eniluracil), 암사크린(amsacrine), 베스트라부실(bestrabucil), 비산트렌(bisantrene), 에다트락세이트(edatraxate), 데포파민(defofamine), 데메콜신(demecolcine), 디아지콘(diaziquone), 엘포르니틴(elfornithine), 엘립티니움 아세테이트(elliptinium acetate), 에토글루시드(etoglucid), 갈리움 나이트레이트(gallium nitrate), 하이드록시우레아(hydroxyurea), 렌티난(lentinan), 로니다이닌(lonidainine), 메이탄신(maytansine), 안사미토신(ansamitocins), 미토구아존(mitoguazone), 미토잔트론(mitoxantrone), 모피단몰(mopidanmol), 니트라에린(nitraerine), 펜토스타틴(pentostatin), 페나메트(phenamet), 피라루비신(pirarubicin), 로소잔트론(losoxantrone), 2-에틸하이드라지드(2-ethylhydrazide), 프로카르바진(procarbazine), 폴리사카라이드-k(polysaccharide-k), 라족세인(razoxane), 리조신(rhizoxin), 시조피란(sizofiran), 스피로게르마늄(spirogermanium), 테누아존산(tenuazonic acid), 트리아지콘(triaziquone), 2,2',2''-트리클로로트리에틸아민(2,2’,2''-trichlorotriethylamine), T-2 톡신, 베라큐린 A(verracurin A), 로리딘 A(roridin A), 안구이딘(anguidine), 우레탄(urethane), 빈데신(vindesine), 다카르바진(dacarbazine), 만노무스틴(mannomustine), 미토브로니톨(mitobronitol), 미토락톨(mitolactol), 피포브로만(pipobroman), 가시토신(gacytosine), 아라비노사이드(arabinoside), 사이클로포스파미드(cyclophosphamide), 티오테파(thiotepa), 파클리탁셀(paclitaxel), 파클리탁셀, 파클리탁셀의 알부민-엔지니어드 나노파티클(albumin-engineered nanoparticle formulation of paclitaxel), 도세탁셀, 클로람부실, 젬시타빈, 6-티오구아닌, 머캅토퓨린, 시스플라틴, 카보플라틴(carboplatin), 빈블라스틴(vinblastine), 플래티늄(platinum), 에토포사이드(etoposide), 이포스파미드(ifosfamide), 미톡산트론(mitoxantrone), 빈크리스틴, 비노렐빈(vinorelbine), 노반트론(novantrone), 테니포사이드(teniposide), 에다트렉세이트(edatrexate), 다우노마이신(daunomycin), 아미노프테린(aminopterin), 젤로다(xeloda), 이반드로네이트(ibandronate), CPT-11, 토포이소머라아제 저해제 RFS 2000, 디플루오로메틸오르니틴(difluoromethylornithine), 레티노산(retinoic acid), 카페시타빈(capecitabine), 또는 이의 약학적으로 허용되는 염, 용매화물 또는 산;
(b) 모노카인(monokine), 림포카인(lympokine), 폴리펩타이드 호르몬(traditional polypeptide hormone), 부갑상선 호르몬(parathyroid hormone), 티록신(thyroxine), 릴렉신(relaxin), 프로릴렉신(prorelaxin), 당단백 호르몬(glycoprotein hormone), 여포자극호르몬(follicle stimulating hormone), 갑상샘자극호르몬(thyroid stimulating hormone), 황체형성호르몬(luteinizing hormone), 간 성장인자 섬유모세포성장인자(hepatic growth factor fibroblast growth factor), 프롤락틴(prolactin), 태반성 락토젠(placental lactogen), 종양괴사인자-α(tumor necrosis factor-α), 종양괴사인자-β, 뮐러관 억제물질(mullerian-inhibiting substance), 마우스 고나도트로핀-연관 펩타이드(mouse gonadotropin-associated peptide), 인히빈(inhibin), 액티빈(activin), 혈관내피증식인자(vascular endothelial growth factor), 트롬보포이에틴(thrombopoietin), 에리스로포이에틴(erythropoietin), 골유도 인자(osteoinductive factor), 인터페론, 인터페론-α, 인터페론-β, 인터페론-γ, 콜로니자극인자(colony stimulating factor, CSF), 마크로파지-CSF, 과립구-마크로파지-CSF(granulocyte-macrophage-CSF), 과립구-CSF, 인터루킨(IL), IL-1, IL-1α, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, 종양괴사인자(tumor necrosis factor), TNF-α, TNF-β, 폴리펩타이드 인자, LIF, 키트 리간드(kit ligand), 또는 이들의 배합물;
(c) 디프테리아 톡신, 보툴리눔 톡신, 테타누스 톡신, 디센터리 톡신, 콜레라 톡신, 아마니틴, α-아마니틴, 피롤로벤조디아제핀, 피롤로벤조디아제핀 유도체, 테트로도톡신, 브레베톡신(brevetoxin), 시구아톡신(ciguatoxin), 리신(ricin), AM 톡신, 오리스타틴(auristatin), 투불리신(tubulysin), 겔다나마이신(geldanamycin), 메이탄시노이드(maytansinoid), 칼리케아마이신(calicheamycin), 다우노마이신(daunomycin), 독소루비신(doxorubicin), 메토트렉세이트(methotrexate), 빈데신(vindesine), SG2285, 돌라스타틴(dolastatin), 돌라스타틴 유사체(dolastatin analog), 오리스타틴(auristatin), 크립토피신(cryptophycin), 캄토테신(camptothecin), 리족신(rhizoxin), 리족신 유도체(rhizoxin derivatives), CC-1065, CC-1065, 유사체 또는 유도체, 듀오카마이신(duocarmycin), 에네다인 항생제(enediyne antibiotic), 에스페라마이신(esperamicin), 에포틸론(epothilone), 톡소이드(toxoid), 또는 이들의 배합물;
(d) 친화성 리간드(affinity ligand), 여기에서 친화성 리간드는 기질, 저해제, 활성화제, 신경전달물질, 방사성 동위원소, 또는 이들의 배합물;
(e) 방사능표지(radioactive label), 32P, 35S, 형광다이, 전자밀도 반응제(electron dense reagent), 효소, 비오틴, 스트렙타비딘(streptavidin), 디옥시제닌(dioxigenin), 햅텐(hapten), 면역성 단백질(immunogenic protein), 타겟에 컴플러멘터리한 서열을 갖는 핵산 분자(nucleic acid molecule with a sequence complementary to a target) 또는 이들의 배합물;
(f) 면역조절 화합물(immunomodulatory compound), 항-암제(anti-cancer agent), 항-바이러스제(anti-viral agent), 항-박테리아제(anti-bacterial agent), 항-곰팡이제(anti-fungal agent), 및 항-기생충제(anti-parasitic agent), 또는 이들의 배합물;
(g) 타목시펜(tamoxifen), 랄록시펜(raloxifene), 드롤록시펜(droloxifene), 4-하이드록시타목시펜(4-hydroxytamoxifen), 트리옥시펜(trioxifene), 케옥시펜(keoxifene), LY117018, 오나프리스톤(onapristone) 또는 토레미펜(toremifene);
(h) 4(5)-이미다졸, 아미노글루테티미드(aminoglutethimide), 메제스톨 아세테이트(megestrol acetate), 엑스메스탄(exemestane), 레트로졸(letrozole)Ehsms 아나스트로졸(anastrozole)
(i) 플루타미드(flutamide), 닐루타미드(nilutamide), 비칼루타미드(bicalutamide), 리우프롤라이드(leuprolide), 고세렐린(goserelin), 또는 트록사시타빈(troxacitabine);
(j) 아로마타아제 저해제;
(k) 단백질 키나아제 저해제;
(l) 리피드 키나아제 저해제;
(m) 안티센스 올리고뉴클레오티드;
(n) 리보자임;
(o) 백신; 및
(p) 항-맥관형성제(anti-angiogenic agent).
본 발명의 또 다른 일 양태에서, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물을 유효성분으로 함유하는, 과증식, 암 또는 혈관신생질환의 예방 또는 치료용 약학적 조성물이 제공된다.
본 발명의 일 양태에서, 불활성, 비-독성, 또는 약제학적으로 허용되는 부형제를 추가로 포함하는, 약학적 조성물이 제공된다.
본 발명의 일 양태에서, 하나 이상의 항-과증식, 세포정지성 또는 세포독성 물질을 추가로 포함하는, 약학적 조성물이 제공된다.
본 발명의 또 다른 일 양태에서, 과증식, 암 또는 혈관신생질환의 예방 또는 치료를 위한 약제의 제조에 있어서, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물의 용도가 제공된다.
본 발명의 또 다른 일 양태에서, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물을 유효성분으로 함유하는, 과증식, 암 또는 혈관신생질환의 예방 또는 치료용 약학적 조성물을 개체에 투여하여 과증식, 암 또는 혈관신생질환을 예방 또는 치료하는 방법이 제공되며, 이 때 하나 이상의 항-과증식, 세포정지성 또는 세포독성물질을 배합하여 투여하는 방법이 또한 제공된다.
본 발명에 따른 항체-약물 접합체는 EGFRvIII 발현 세포에 특이적으로 결합하여 세포 내로 내재화되는 항-EGFRvIII 항체를 포함함으로써, 약물을 효과적이면서도 특이적 및 선택적으로 전달할 수 있으며, 항체에 약물이 안정적으로 결합되어 생체내 안정성을 유지하면서 목적하는 세포독성을 나타낼 수 있도록 하며, 특히 혈장 내에서 보다 안정하고 체내 순환시에도 안정적이며, 약물이 암세포 내에서 쉽게 방출되어 약효를 극대화할 수 있는 자가-희생기를 포함하는 링커 기술을 접목시킴으로써, 약물 및/또는 톡신이 표적 세포에 안정적으로 도달하여 약효를 효과적으로 발휘하면서도 독성을 크게 낮출 수 있는, 약물-링커-리간드 시스템을 제공하는 효과를 나타낸다.
이하, 본 발명을 보다 상세히 설명한다.
본 명세서에서 "접합체(conjugates)"는 세포독성 화합물의 하나 이상의 분자에 공유결합되는 세포 결합제를 말한다. 여기서, "세포 결합제"는 생물학적 타겟에 대한 친화도를 갖는 분자로서, 예를 들어 리간드, 단백질, 항체, 구체적으로 모노클로날 항체, 단백질 또는 항체 단편, 펩타이드, 올리고뉴클레오티드, 올리고사카라이드일 수 있으며, 결합제는 생물학적 활성 화합물을 생물학적 타겟으로 유도하는 기능을 한다. 본 발명의 일 양태에서, 접합체는 세포 표면 항원을 통해 종양 세포를 표적화하도록 설계될 수 있다. 항원은 비정상적인 세포 타입에서 과다 발현되거나 또는 발현되는 세포 표면 항원일 수 있다. 구체적으로, 표적 항원은 증식성 세포(예컨대 종양 세포) 상에서만 발현되는 것일 수 있다. 표적 항원은 통상 증식성 조직 및 정상 조직 사이의 상이한 발현에 기초하여 선택될 수 있다. 본 발명에서 리간드는 링커에 결합된다.
본 명세서에서 “Linker(링커)”는 세포독성 화합물을 결합제에 공유결합시키는 화합물을 말한다. 본 발명의 일 양태에서, 링커로는 대한민국공개특허 제2015-0137015호, PCT/US2016/063564호 및 PCT/US2016/063595호에 개시된 링커를 사용할 수 있다.
본 명세서에서 "EGFRvIII"는 MR1 scFv에 의해 인식되고 아미노 말단 부근 2-7 엑손의 801 염기쌍 인프레임 결실에 의해 특징되는 표피성장인자 수용체의 돌연변이형을 의미한다. 약 50∼60%의 글리오블라스토마(glioblastoma)에서 고발현되고, 약 70∼80%의 유방 및 난소 암종 및 약 16%의 비소세포 폐 암종에서 존재하는 것으로 나타난다. 돌연변이 수용체는 세포표면에서 발현되고, 결실 접합부에서 새로운 종양 특이 세포 표면 에피토프(epitope)를 생성한다.
본 명세서에서 "항체(antibody)"는 EGFRvIII에 특이적으로 결합하는 항-EGFRvIII 항체를 의미한다. 본 발명의 범위에는 EGFRvIII에 특이적으로 결합하는 완전한 항체 형태뿐 아니라, 상기 항체 분자의 항원 결합 단편도 포함된다.
완전한 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 중쇄 불변영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변영역은 카파(κ) 및 람다(λ) 타입을 가진다.
항체의 항원 결합 단편 또는 항체 단편이란 항원 결합 기능을 보유하고 있는단편을 의미하며, Fab, F(ab'), F(ab')2 및 Fv 등을 포함한다. 항체 단편 중 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변영역 및 중쇄의 첫 번째 불변영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변영역 및 경쇄 가변영역만을 가지고 있는 최소의 항체조각으로 Fv 단편을 생성하는 재조합 기술은 PCT 국제 공개특허출원 WO88/10649, WO88/106630, WO88/07085, WO88/07086 및 WO88/09344에 개시되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변영역과 경쇄 가변영역이 연결되어 있고 단쇄 Fv(single-chain Fv, scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변영역과 경쇄의 가변영역이 공유결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 유전자 재조합 기술을 통하여 제작할 수도 있다.
"중쇄"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변영역 도메인 VH 및 3 개의 불변영역 도메인 CH1, CH2 및 CH3을 포함하는 전체길이 중쇄 및 이의 단편을 모두 의미한다.
"경쇄"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변영역 도메인 VL 및 불변영역 도메인 CL을 포함하는 전체길이 경쇄 및 이의 단편을 모두 의미한다.
"항체 가변 도메인"은 상보성 결정 영역 (CDR; 즉,CDR1, CDR2, 및 CDR3), 및 골격 영역 (framework region; FR)의 아미노산 서열을 포함하는 항체 분자의 경쇄 및 중쇄 부분을 지칭한다. VH는 중쇄의 가변 도메인을 지칭한다. VL은 경쇄의 가변 도메인을 지칭한다.
"상보성 결정 영역" (CDR; 즉, CDR1, CDR2, 및 CDR3)은 항원 결합을 위해 필요한 존재인, 항체 가변 도메인의 아미노산 잔기를 지칭한다. 각 가변 도메인은 전형적으로, CDR1, CDR2 및 CDR3으로서 확인된 3개의 CDR 영역을 갖는다.
상기 CDR 영역의 결정은 CDR 결정은 Kabat, IMGT 방법, Chothia 방법, AbM 방법을 이용하여 결정할 수 있고, 본 발명은 Kabat, IMGT 방법을 이용하여 CDR 영역을 결정하였다.
"골격 영역" (FR)은 CDR 잔기 이외의 가변 도메인 잔기이다. 각 가변 도메인은 전형적으로, FR1, FR2, FR3 및 FR4로서 확인된 4개의 FR을 가진다.
"Fv" 단편은 완전한 항체 인식 및 결합 부위를 함유하는 항체 단편이다. 이러한 영역은 1개의 중쇄 가변 도메인과 1개의 경쇄 가변 도메인이, 예를 들어 scFv로 단단하게 사실상 공유적으로 연합된 이량체로 이루어진다.
"Fab" 단편은 경쇄의 가변 및 불변 도메인과, 중쇄의 가변 및 제1 불변 도메인 (CH1)을 함유한다. F(ab')2 항체 단편은 일반적으로 그들 사이에 힌지 시스테인에 의해 그들의 카복시 말단 근처에 공유적으로 연결되는 한 쌍의 Fab 단편을 포함한다.
"단일쇄 Fv" 또는 "scFv" 항체 단편은 항체의 VH 및 VL 도메인을 포함하는데, 이들 도메인은 단일 폴리펩티드 쇄 내에 존재한다. Fv 폴리펩티드는 scFv가 항원 결합을 위해 목적하는 구조를 형성할 수 있도록 하는 VH 도메인과 VL 도메인 사이에 폴리펩티드 링커를 추가로 포함할 수 있다.
본 명세서에서 "치료제"는 암 세포 또는 활성화된 면역 세포에 세포독성, 세포증식억제 및/또는 면역조절 효과를 행사하는 작용제이다. 치료제의 예는 세포독성제, 화학요법제, 세포증식억제제 및 면역조절제를 포함한다.
본 명세서에서 "약물 또는 톡신"은 암의 치료에 유용한 화학적 화합물이다.
본 명세서에서 "비치환되거나 치환된"은 비치환될 수 있거나 또는 치환될 수 있는 모기(parent group)를, "치환된"은 1 이상의 치환기를 갖는 모기(parent group)를, "치환기"는 모기(parent group)에 공유결합되거나 모기(parent group)에 융합된 화학적 부분을 의미한다.
본 명세서에서 "할로" 또는 "할로겐"은 플루오린, 클로라인, 브로마인, 요오드 등을 말한다.
본 명세서에서 "알킬"은 지방족 또는 지환족, 포화 또는 불포화(불포화, 완전 불포화) 탄화수소 화합물의 탄소 원자로부터 수소 원자를 제거하여 얻어진 1가 부분으로서, 포화 알킬의 예로는 메틸, 에틸, 프로필, 부틸, 펜틸, 헥실, 헵틸 등을, 포화 직쇄형 알킬의 예로는 메틸, 에틸, n-프로필, n-부틸, n-펜틸(아밀), n-헥실, n-헵틸 등, 포화 분지쇄형 알킬의 예로는 이소프로필, 이소부틸, sec-부틸, tert-부틸, 이소펜틸, 네오펜틸 등을 들 수 있다.
본 명세서에서 "알콕시"는 -OR[여기서, R은 알킬기]을 의미하며, 예로는 메톡시, 에톡시, n-프로폭시, 이소프로폭시, n-부톡시, sec-부톡시, 이소부톡시, tert-부톡시 등을 들 수 있다.
본 명세서에서 "아릴"은 고리 원자를 갖는 방향족 화합물의 방향족 고리 원자로부터 수소 원자를 제거하여 얻어진 1가 부분을 의미한다.
본 명세서에서 "알케닐"은 1 이상의 탄소-탄소 이중 결합을 갖는 알킬로서, 불포화 알케닐기의 예로는 에테닐(비닐, -CH=CH2), 1-프로페닐(-CH=CH-CH3), 2-프로페닐, 이소프로페닐, 부테닐, 펜테닐, 헥세닐 등을 들 수 있다.
본 명세서에서 "알킬렌"은 지방족 포화 탄화수소 중 다른 2개의 탄소 원자에 결합하는 2개의 수소 원자를 제외하고 생기는 2가의 원자단을 말하며, 일반식 CnH2n-으로 표시되며, 에틸렌, 프로필렌, 부틸렌, 아밀렌, 헥실렌 등을 들 수 있다.
본 명세서에서 "카르복시"는 -C(=O)OH를 말한다.
본 명세서에서 "포르밀"은 -C(=O)H를 말한다.
본 명세서에서 "헤테로아릴"은 1 이상의 헤테로 원자를 포함하는 아릴로서, 예로는 피리딘, 피리미딘, 벤조티오펜, 푸릴, 디옥살라닐, 피롤릴, 옥사졸릴, 피리딜, 피리다지닐, 피리미디닐 등, 보다 구체적으로 벤조푸란, 이소벤조푸란, 인돌, 이소인돌, 인돌리진, 인돌린, 이소인돌린, 푸린(아데닌 또는 구아닌), 벤즈이미다졸, 인다졸, 벤즈옥사졸, 벤즈이속사졸, 벤조디옥솔, 벤조푸란, 벤조트리아졸, 벤조티오푸란, 벤조티아졸, 벤조티아디아졸로부터 유도된 2개의 융합고리를 갖는 C9, 크로멘, 이소크로멘, 크로만, 이소크로만, 벤조디옥산, 퀴놀린, 이소퀴놀린, 퀴놀리진, 벤족사진, 벤조디아진, 피리도피리딘, 퀴녹살린, 퀴나졸린, 신놀린, 프탈라진, 나프티리딘, 프테리딘으로부터 유도된 2개의 융합고리를 갖는 C10, 벤조디아제핀으로부터 유도된 2개의 융합고리를 갖는 C11, 카르바졸, 디벤조푸란, 디벤조티오펜, 카르볼린, 페리미딘, 피리도인돌로부터 유도된 3개의 융합고리를 갖는 C13, 아크리딘, 크산텐, 티오크산텐, 옥산트렌, 페녹사티인, 페나진, 페녹사진, 페노티아진, 티안트렌, 페난트리딘, 페난트롤린, 페나진으로부터 유도된 3개의 융합고리를 갖는 C14를 들 수 있다.
본 명세서에서 "약학적으로 허용되는 염"으로는 약학적으로 허용가능한 유리산(free acid)에 의하여 헝성된 산 부가염을 사용할 수 있고, 상기 유리산으로는 유기산 또는 무기산을 사용할 수 있다.
상기 유기산은 이로 제한되는 것은 아니나, 구연산, 초산, 젖산, 주석산, 말레인산, 푸마르산, 포름산, 프로피온산, 옥살산, 트리플루오로아세트산, 벤조산, 글루콘산, 메타술폰산, 글리콜산, 숙신산, 4-톨루엔술폰산, 글루탐산 및 아스파르트산을 포함한다. 또한 상기 무기산은 이로 제한되는 것은 아니나, 염산, 브롬산, 황산 및 인산을 포함한다.
예컨대, 화합물이 음이온이거나 또는 음이온일 수 있는 작용기를 갖는 경우(예컨대 -COOH는 -COO-일 수 있음), 적절한 양이온으로 염을 형성할 수 있다. 적절한 무기 양이온의 예는 알칼리 금속 이온, 예컨대 Na+ 및 K+, 알칼리 토금속 양이온, 예컨대 Ca2+ 및 Mg2+ 및 다른 양이온, 예컨대 Al3+을 포함하지만, 이에 한정되지 않는다. 적절한 유기 양이온의 예는 암모늄 이온(즉, NH4
+) 및 치환된 암모늄 이온(예컨대 NH3R+, NH2R2
+, NHR3
+, NR4
+)을 포함하지만, 이에 한정되지 않는다.
일부 적절한 치환된 암모늄 이온의 예는 하기로부터 유도된 것들이다: 에틸아민, 디에틸아민, 디사이클로헥실아민, 트리에틸아민, 부틸아민, 에틸렌디아민, 에탄올아민, 디에탄올아민, 피페라진, 벤질아민, 페닐벤질아민, 콜린, 메글루민 및 트로메타민 뿐 아니라, 아미노산, 예컨대 리신 및 아르기닌. 통상적인 4급 암모늄 이온의 예는 N(CH3)4
+이다.
화합물이 양이온이거나 또는 양이온일 수 있는 작용기를 갖는 경우(예컨대 -NH2는 -NH3
+일 수 있음), 적절한 음이온으로 염을 형성할 수 있다. 적절한 무기 음이온의 예는 하기 무기 산으로부터 유도된 것들을 포함하지만, 이에 한정되지 않는다: 염산, 브롬화수소산, 요오드화수소산, 황산, 아황산, 질산, 아질산, 인산 및 아인산 등을 예로 들 수 있다.
적절한 유기 음이온의 예는 하기 유기산으로부터 유도된 것들을 포함하지만, 이로 한정되지 않는다: 2-아세티옥시벤조산, 아세트산, 아스코르브산, 아스파르트산, 벤조산, 캠퍼설폰산, 신남산, 시트르산, 에데트산, 에탄디설폰산, 에탄설폰산, 푸마르산, 글루쳅톤산, 글루콘산, 글루탐산, 글리콜산, 히드록시말레산, 히드록시나프탈렌 카르복실산, 이세티온산, 락트산, 락토비온산, 라우르산, 말레산, 말산, 메탄설폰산, 점액산, 올레산, 옥살산, 팔미트산, 팜산, 판토텐산, 페닐아세트산, 페닐설폰산, 프로피온산, 피루브산, 살리실산, 스테아르산, 숙신산, 설파닐산, 타르타르산, 톨루엔설폰산 및 발레르산 등을 예로 들 수 있다. 적절한 중합체 유기 음이온의 예는 하기 중합체 산으로부터 유도된 것들을 포함하지만, 이에 한정되지 않는다: 타닌산, 카르복시메틸 셀룰로오스 등을 예로 들 수 있다.
본 명세서에서 "용매화물(solvate)"은 본 발명에 따른 화합물과 용매 분자(solvent molecules) 사이의 분자 복합체(molecular complex)를 말하며, 용매화물의 예는 물, 이소프로판올, 에탄올, 메탄올, 디메틸설폭사이드(dimethylsulfoxide), 에틸 아세테이트, 아세트산, 에탄올아민 또는 이의 혼합용매와 결합한 본 발명에 따른 화합물을 포함하나, 이로 제한되는 것은 아니다.
활성 화합물의 상당하는 용매화물을 제조, 정제 및/또는 취급하는 것이 편리하거나 또는 바람직할 수 있다. 용어 "용매화물"은 본 명세서에서 용질(예컨대 활성 화합물, 활성 화합물의 염) 및 용매의 착체를 지칭하기 위해 통상적인 의미로 사용된다. 용매가 물인 경우, 용매화물을 편리하게 수화물, 예컨대 일수화물, 이수화물, 삼수화물 등으로 지칭할 수 있다.
상기 본 발명의 약학적 조성물은 약학적으로 허용 가능한 담체를 포함할 수 있다. 약학적으로 허용 가능한 담체는 통상적으로 서서히 대사되는 거대분자, 예를 들어 단백질, 다당류, 폴리락트산, 폴리글리콜산, 중합체성 아미노산, 아미노산 공중합체, 지질 응집물 등을 포함할 수 있으며, 이러한 약학적으로 허용 가능한 담체는 당업자가 적절히 선택하여 사용할 수 있다.
약학적으로 허용 가능한 담체를 포함하는 상기 조성물은 경구 또는 비경구의 여러 가지 제형일 수 있다. 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다.
경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 하나 이상의 화합물에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로오스 또는 락토오스, 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 스테아린산 마그네슘, 탈크 등과 같은 윤활제들도 사용될 수 있다. 한편 경구투여 시, 단백질 또는 펩타이드는 소화가 되므로 경구용 조성물의 형태로 제형화할 때에는 활성 성분을 코팅하거나 위에서 분해되지 않도록 보호하는 것이 필요하다.
경구투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다.
비경구투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수성용제, 현탁용제로는 프로필렌글리콜(propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테로 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로젤라틴 등이 사용될 수 있다.
상기 약학적 조성물은 주사제, 정제, 환제, 산제, 과립제, 캡슐제, 현탁제, 내용액제, 유제, 시럽제, 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제 및 좌제로 이루어진 군으로부터 선택되는 어느 하나의 제형을 가질 수 있다.
정맥내, 피부 또는 피하 주사 등을 위해, 활성 성분은 무발열성(pyrogen-free)이고 적절한 pH, 등장성 및 안정성을 갖는 비경구 투여용의, 허용가능한 수용액의 형태일 수 있다. 당업자는 예를 들어 염화나트륨 수용액, 링거액, 락테이트 링거액 등과 같은 등장성 비히클을 사용하여 적절한 용액을 제조할 수 있으며, 보존제, 안정화제, 완충제, 산화 방지제 또는 기타 다른 첨가제로 필요한 경우 포함될 수 있다. 주사에 적합한 고체 형태는 또한 에멀젼으로서 또는 리포솜에 캡슐화된 폴리펩티드의 형태로 제조될 수 있다.
본 발명에 따른 접합체는 활성 물질이 타겟 세포로 이동할 수 있는 임의의 장치에 의해 투여될 수도 있다.
본 명세서에 사용된 어구 "유효량" 또는 "치료 유효량"은 목적 치료 결과를 달성하는데 (투여량 및 투여 기간 및 수단에 대해) 필요한 양을 지칭한다. 유효량은 적어도 대상체에게 치료 이익을 부여하는데 필요한 활성제의 최소량이며, 독성량 미만이다. 예를 들어 투여량은 환자 당 약 100 ng 내지 약 100 mg/kg 범위로, 보다 전형적으로 약 1 μg/kg 내지 약 10 mg/kg의 범위로 투여할 수 있다. 활성 화합물이 염, 에스테르, 아미드, 전구체 약물(prodrug) 등인 경우에 투여량은 모 화합물을 기준으로 계산되므로, 사용되는 실제 중량은 비례하여 증가된다.
예를 들어 약물 또는 톡신은 단위 제형(dosage form)당 활성 성분 0.01 mg 내지 3000 mg, 0.1 mg 내지 2000 mg, 1 mg 내지 1000 mg을 포함하도록 제형화될 수 있으나 이로 한정되지 않는다. 활성 성분은 약 0.05 μM 내지 100 μM, 1 μM 내지 50 μM, 5 μM 내지 30 μM의 활성 화합물의 피크 플라즈마 농도를 얻도록 투여될 수 있다. 예를 들어 임의로 식염수 내에서 활성 성분 0.1 w/v% 내지 5 w/v% 용액의 정맥 주사에 의해 투여될 수 있다.
약학 조성물에서 활성 화합물의 농도는 약물의 흡수, 불활성화 및 배출율 및 당 기술분야의 숙련자에게 알려진 다른 인자에 의해 결정될 수 있다. 투여량은 증상/질환의 심각도에 따라 달라질 수 있다. 또한 어떤 특정 환자에 대한 투여량 및 투여요법은 환자의 증상/질환의 정도, 필요성, 나이, 약물에 대한 반응성 등을 종합적으로 고려하여 투여 감독자의 직업적 판단에 따라 조정될 수 있으며, 본 발명에서 제시된 농도 범위는 단지 일예이며, 청구된 조성물의 실시양태를 이로 한정하는 것을 의도하지 않는다. 또한 활성 성분은 1회 투여될 수 있거나, 보다 적은 투여량을 수 회 나누어 투여할 수도 있다.
본 발명에 따른 항체-링커-약물(톡신) 접합체 화합물은 증식성 질환, 특히 암 질환을 치료하기 위해 사용될 수 있다.
용어 "증식성 질환"은 시험관내 또는 생체 내에서 신생 또는 과다형성 성장과 같은 바람직하지 않은 과도하거나 비정상적인 세포의 원치 않거나 조절되지 않는 세포 증식을 말한다. 증식성 질환은 예를 들어 신생물, 종양, 암, 백혈병, 건선, 뼈 질환, 섬유증식성 장애, 죽상동맥경화증 등을 포함하며, 양성, 전악성 또는 악성 세포 증식을 포함할 수 있으나 이로 제한되지 않는다. 상기 암은 폐암, 소세포성 폐암, 위장관암, 대장암, 장암, 유방암, 난소암, 전립선암, 고환암, 간암, 신장암, 방광암, 췌장암, 뇌암, 교모세포종, 육종, 골육종, 카포시 육종 또는 흑색종일 수 있으나 이로 제한되는 것은 아니다.
"EGFRvIII을 과발현하는 암"은 동일한 조직 유형의 비-암성 세포와 비교하여 유의적으로 더 높은 수준으로 EGFRvIII을 암 세포표면에 가지고 있는 암을 의미한다.
본 발명에 따른 접합체가 적용되는 질환인 암은 EGFRvIII을 과발현하는 암일 수 있고, 예를 들어 교모세포종, 성상세포종, 신경교종, 신경아세포종, 고환암, 대장암, 흑색종, 췌장암, 폐암, 유방암, 식도암, 폐암, 난소암, 전립선암 및 편평상피암 등일 수 있다.
이하 본 발명을 실시예 및 실험예를 통해 보다 상세히 설명한다. 하기 실시예 및 실험예는 본 발명의 이해를 돕기 위한 것이고, 본 발명의 권리범위를 이로 한정하려는 의도를 갖는 것은 아니다.
실시예 1. 화합물 1의 제조
상기 화학식1의 화합물은 대한민국등록특허 제1,628,872호에 기재된 방법(실시예 8)에 따라 제조하였다.
한편, 상기 화합물1의 화학식에서 MMAF의 구조는 다음에 나타낸 바와 같다.
실시예 2. 화합물 2, 3, 4, 5, 6, 7, 8 및 9의 제조
상기 화합물 2, 3, 4, 5, 6, 7, 8 및 9는 WO2017-189895호에 기재된 방법으로 제조하였다.
상기 화합물 3, 5 및 7에서 MMAE의 구조는 다음과 같다.
실시예 3. 항체-약물 접합체(Antibody-Drug conjugate)의 제조
상기 화합물 1, 2, 3, 4, 5, 6, 7, 8 및 9를 이용하여 항체-약물 접합체를 WO2017-189895호에 기재된 방법으로 제조하였다.
각각의 항체와 화합물의 조합에 따라 다음과 같이 ADC를 명명하였다.
실험예 1. 세포사멸유도 활성 테스트
상기 표 2 및 표 3에 기재된 ADC의 DKMG (glioblastoma cell line) 암세포주 또는 뇌암 환자유래세포주(PDC; vIII352T1, 022, 437, 464, 626, NT352T1)에 대한 세포사멸유도 활성을 측정하였다.
96-well 플레이트에 각 암세포주를 well당 5,000개씩 파종(seeding)하여 4시간(PDC) 또는 24시간(CDC) 동안 배양한 후, 약물을 처리하였다. 72시간 또는 168시간 후에 살아있는 세포수를 CellTiter-Glo® Luminescent Cell Viability Assay(Promega, G7570)을 이용하여 측정하였다. 72시간 조건에서 효능을 평가한 것을 표 4에, 168시간 조건에서 효능을 평가한 것을 표 5 및 표 6에 각각 나타냈다.
EGFRvIII가 발현되고 있는 환자유래세포나 암세포주에서 단위 nM 이하의 우수한 효능을 나타냈다. 또한 EGFRvIII를 발현하지 않는 정상세포 NT352T1에서는 100 nM까지도 독성이 전혀 관찰되지 않아, 선택성이 우수함을 확인하였다. 따라서 본 발명에 따른 항체-약물 접합체는 안전성이 충분히 확보되었음을 알 수 있다.
Claims (42)
- 일반식 I의 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물:[일반식 I]Ab - (Linker - D)n상기 식에서,Ab는 EGFRvIII(Epidermal Growth Factor Receptor Variant III)에 결합하는 항체 또는 이의 항원 결합단편이고,Linker는 링커이며,D는 약물 또는 톡신이고,n은 1 내지 20의 정수이다.
- 제1항에 있어서,상기 EGFRvIII에 결합하는 항체 또는 이의 항원 결합단편은,서열번호 1로 기재되는 서열을 가지는 EGFRvIII의 에피토프에 결합하는 것을 특징으로 하는 항체 또는 이의 항원 결합단편인 것을 특징으로 하는 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제1항에 있어서,상기 EGFRvIII에 결합하는 항체 또는 이의 항원 결합단편은,서열번호 2, 3, 17, 18 및 32로 이루어진 군으로부터 선택되는 어느 하나로 기재되는 서열을 가지는 CDR(complementarity determining region)H1, 서열번호 4, 5, 19, 20 및 33으로 이루어진 군으로부터 선택되는 어느 하나로 기재되는 서열을 가지는 CDRH2, 및 서열번호 6, 7, 21, 22 및 34로 이루어진 군으로부터 선택되는 어느 하나로 기재되는 서열을 가지는 CDRH3을 포함하는 중쇄 가변영역; 및서열번호 8, 9, 23, 24 및 35로 이루어진 군으로부터 선택되는 어느 하나로 기재되는 서열을 가지는 CDRL1, 서열번호 10, 11, 25, 26 및 36으로 이루어진 군으로부터 선택되는 어느 하나로 기재되는 서열을 가지는 CDRL2, 및 서열번호 12, 27 또는 37로 기재되는 서열을 가지는 CDRL3을 포함하는 경쇄 가변영역을 포함하는 것을 특징으로 하는 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제1항에 있어서,상기 EGFRvIII에 결합하는 항체 또는 이의 항원 결합단편은,서열번호 13, 28 또는 38 기재되는 서열을 가지는 중쇄 가변영역을 포함하는 것을 특징으로 하는 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제1항에 있어서,상기 EGFRvIII에 결합하는 항체 또는 이의 항원 결합단편은,서열번호 14, 29 또는 39로 기재되는 서열을 가지는 경쇄 가변영역을 포함하는 것을 특징으로 하는 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제1항에 있어서,Linker는 하기 화학식 IIa의 구조를 갖는 것인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물:[화학식 IIa]상기 식에서,G는 당(sugar), 당산(sugar acid), 또는 당 유도체(sugar derivatives)이고,W는 -C(O)-, -C(O)NR'-, -C(O)O-, -S(O)2NR'-, -P(O)R''NR'-, -S(O)NR'-, 또는 -PO2NR'-이고,C(O), S, 또는 P가 페닐환과 바로 연결되는 경우, R' 및 R''은 각각 독립적으로 수소, (C1-C8)알킬, (C3-C8)사이클로알킬, (C1-C8)알콕시, (C1-C8)알킬티오, 모노- 또는 디-(C1-C8)알킬아미노, (C3-C20)헤테로아릴, 또는 (C6-C20)아릴이며,각 Z는 각각 독립적으로 수소, (C1-C8)알킬, 할로겐, 시아노 또는 니트로이고,n은 1 내지 3의 정수이며,m은 0 또는 1이고,L은 부존재하거나, 또는최소 하나의 브랜칭 유닛(branching unit, BR) 및 최소 하나의 커넥션 유닛(connection unit)을 함유하며,R1 및 R2는 각각 독립적으로 수소, (C1-C8)알킬 또는 (C3-C8)사이클로알킬이거나, 또는R1 및 R2는 이들이 부착된 탄소 원자와 함께 (C3-C8)사이클로알킬 환을 형성하며,상기 식에서 물결표시는 항체와 연결되는 부위,* 표시는 약물 또는 톡신과 연결되는 부위를 나타낸다.
- 제6항에 있어서,상기 당 또는 당산은 모노사카라이드인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제8항에 있어서,상기 R3는 수소이고, 각 R4는 수소인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,W는 -C(O)NR'-이고, 여기에서 C(O)가 페닐환과 연결되며, NR'은 Linker와 연결되는, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,Z는 수소이고, n은 3인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,R1 및 R2는 각각 수소인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,브랜칭 유닛은 1 내지 100개의 탄소 원자를 갖는 알킬렌이고,여기에서 알킬렌의 탄소 원자는 N, O 및 S로 이루어진 그룹으로부터 선택되는 하나 또는 그 이상의 헤테로원자로 치환될 수 있으며,여기에서 알킬렌은 1 내지 20개의 탄소원자를 갖는 하나 이상의 알킬로 더 치환될 수 있는, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,브랜칭 유닛은 친수성 아미노산(hydrophilic amino acid)인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제14항에 있어서,친수성 아미노산은 아르기닌, 아스파테이트, 아스파라긴, 글루타메이트, 글루타민, 히스티딘, 리신, 오르니틴, 프롤린, 세린, 및 트레오닌으로 이루어진 그룹으로부터 선택되는 것인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,브랜칭 유닛은 -C(O)-, -C(O)NR'-, -C(O)O-, -S(O)2NR'-, -P(O)R''NR'-, -S(O)NR'-, 또는 -PO2NR'-이고,여기에서 R' 및 R''은 각각 독립적으로 수소, (C1-C8)알킬, (C3-C8)사이클로알킬, (C1-C8)알콕시, (C1-C8)알킬티오, 모노- 또는 디-(C1-C8)알킬아미노, (C3-C20)헤테로아릴, 또는 (C6-C20)아릴인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,커넥션 유닛은 -(CH2)r(V(CH2)p)q- 이고,여기에서,r은 0 내지 10의 정수이며,p은 0 내지 12의 정수이고,q는 1 내지 20의 정수이며,V는 단일결합, -O- 또는 -S-인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,커넥션 유닛은 1 내지 12 -OCH2CH2-유닛인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,커넥션 유닛은 -(CH2CH2X)w-이고,여기에서 X는 단일 결합, -O-, (C1-C8)알킬렌, 또는 -NR21-이고;R21은 수소, (C1-C6)알킬, (C1-C6)알킬(C6-C20)아릴, 또는 (C1-C6)알킬(C3-C20)헤테로아릴이며,w는 1 내지 20의 정수인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,Linker는 1,3-dipolar cycloaddition 반응, hetero-Diels-Alder 반응, 친핵성 치환(nucleophilic substitution) 반응, 비-알돌형 카르보닐 반응, 탄소-탄소 다중 결합 첨가(addition to carbon-carbon multiple bond), 산화 반응 또는 클릭 반응에 의해 형성된 바인딩 유닛을 추가로 포함하는, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제21항에 있어서,바인딩 유닛은 아세틸렌 및 아자이드 사이의 반응, 또는 알데하이드 또는 케톤기 및 하이드라진 또는 알콕시아민 사이의 반응에 의해 형성되는, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제25항에 있어서,상기 이소프레닐 유닛은, 이소프레노이드 트랜스퍼라제의 기질 또는 생성물인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제25항에 있어서,Linker의 이소프레닐 유닛은 티오에테르 결합에 의해 항체와 공유결합하며, 티오에테르 결합은 항체의 시스테인의 황원자를 포함하는, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제6항에 있어서,상기 EGFRvIII에 결합하는 항체 또는 이의 항원 결합단편은,이소프레노이드 트랜스퍼라제에 의해 인식되는 아미노산 모티프를 포함하고,티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함하는, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제28항에 있어서,상기 아미노산 모티프는 CXX, CXC, XCXC, XXCC, 및 CYYX로 이루어진 그룹으로부터 선택되는 서열이고,여기에서 C는 시스테인을 나타내며;Y는 각 경우 독립적으로 지방족 아미노산을 나타내고;X는 각 경우 독립적으로 글루타민, 글루타메이트, 세린, 시스테인, 메티오닌, 알라닌, 또는 루신을 나타내며;티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함하는, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제1항에 있어서,Linker는,(a) 하나 이상의 브랜칭 유닛; (b) 하나 이상의 커넥션 유닛; (c) 하나 이상의 바인딩 유닛(binding unit, BU); 및 (d) 하나 이상의 트리거 유닛(trigger unit, TU)을 함유하는 것으로서,여기에서 커넥션 유닛은 트리거 유닛과 바인딩 유닛, 트리거 유닛과 브랜칭 유닛 또는 브랜칭 유닛과 바인딩 유닛을 연결하고,여기에서 하나 이상의 트리거 유닛은 하나 이상의 약물 또는 톡신을 방출할 수 있으며,여기에서 브랜칭 유닛은 커넥션 유닛과 트리거 유닛, 또는 커넥션 유닛을 또 다른 커넥션 유닛과 연결하는 것인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제30항에 있어서,트리거 유닛은 다음 화학식 (IIb)의 구조를 갖는 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물:화학식 (IIb)상기 식에서,G는 당(sugar), 당산(sugar acid), 또는 당 유도체(sugar derivatives)이고,W는 -C(O)-, -C(O)NR'-, -C(O)O-, -S(O)2NR'-, -P(O)R''NR'-, -S(O)NR'-, 또는 -PO2NR'-이며,C(O), S, 또는 P가 페닐환과 바로 연결되는 경우, R' 및 R''은 각각 독립적으로 수소, (C1-C8)알킬, (C3-C8)사이클로알킬, (C1-C8)알콕시, (C1-C8)알킬티오, 모노- 또는 디-(C1-C8)알킬아미노, (C3-C20)헤테로아릴, 또는 (C6-C20)아릴이고, W는 커넥션 유닛 또는 브랜칭 유닛과 연결되며,각 Z는 각각 독립적으로 수소, (C1-C8)알킬, 할로겐, 시아노 또는 니트로이고,n은 1 내지 3의 정수이며,m은 0 또는 1이고,R1 및 R2는 각각 독립적으로 수소, (C1-C8)알킬 또는 (C3-C8)사이클로알킬이거나, 또는R1 및 R2는 이들이 부착된 탄소 원자와 함께 (C3-C8)사이클로알킬 환을 형성한다.
- 제30항에 있어서,커넥션 유닛은 -(CH2)r(V(CH2)p)q-, -((CH2)pV)q-, -(CH2)r(V(CH2)p)qY-, -((CH2)pV)q(CH2)r-, -Y((CH2)pV)q- 또는 -(CH2)r(V(CH2)p)qYCH2-로 나타내지며,여기에서,r은 0 내지 10의 정수이고;p는 1 내지 10의 정수이며;q는 1 내지 20의 정수이고,V 및 Y는 각각 독립적으로 단일결합, -O-, -S-, -NR21-, -C(O)NR22-, -NR23C(O)-, -NR24SO2-, 또는 -SO2NR25-이고,R21 내지 R25는 각각 독립적으로 수소, (C1-C6)알킬, (C1-C6)알킬(C6-C20)아릴 또는 (C1-C6)알킬(C3-C20)헤테로아릴인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제30항에 있어서,브랜칭 유닛은,여기에서,L1, L2, 및 L3는 각각 독립적으로 직접 결합(direct bond) 또는 -CnH2n- 이고,여기에서 n은 1 내지 30의 정수이며,여기에서,여기에서 R3는 수소 또는 C1-C30알킬이며,여기에서 R4는 수소 또는 -L4-COOR5이고, 여기에서 L4는 직접 결합 또는 -CnH2n- 이고 여기에서 n은 1 내지 10의 정수이며, R5는 수소 또는 C1-C30알킬인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제1항에 있어서,D는 과증식, 암 또는 혈관신생질환의 예방 또는 치료제인 것인, 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물.
- 제1항 내지 제35항 중 어느 한 항에 따른 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물을 유효성분으로 함유하는,과증식, 암 또는 혈관신생질환의 예방 또는 치료용 약학적 조성물.
- 제37항에 있어서,불활성, 비-독성, 또는 약제학적으로 허용되는 부형제를 추가로 포함하는, 약학적 조성물.
- 제37항에 있어서,하나 이상의 항-과증식, 세포정지성 또는 세포독성 물질을 추가로 포함하는, 약학적 조성물.
- 제1항 내지 제35항 중 어느 한 항에 따른 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물을 과증식, 암 또는 혈관신생질환에 걸린 개체에 투여하는 단계를 포함하는 과증식, 암 또는 혈관신생질환 치료 방법.
- 제1항 내지 제35항 중 어느 한 항에 따른 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물을 개체에 투여하는 단계를 포함하는 과증식, 암 또는 혈관신생질환 예방 방법.
- 과증식, 암 또는 혈관신생질환을 치료하기 위한, 제1항 내지 제35항 중 어느 한 항에 따른 항체-약물 접합체 또는 이의 약학적으로 허용되는 염 또는 용매화물의 용도.
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR20170103096 | 2017-08-14 | ||
| KR10-2017-0103096 | 2017-08-14 | ||
| KR10-2018-0095186 | 2018-08-14 | ||
| KR1020180095186A KR20190018400A (ko) | 2017-08-14 | 2018-08-14 | EGFRvIII에 대한 항체를 포함하는 항체 약물 접합체 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019035649A1 true WO2019035649A1 (ko) | 2019-02-21 |
Family
ID=65362020
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2018/009362 Ceased WO2019035649A1 (ko) | 2017-08-14 | 2018-08-14 | EGFRvIII에 대한 항체를 포함하는 항체 약물 접합체 |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2019035649A1 (ko) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12247071B2 (en) | 2016-12-21 | 2025-03-11 | Amgen Inc. | Anti-TNF alpha antibody formulations |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050222059A1 (en) * | 2002-02-25 | 2005-10-06 | Tang Careen K | Egfrviii specific monoclonal antibody and egfrviii ribozymes and use to detect, treat or prevent egfrviii associated cancer |
| KR20140035393A (ko) * | 2011-05-08 | 2014-03-21 | 주식회사 레고켐 바이오사이언스 | 단백질-활성제 접합체 및 이의 제조 방법 |
| KR101531400B1 (ko) * | 2003-06-27 | 2015-06-26 | 암젠 프레몬트 인코포레이티드 | 상피 성장 인자 수용체의 결실 돌연변이체 지향 항체 및 그용도 |
| KR20150137015A (ko) * | 2014-05-28 | 2015-12-08 | 주식회사 레고켐 바이오사이언스 | 자가-희생 기를 포함하는 화합물 |
| WO2017089895A1 (en) * | 2015-11-25 | 2017-06-01 | Legochem Biosciences, Inc. | Antibody-drug conjugates comprising branched linkers and methods related thereto |
-
2018
- 2018-08-14 WO PCT/KR2018/009362 patent/WO2019035649A1/ko not_active Ceased
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050222059A1 (en) * | 2002-02-25 | 2005-10-06 | Tang Careen K | Egfrviii specific monoclonal antibody and egfrviii ribozymes and use to detect, treat or prevent egfrviii associated cancer |
| KR101531400B1 (ko) * | 2003-06-27 | 2015-06-26 | 암젠 프레몬트 인코포레이티드 | 상피 성장 인자 수용체의 결실 돌연변이체 지향 항체 및 그용도 |
| KR20140035393A (ko) * | 2011-05-08 | 2014-03-21 | 주식회사 레고켐 바이오사이언스 | 단백질-활성제 접합체 및 이의 제조 방법 |
| KR20150137015A (ko) * | 2014-05-28 | 2015-12-08 | 주식회사 레고켐 바이오사이언스 | 자가-희생 기를 포함하는 화합물 |
| WO2017089895A1 (en) * | 2015-11-25 | 2017-06-01 | Legochem Biosciences, Inc. | Antibody-drug conjugates comprising branched linkers and methods related thereto |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12247071B2 (en) | 2016-12-21 | 2025-03-11 | Amgen Inc. | Anti-TNF alpha antibody formulations |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2022211508A1 (ko) | 인간 cldn18.2에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도 | |
| WO2015182984A1 (ko) | 자가-희생 기를 포함하는 화합물 | |
| CN110088086B (zh) | 用于抗体-药物偶联的双取代马来酰胺类连接子及其制备方法和用途 | |
| US5475092A (en) | Cell binding agent conjugates of analogues and derivatives of CC-1065 | |
| WO2020180121A1 (ko) | 인간 dlk1에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도 | |
| TWI662968B (zh) | 配體-細胞毒性藥物偶聯物、其製備方法及其應用 | |
| WO2022245186A1 (ko) | Ror1 및 b7-h3에 결합하는 항체-약물 접합체 및 그 용도 | |
| JP2020143167A (ja) | β−グルクロニド−リンカー薬物結合体 | |
| CN110575547B (zh) | 靶向于tf的抗体-药物偶联物及其制法和用途 | |
| HUT61898A (en) | Process for producing conjugates of anthracyclines formed with carriers, as well as pharmaceutical compositions comprising same viscoelastic dentifrice | |
| KR20160009019A (ko) | 세포독성 및 유사분열-억제 화합물, 및 이를 사용하는 방법 | |
| WO2010126178A1 (ko) | 신규한 클로린 e6-엽산 결합 화합물, 이의 제조방법 및 이를 함유하는 암 치료용 약학적 조성물 | |
| KR102503143B1 (ko) | 인간 dlk1에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도 | |
| KR20190018400A (ko) | EGFRvIII에 대한 항체를 포함하는 항체 약물 접합체 | |
| WO2020141923A9 (ko) | 안전성이 향상된 피롤로벤조디아제핀 이량체 화합물 및 이의 용도 | |
| CN110575548A (zh) | 靶向于cd73的抗体-药物偶联物及其制法和用途 | |
| CN109810039B (zh) | 一种用于抗体-药物偶联的双取代马来酰胺类连接子及其制备方法和用途 | |
| WO2020222573A1 (ko) | 트리스 구조를 가지는 링커를 포함하는 리간드-약물 접합체 | |
| EP4429707B1 (en) | ANTHRACYCLINE-DERIVED BINDING REAGENTS, ANTIBODY-DRUG CONJUGATES AND PROCESSES | |
| WO2024005460A1 (ko) | 자가-희생기를 포함하는 화합물 및 이를 포함하는 리간드-약물 접합체 | |
| WO2019212253A1 (ko) | C-met에 특이적으로 결합하는 항체 및 그의 용도 | |
| WO2019035649A1 (ko) | EGFRvIII에 대한 항체를 포함하는 항체 약물 접합체 | |
| WO2022035262A1 (ko) | 세포내 종양 유발 단백질을 타겟하는 항체 또는 이의 단일가닥 가변 단편과 암세포 투과성 펩타이드의 융합 단백질 및 이의 용도 | |
| WO2023038368A1 (ko) | 방사선 및/또는 항암 치료 보조 요법으로 아데노신 디포스페이트 리보오스의 활용 | |
| WO2022031150A1 (ko) | 데옥시사이티딘계 항암제 및 실릴 에테르 함유 링커를 포함하는 접합체 및 이의 용도 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18846297 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 18846297 Country of ref document: EP Kind code of ref document: A1 |












































