WO2019034887A1 - HPV VACCINE - Google Patents

HPV VACCINE Download PDF

Info

Publication number
WO2019034887A1
WO2019034887A1 PCT/GB2018/052335 GB2018052335W WO2019034887A1 WO 2019034887 A1 WO2019034887 A1 WO 2019034887A1 GB 2018052335 W GB2018052335 W GB 2018052335W WO 2019034887 A1 WO2019034887 A1 WO 2019034887A1
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
conserved
seq
nucleic acid
polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2018/052335
Other languages
English (en)
French (fr)
Inventor
Lucy DORRELL
Joshua BLIGHT
Arturo Reyes-Sandoval
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Oxford University Innovation Ltd
Original Assignee
Oxford University Innovation Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA3072536A priority Critical patent/CA3072536A1/en
Priority to KR1020207006062A priority patent/KR102713224B1/ko
Priority to JP2020508007A priority patent/JP7551495B2/ja
Priority to AU2018316734A priority patent/AU2018316734B2/en
Priority to SG11202001244SA priority patent/SG11202001244SA/en
Priority to CN201880053063.XA priority patent/CN111212659B/zh
Application filed by Oxford University Innovation Ltd filed Critical Oxford University Innovation Ltd
Priority to US16/639,144 priority patent/US11179456B2/en
Priority to MX2020001655A priority patent/MX2020001655A/es
Priority to EP18759700.0A priority patent/EP3668542A1/en
Publication of WO2019034887A1 publication Critical patent/WO2019034887A1/en
Anticipated expiration legal-status Critical
Priority to US17/532,177 priority patent/US12064477B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10041Use of virus, viral particle or viral elements as a vector
    • C12N2710/10043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/20011Papillomaviridae
    • C12N2710/20022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/20011Papillomaviridae
    • C12N2710/20034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • This invention relates to viral-vectored vaccines for use in a vaccination against HPV infection.
  • Human papillomavirus infection is an infection by human papillomavirus (HPV). Most HPV infections cause no symptoms and resolve spontaneously. However, in some cases they persist and this can result in the development of warts or precancerous lesions.
  • the precancerous lesions increase the risk of cancer of the cervix, vulva, vagina, penis, anus, mouth, or throat.
  • HPV vaccines that have been developed for therapy of existing HPV infection include Inovio - VGX-3 100 (DNA encoding E6, E7) similarly Genexine (GX- 188E); Janssen - Ad26/Ad35 +/-MVA encoding E2, E6, E7 fusion protein; Synthetic long peptides (E6, E7) and similar eg. PepCan, GTL001 ; Advaxis - ADXS-HPV; and L. Monocytogenes encoding E7.
  • Inovio - VGX-3 100 DNA encoding E6, E7) similarly Genexine (GX- 188E); Janssen - Ad26/Ad35 +/-MVA encoding E2, E6, E7 fusion protein; Synthetic long peptides (E6, E7) and similar eg. PepCan, GTL001 ; Advaxis - ADXS-HPV; and L. Monocytogenes encoding E7.
  • such developed vaccines have been targeted to HP
  • an aim of the present invention is to provide an improved vaccine for HPV infection.
  • a nucleic acid encoding a polypeptide comprising a plurality of conserved peptide sequences, or variants thereof,
  • conserved sequences are conserved across one or more HPV genotypes 16, 18, 3 1 , 52, 53, and 58;
  • the polypeptide comprises a conserved peptide sequence of each of the HPV proteins E l , E2, E4, E5, E6, and E7.
  • the invention advantageously provides a novel alternative and safer approach to vaccination whereby T cells can be induced to the relatively conserved antigens of the virion.
  • the use of specially designed conserved viral segments from the non-structural proteins can provide protection against multiple important genotypes.
  • the polypeptide is a fusion polypeptide.
  • the polypeptide may not be a wild-type polypeptide.
  • the polypeptide may be synthetic/artificial, for example, the polypeptide may not exist in nature.
  • the polypeptide may not comprise a complete gene sequence.
  • the polypeptide may consist essentially of conserved peptide sequences.
  • the polypeptide may consist essentially of conserved peptide sequences and a peptide adjuvant sequence. In another embodiment, the polypeptide may consist essentially of conserved peptide sequences and one or more linkers therebetween. In another embodiment, the polypeptide may consist essentially of conserved peptide sequences, a peptide adjuvant sequence and one or more linkers therebetween. In one embodiment, the polypeptide is a recombinant polypeptide, such as a recombinant fusion polypeptide.
  • fusion polypeptide used herein is understood to mean a polypeptide comprising a combination of sequences derived from different gene products (for example different HPV proteins) or combinations of sequences from the same gene product (for example a single HPV protein), wherein the sequences are from distinct/separate regions of the wild-type gene product.
  • the fusion polypeptide may comprise combinations of sequences which are normally separated by other sequence segments in wild-type, and the separating sequence(s) have been removed.
  • conserved peptide sequence or “conserved segment” used herein is defined as a sequence that is conserved in one or more genotypes, as defined below.
  • inter-genotype conservation conserved intra-genotype windows at the same position across all genotypes were identified independent of the percentage identity of shared intra- genotype normalised consensus between genotypes (inter-genotype conservation).
  • a phylogeny was then created of the resultant regions and tree ingroup sequences combined to create an inter-genotype consensus with a high level of shared consensus identity.
  • 'inter-genotype consensus ' refers to a consensus created using the normalised consensus created from each genotype.
  • a 'modified variant' was created where conserved intra-genotype windows at the same position across all proteins were identified which shared greater than 60% shared intra- genotype normalised consensus percentage identity between genotypes.
  • inter-serotype fragments from tree ingroups had a percentage identity less than 60%, the sequences were classed as "highly divergent", in contrast to "less divergent” sequences used in the variant approach.
  • a 'chimeric' approach was used to identify conserved peptide sequences ( Figure IB); a phylogeny was created and only genotype ingroups were aligned together and intra-genotype conserved assessed. Therefore, inter-genotype conservation was only assessed between ingroups and intra-serotype conserved windows with greater than 60% shared consensus identity across genotypes selected. In some cases genotypes were run as 'chimerics' but inter-genotype conservation was not assessed ('chimeric-variants').
  • the plurality of conserved peptide sequences may comprise 10 or more conserved peptide sequences. In another embodiment, the plurality of conserved peptide sequences may comprise 15 or more conserved peptide sequences. In another embodiment, the plurality of conserved peptide sequences may comprise 20 or more conserved peptide sequences. In another embodiment, the plurality of conserved peptide sequences may comprise 25 or more conserved peptide sequences. In another embodiment, the plurality of conserved peptide sequences may comprise 30 or more conserved peptide sequences. The plurality of conserved sequences may comprise 35 or more conserved peptide sequences. In another embodiment, the plurality of conserved peptide sequences may comprise 40 or more conserved peptide sequences.
  • the plurality of conserved peptide sequences may comprise 45 or more conserved peptide sequences. In another embodiment, the plurality of conserved peptide sequences may comprise 50 or more conserved peptide sequences. In another embodiment, the plurality of conserved peptide sequences may comprise 55 or more conserved peptide sequences. In one embodiment, the plurality of conserved peptide sequences consists of about 56 or more conserved peptide sequences. In one embodiment, the plurality of conserved peptide sequences consists of about 57 or more conserved peptide sequences. In one embodiment, the plurality of conserved peptide sequences consists of about 58 or more conserved peptide sequences. In one embodiment, the plurality of conserved peptide sequences consists of about 59 or more conserved peptide sequences. In one embodiment, the plurality of conserved peptide sequences consists of about 59 conserved peptide sequences.
  • the encoded polypeptide may comprise at least 3 different conserved peptide sequences of each of the HPV proteins E l , E2, E4, E5, E6, and E7.
  • the encoded polypeptide may comprise at least 3 different conserved peptide sequences of HPV protein E l .
  • the encoded polypeptide may comprise at least 3 different conserved peptide sequences of HPV protein E2.
  • the encoded polypeptide may comprise at least 3 different conserved peptide sequences of HPV protein E4.
  • the encoded polypeptide may comprise at least 3 different conserved peptide sequences of HPV protein E5.
  • the encoded polypeptide may comprise at least 3 different conserved peptide sequences of HPV protein E6.
  • the encoded polypeptide may comprise at least 3 different conserved peptide sequences of HPV protein E7.
  • the encoded polypeptide may comprise at least 4 different conserved peptide sequences of HPV protein E l .
  • the encoded polypeptide may comprise at least 4 different conserved peptide sequences of HPV protein E2.
  • the encoded polypeptide may comprise at least 4 different conserved peptide sequences of HPV protein E4.
  • the encoded polypeptide may comprise at least 4 different conserved peptide sequences of HPV protein E6.
  • the encoded polypeptide may comprise at least 4 different conserved peptide sequences of HPV protein E7.
  • the encoded polypeptide may comprise at least 5 different conserved peptide sequences of HPV protein E l .
  • the encoded polypeptide may comprise at least 5 different conserved peptide sequences of HPV protein E2.
  • the encoded polypeptide may comprise at least 5 different conserved peptide sequences of HPV protein E4.
  • the encoded polypeptide may comprise at least 5 different conserved peptide sequences of HPV protein E6.
  • the encoded polypeptide may comprise at least 6 different conserved peptide sequences of HPV protein E l .
  • the encoded polypeptide may comprise at least 6 different conserved peptide sequences of HPV protein E2.
  • the encoded polypeptide may comprise at least 6 different conserved peptide sequences of HPV protein E4.
  • the encoded polypeptide may comprise at least 6 different conserved peptide sequences of HPV protein E6.
  • the encoded polypeptide may comprise at least 7 different conserved peptide sequences of HPV protein E l .
  • the encoded polypeptide may comprise at least 7 different conserved peptide sequences of HPV protein E2.
  • the encoded polypeptide may comprise at least 7 different conserved peptide sequences of HPV protein E4.
  • the encoded polypeptide may comprise at least 7 different conserved peptide sequences of HPV protein E6.
  • the encoded polypeptide may comprise at least 8 different conserved peptide sequences of HPV protein E l .
  • the encoded polypeptide may comprise at least 8 different conserved peptide sequences of HPV protein E2.
  • the encoded polypeptide may comprise at least 8 different conserved peptide sequences of HPV protein E4.
  • the encoded polypeptide may comprise at least 8 different conserved peptide sequences of HPV protein E6.
  • the encoded polypeptide may comprise at least 9 different conserved peptide sequences of HPV protein E l .
  • the encoded polypeptide may comprise at least 9 different conserved peptide sequences of HPV protein E2.
  • the encoded polypeptide may comprise at least 9 different conserved peptide sequences of HPV protein E4.
  • the encoded polypeptide may comprise at least 10 different conserved peptide sequences of HPV protein E l .
  • the encoded polypeptide may comprise at least 10 different conserved peptide sequences of HPV protein E2.
  • the encoded polypeptide may comprise at least 1 1 different conserved peptide sequences of HPV protein E l .
  • the encoded polypeptide may comprise at least 1 1 different conserved peptide sequences of HPV protein E2.
  • the encoded polypeptide may comprise at least 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, or 24 different conserved peptide sequences of HPV protein E2.
  • the encoded polypeptide may comprise or consist of 1 1 or more different conserved peptide sequences of HPV protein E l , 24 or more different conserved peptide sequences of HPV protein E2, 9 or more different conserved peptide sequences of HPV protein E4, 3 or more different conserved peptide sequences of HPV protein E5, 8 or more different conserved peptide sequences of HPV protein E6, and 4 or more different conserved peptide sequences of HPV protein E7.
  • the plurality of conserved peptide sequences may be derived from distinct regions of sequence relative to each other (i.e. not-naturally concurrent).
  • reference to "different conserved peptide sequences" may comprise sequences that are derived from distinct regions of wild-type sequence relative to each other (i.e. not-naturally concurrent).
  • the conserved sequences may be separated in the wild-type genotypes by variable/non-conserved sequences.
  • the plurality of conserved peptide sequences may not, or may not significantly, overlap with each other.
  • Two or more, or all, of the plurality of conserved peptide sequences may be directly joined together in the polypeptide, for example not comprising any non-conserved/variable residues therebetween.
  • the polypeptide sequence may not be found in nature .
  • the polypeptide may not comprise non-conserved sequences or residues.
  • the conserved peptide sequences may not be distanced apart by more than 1 ,
  • the conserved peptide sequences may not be distanced apart by more than 6, 7, 8, 9, or 10 residues in the polypeptide sequence, for example in embodiments where there are linker/junction residues between the conserved peptide sequences.
  • the polypeptide may not comprise non-conserved sequences longer than 2,
  • linker residues may be provided between one or more, or all, conserved peptide sequences (e.g. providing junctions between the conserved peptide sequences in the polypeptide).
  • the linker residues may comprise random amino acid sequences, or amino acids that have been selected to be non-immunogenic based on epitope prediction computer programs or experiments in animal models.
  • a linker may not be considered if it is predicted or known to be an epitope (i.e. in order to avoid an immune response to epitopes, e.g. artificial epitopes, not found in HPV.
  • the linker may be flexible .
  • the linker may comprise or consist of K, G, P, A or S amino acid residues, or combinations thereof.
  • the linker may comprise or consist of G and/or P amino acid residues. In one embodiment, the linker may comprise or consist of one or more alanine (A) amino acid residues.
  • the linker residues may be between 1 and 10 amino acids in length. In another embodiment, the linker residues may be between 2 and 8 residues in length. In another embodiment, the linker residues may be between 1 and 6 residues in length.
  • the conserved peptide sequences may be distanced apart by between 1 and 10 residues in the polypeptide sequence, for example in embodiments where there are linker/junction residues between the conserved peptide sequences.
  • the polypeptide may consist essentially of conserved peptide sequences and one or more linkers, optionally wherein the one or more linkers are disposed between adjacent conserved peptide sequence .
  • the conserved peptide sequences may be selected from any of the group comprising SEQ ID NOs: 1 to 59; variants thereof or combinations thereof.
  • the conserved peptide sequences may be selected from any of the group comprising SEQ ID NOs : 1 to 59; variants thereof or combinations thereof, in any order.
  • the conserved peptide sequences may consist of the group comprising SEQ ID NOs: 1 to 59.
  • the polypeptide may comprise one or more conserved E l sequence(s) selected from any one of SEQ ID NOs : 1 - 1 1 ; one or more conserved E2 sequence(s) selected from any one of SEQ ID NOs : 12-35 ; one or more conserved E4 sequence(s) selected from any one of SEQ ID NOs : 36-44; one or more conserved E5 sequence(s) selected from any one of SEQ ID NOs : 45-47; one or more conserved E6 sequence(s) selected from any one of SEQ ID NOs : 48-55 ; and one or more conserved E7 sequence(s) selected from any one of SEQ ID NOs: 56-59.
  • the polypeptide may comprise two or more conserved E l sequence(s) selected from any of SEQ ID NOs : 1 - 1 1 ; two or more conserved E2 sequence(s) selected from any of SEQ ID NOs : 12-35 ; two or more conserved E4 sequence(s) selected from any of SEQ ID NOs : 36-44; two or more conserved E5 sequence(s) selected from any of SEQ ID NOs: 45-47; two or more conserved E6 sequence(s) selected from any of SEQ ID NOs: 48-55 ; and two or more conserved E7 sequence(s) selected from any of SEQ ID NOs: 56-59.
  • the polypeptide may comprise three or more conserved E l sequence(s) selected from any of SEQ ID NOs : 1 - 1 1 ; three or more conserved E2 sequence(s) selected from any of SEQ ID NOs : 12-35 ; three or more conserved E4 sequence(s) selected from any of SEQ ID NOs: 36-44; three or more conserved E5 sequence(s) selected from any of SEQ ID NOs: 45-47; three or more conserved E6 sequence(s) selected from any of SEQ ID NOs: 48-55 ; and three or more conserved E7 sequence(s) selected from any of SEQ ID NOs: 56-59.
  • the conserved sequences are conserved across one or more of HPV genotypes 16, 18, 31, 52, and 58.
  • the conserved sequences are conserved across all of HPV genotypes 16, 18, 31, 52, and 58.
  • the polypeptide may comprise:
  • conserved El sequence(s) selected from any one of SEQ ID NOs: 1-11, wherein each of the genotypes 16, 18, 31, 52, 53, and 58 are represented by at least one conserved El sequence;
  • conserved E2 sequence(s) selected from any one of SEQ ID NOs: 12-35, wherein each of the genotypes 16, 18, 31, 52, 53, and 58 are represented by at least one conserved E2 sequence;
  • conserved E4 sequence(s) selected from any one of SEQ ID NOs: 36-44, wherein each of the genotypes 16, 18, 31, 52, 53, and 58 are represented by at least one conserved E4 sequence;
  • each of the genotypes 16, 18, 31, 52, 53, and 58 are represented by at least one conserved E5 sequence;
  • conserved E6 sequence(s) selected from any one of SEQ ID NOs: 48-55, wherein each of the genotypes 16, 18, 31, 52, 53, and 58 are represented by at least one conserved E6 sequence;
  • the polypeptide may comprise:
  • conserved El sequence(s) selected from any one of SEQ ID NOs: 1-11, wherein each of the genotypes 16, 18, 31, 52, and 58 are represented by at least one conserved El sequence;
  • conserved E2 sequence(s) selected from any one of SEQ ID NOs: 12-35, wherein each of the genotypes 16, 18, 31, 52, and 58 are represented by at least one conserved E2 sequence;
  • conserved E6 sequence(s) selected from any one of SEQ ID NOs : 48-55, wherein each of the genotypes 16, 18, 3 1 , 52, and 58 are represented by at least one conserved E6 sequence;
  • conserved E7 sequence(s) selected from any one of SEQ ID NOs : 56-59, wherein each of the genotypes 16, 18, 3 1 , 52, and 58 are represented by at least one conserved E7 sequence .
  • the polypeptide may comprise :
  • each of the genotypes 16, 18, 3 1 , 52, 53, and 58 are represented in the group of conserved E2 sequences;
  • the polypeptide may comprise :
  • each of the genotypes 16, 18, 3 1 , 52, and 58 are represented in the group of conserved E6 sequences;
  • the polypeptide may comprise :
  • each of the genotypes 16, 18, 3 1 , 52, 53, and 58 are represented in the group of conserved E6 sequences;
  • the polypeptide may comprise :
  • each of the genotypes 16, 18, 3 1 , 52, and 58 are represented in the group of conserved E2 sequences;
  • each of the genotypes 16, 18, 3 1 , 52, 53, and 58 are represented or "each of the genotypes 16, 18, 3 1, 52, and 58 are represented” is intended to mean that each of the identified genotypes has been used to define at least one consensus sequence of a conserved peptide sequence. Therefore, a given group may comprise a conserved peptide from each genotype, or a conserved peptide may be derived from a consensus of two or more genotypes.
  • genotypes 16, 18, 3 1 , 52, 53, and 58 or 16, 18, 3 1 , 52, and 58 could be represented by a single conserved peptide sequence, which may be a consensus of all the genotypes 16, 18, 3 1, 52, 53, and 58 or 16, 18, 31 , 52, and 58 respectively.
  • a single conserved peptide may not be able to represent a consensus sequence from all genotypes 16, 18, 3 1 , 52, 53, and 58 or 16, 18, 3 1 , 52, and 58 and instead two or more conserved peptide sequences are required to cover/represent all the genotypes 16, 18, 3 1 , 52, 53, and 58 or 16, 18, 3 1 , 52, and 58.
  • one conserved E6 peptide sequence may represent E6 genotypes 16 and 18, another may represent E6 genotype 52, and a third may represent E6 genotypes 53 and 58, such that all three conserved E6 peptide sequences in a group represent all E6 genotypes 16, 18, 3 1 , 52, 53, and 58 or 16, 18, 3 1 , 52, and 58.
  • the nucleic acid may comprise or consist of the sequence of SEQ ID NO: 60, or variants thereof. In another embodiment, the nucleic acid may comprise or consist of the sequence of SEQ ID NO: 60, or variants thereof, and without encoding the TPA lead sequence.
  • the nucleic acid may comprise or consist of the sequence of SEQ ID NO: 60, or variants thereof, with a different/alternative peptide adjuvant encoded than the TPA lead sequence .
  • the nucleic acid may comprise or consist of the sequence of SEQ ID NO : 65, or variants thereof.
  • Variants of the nucleic acid may comprise or consist of a sequence having at least 80% identity with SEQ ID NO: 60 or 65. Alternatively, variants of the nucleic acid may comprise or consist of a sequence having at least 85% identity with SEQ ID NO : 60 or 65. Variants of the nucleic acid may comprise or consist of a sequence having at least 90% identity with SEQ ID NO: 60 or 65. Variants of the nucleic acid may comprise or consist of a sequence having at least 95% identity with SEQ ID NO: 60 or 65. Variants of the nucleic acid may comprise or consist of a sequence having at least 98% identity with SEQ ID NO: 60 or 65.
  • Variants of the nucleic acid may comprise or consist of a sequence having at least 99% identity with SEQ ID NO: 60 or 65.
  • a variant of the nucleic acid may include redundant codon variants that encode the same peptide as SEQ ID NO: 60 or 65.
  • the nucleic acid may comprise or consist of the sequence of SEQ ID NO: 62, or variants thereof.
  • the nucleic acid may comprise or consist of the sequence of SEQ ID NO: 62, or variants thereof, and without encoding the TPA lead sequence.
  • the nucleic acid may comprise or consist of the sequence of SEQ ID NO: 62, or variants thereof, with a different/alternative peptide adjuvant encoded than the TPA lead sequence .
  • Variants of the nucleic acid may comprise or consist of a sequence having at least 80% identity with SEQ ID NO: 62. Alternatively, variants of the nucleic acid may comprise or consist of a sequence having at least 85% identity with SEQ ID NO: 62. Variants of the nucleic acid may comprise or consist of a sequence having at least 90% identity with SEQ ID NO: 62. Variants of the nucleic acid may comprise or consist of a sequence having at least 95% identity with SEQ ID NO: 62. Variants of the nucleic acid may comprise or consist of a sequence having at least 98% identity with SEQ ID NO : 62. Variants of the nucleic acid may comprise or consist of a sequence having at least 99% identity with SEQ ID NO: 62.
  • Variants of the nucleic acid may comprise or consist of a sequence having at least 99.5% identity with SEQ ID NO: 62. Variants of the nucleic acid may comprise or consist of a sequence having at least 99.9% identity with SEQ ID NO: 62.
  • a variant of the nucleic acid may include redundant codon variants that encode the same viral vector and/or peptide as SEQ ID NO: 62.
  • the nucleic acid may comprise or consist of the sequence of SEQ ID NO: 71 , 73 or 75, or variants thereof. In another embodiment, the nucleic acid may comprise or consist of the sequence of SEQ ID NO: 71 , 73 or 75, or variants thereof, and without encoding the TPA lead sequence. In another embodiment, the nucleic acid may comprise or consist of the sequence of SEQ ID NO: 71 , 73 or 75, or variants thereof, with a different/alternative peptide adjuvant encoded than the TPA lead sequence .
  • Variants of the nucleic acid may comprise or consist of a sequence having at least 80% identity with SEQ ID NO: 71 , 73 or 75. Alternatively, variants of the nucleic acid may comprise or consist of a sequence having at least 85% identity with SEQ ID NO : 71 , 73 or 75. Variants of the nucleic acid may comprise or consist of a sequence having at least 90% identity with SEQ ID NO : 71 , 73 or 75. Variants of the nucleic acid may comprise or consist of a sequence having at least 95% identity with SEQ ID NO: 71 , 73 or 75. Variants of the nucleic acid may comprise or consist of a sequence having at least 98% identity with SEQ ID NO : 71 , 73 or 75.
  • Variants of the nucleic acid may comprise or consist of a sequence having at least 99% identity with SEQ ID NO: 71 , 73 or 75. Variants of the nucleic acid may comprise or consist of a sequence having at least 99.5% identity with SEQ ID NO: 71 , 73 or 75. Variants of the nucleic acid may comprise or consist of a sequence having at least 99.9% identity with SEQ ID NO: 71 , 73 or 75.
  • a variant of the nucleic acid may include redundant codon variants that encode the same viral vector and/or peptide as SEQ ID NO: 71 , 73 or 75.
  • the polypeptide may comprise or consist of the sequence of SEQ ID NO: 61 , or variants thereof.
  • polypeptide may comprise or consist of the sequence of SEQ ID NO: 61 , or variants thereof, and without the TPA lead sequence .
  • polypeptide may comprise or consist of the sequence of SEQ ID NO: 61 , or variants thereof, with a different/alternative peptide adjuvant than the TPA lead sequence.
  • polypeptide may comprise or consist of the sequence of SEQ ID NO: 66, or variants thereof.
  • the polypeptide may comprise or consist of the sequence of SEQ ID NO: 72, 74 or 76, or variants thereof. In another embodiment, the polypeptide may comprise or consist of the sequence of SEQ ID NO : 72, 74 or 76, or variants thereof, and without the TPA lead sequence . In another embodiment, the polypeptide may comprise or consist of the sequence of SEQ ID NO: 72, 74 or 76, or variants thereof, with a different/alternative peptide adjuvant than the TPA lead sequence . In another embodiment, the polypeptide may comprise or consist of the sequence of SEQ ID NO: 72, 74 or 76, or variants thereof.
  • the polypeptide may consist essentially of conserved peptide sequences and a peptide adjuvant. In one embodiment, the polypeptide may consist essentially of conserved peptide sequences, one or more linkers, and a peptide adjuvant. The one or more linkers may be disposed between adjacent conserved peptide sequence. The peptide adjuvant may be N-terminal.
  • Variants of the polypeptide may comprise or consist of a sequence having at least 80% identity with SEQ ID NO: 61 , 66, 72, 74 or 76. Alternatively, variants of the polypeptide may comprise or consist of a sequence having at least 85% identity with SEQ ID NO: 61 , 66, 72, 74 or 76. Variants of the polypeptide may comprise or consist of a sequence having at least 90% identity with SEQ ID NO: 61 , 66, 72, 74 or 76. Variants of the polypeptide may comprise or consist of a sequence having at least 95% identity with SEQ ID NO: 61 , 66, 72, 74 or 76.
  • Variants of the polypeptide may comprise or consist of a sequence having at least 98% identity with SEQ ID NO: 61 , 66, 72, 74 or 76. Variants of the polypeptide may comprise or consist of a sequence having at least 99% identity with SEQ ID NO: 61 , 66, 72, 74 or 76. Variants of conserved peptide sequences may comprise or consist of a truncated sequence of the conserved peptide sequences. For example, any one or more of the sequences of SEQ ID NOs : 1 to 59, herein may be truncated and still provide immunogenicity in the polypeptide.
  • the truncated sequence may comprise a sufficient number of amino acids to form a recognisable epitope (e.g. at least the minimum number of residues for specific T cell recognition) from a sequence within any one of the sequences of SEQ ID NOs: 1 to 59.
  • the truncated sequence may comprise at least 7 amino acids of the sequences of SEQ ID NOs : 1 to 59.
  • the truncated sequence may comprise at least 8 amino acids of the sequences of SEQ ID NOs: 1 to 59.
  • the truncated sequence may comprise at least 9, 10, 1 1 or 12 amino acids of the sequences of SEQ ID NOs: 1 to 59.
  • Multiple truncated sequences may be provided within one of the conserved peptide sequences of SEQ ID NOs: 1 to 59.
  • any one of the conserved peptide sequences of SEQ ID NOs: 1 to 59 may be varied, for example by residue substitution, addition or deletion.
  • some or all of the conserved peptide sequences of SEQ ID NOs: 1 to 59 may be varied, for example by residue substitution, addition or deletion.
  • the variant conserved peptide sequences may still function to provide recognisable HPV epitopes. The skilled person will understand that natural variation exists in any given population and that these variants may have some sequence variation with the consensus sequence, or example patient sequences provided in SEQ ID NOs: 1 to 59. Therefore, a variant conserved peptide sequence may have at least 70% sequence identity with any one of SEQ ID NOs: 1 to 59.
  • a variant conserved peptide sequence may have at least 74% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 75% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 79% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 80% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 82% sequence identity with any one of SEQ ID NOs: 1 to 59.
  • a variant conserved peptide sequence may have at least 83% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 85% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 88% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 90% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 92% sequence identity with any one of SEQ ID NOs: 1 to 59.
  • a variant conserved peptide sequence may have at least 95% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 98% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 99% sequence identity with any one of SEQ ID NOs: 1 to 59. In another embodiment, a variant conserved peptide sequence may have at least 99.5% sequence identity with any one of SEQ ID NOs: 1 to 59.
  • sequence identity used herein may refer to the percentage identity between two aligned sequences using standard NCBI BLASTp parameters (http://blast.ncbi.nlm.nih.gov).
  • the conserved peptide sequences may vary in length, with the minimum length being defined as the minimum number of residues required to form a recognisable epitope. Therefore, the conserved peptide sequence may be from about 7 to 250 amino acids in length, or more .
  • at least one conserved peptide sequence may be at least about 7 amino acids in length.
  • at least one conserved peptide sequence may be at least about 8 amino acids in length.
  • at least one conserved peptide sequence may be at least about 10 amino acids in length.
  • at least one conserved peptide sequence may be at least about 15 amino acids in length.
  • at least one conserved peptide sequence may be at least about 20 amino acids in length.
  • At least one conserved peptide sequence may be at least about 30 amino acids in length. In one embodiment, at least one conserved peptide sequence may be between about 20 and about 220 amino acids in length. In one embodiment, at least one conserved peptide sequence may be no more than about 300 amino acids in length. In another embodiment, at least one conserved peptide sequence may be no more than about 250 amino acids in length. In another embodiment, at least one conserved peptide sequence may be no more than about 200 amino acids in length. In another embodiment, at least one conserved peptide sequence may be no more than about 150 amino acids in length. In another embodiment, at least one conserved peptide sequence may be no more than about 100 amino acids in length. In another embodiment, at least one conserved peptide sequence may be no more than about 55 amino acids in length. In another embodiment, at least one conserved peptide sequence may be no more than about 54 amino acids in length.
  • the conserved peptide sequences may be an average length of between about 15 and about 50 amino acids in a population of conserved peptide sequences.
  • the polypeptide may further comprise a peptide adjuvant, such as a TPA (tissue plasminogen activator) sequence, or functional variants thereof.
  • TPA tissue plasminogen activator
  • the TPA may comprise or consist of the sequence : MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRR (SEQ ID NO: 63), or a functional variant thereof.
  • the peptide adjuvant may comprise a Shark invariant chain, for example of the sequence
  • SLLWGGVTVLAAMLIAGQVASSVVFLV (SEQ ID NO: 64), or a functional variant thereof.
  • the peptide adjuvant may be N-terminal on the polypeptide of the invention.
  • a functional variant of a peptide adjuvant may be a truncated or mutated peptide variant, which can still function as an adjuvant, for example a truncated or mutated variant of the TPA or shark invariant chain, which still function as an adjuvant.
  • 1 , 2, 3, 4, 5 or more amino acid residues may be substituted, added or removed without affecting function. For example, conservative substitutions may be considered.
  • a linker sequence provided (or encoded) between the peptide adjuvant and the first conserved peptide sequence.
  • the first linker sequence may not be provided.
  • nucleic acids may encode different polypeptides according to the invention may be provided as a vaccine .
  • a prime and/or boost vaccine formulation may comprise nucleic acid or viral vector encoding two or more polypeptides of the invention, which may be different relative to each other.
  • the nucleic acid may be used in a vaccine in combination with another therapeutically or prophylactically active ingredient.
  • the nucleic acid may be used in a vaccine in combination with an adjuvant.
  • a composition comprising a plurality of different nucleic acids according to the invention, optionally wherein the composition is a pharmaceutically acceptable composition.
  • polypeptide is an isolated polypeptide.
  • the polypeptide, nucleic acid encoding the polypeptide, or associated viral particle may be provided in a pharmaceutically acceptable carrier.
  • the nucleic acid may be a plasmid vector for vaccination.
  • the nucleic acid may comprise viral vector sequences.
  • a viral vector comprising the nucleic acid according to the invention herein.
  • the viral vector may comprise a virus.
  • the viral vector may comprise an adenovirus, such as a human or simian adenovirus.
  • the viral vector may comprise an adenovirus when used in a prime vaccine of a prime boost regime.
  • the viral vector may comprise ChAdOxl (a group E simian adenovirus, like the AdCh63 vector used safely in malaria trials) or ChAdOx2 (as described in Morris et al 2016. Future Virol 1 1 (9), pp. 649-659).
  • the ChAdOx2 sequence may comprise or consist of the sequence described herein (e.g. SEQ ID NOs: 67+68).
  • the viral vector may comprise AdCh63.
  • the viral vector may comprise AdC3 or AdH6.
  • the viral vector may be a human serotype.
  • the viral vector may comprise Modified Vaccinia Ankara (MVA).
  • the viral vector may comprise F l 1 MVA (e.g. MVA with the nucleic acid construct insert at the F l 1 locus).
  • the nucleic acid of the invention (the HPV vaccine construct insert) may be inserted at the TK locus of parental MVA virus under the control of the p7.5 promoter, for example through recombination with the p7.5 MVA shuttle plasmid (SEQ ID NO : 158).
  • the nucleic acid may comprise the sequence of SEQ ID NO : 158 with the nucleic acid vaccine construct insert as provided in SEQ ID NO: 158 (underlined), or with an alternative nucleic acid vaccine construct in accordance with the invention herein.
  • the nucleic acid of the invention (the HPV vaccine construct insert) may be inserted at the F l l locus of parental MVA virus under the control of the F l l promoter, for example through recombination with the F l l shuttle plasmid (SEQ ID NO: 159).
  • the nucleic acid may comprise the sequence of SEQ ID NO: 159 with the nucleic acid vaccine construct insert as provided in SEQ ID NO: 159 (underlined), or with an alternative nucleic acid vaccine construct in accordance with the invention herein.
  • the MVA sequence may comprise or consist of the sequence described herein (e.g. SEQ ID NOs: 69+70).
  • the viral vector may comprise MVA when used as a vaccine boost in a prime boost regime.
  • the viral vector may comprise Adeno-associated virus (AAV) or lentivirus.
  • the viral vector may be an attenuated viral vector.
  • the polypeptide sequence of the invention may be cloned into any suitable viral vector that is known to elicit good immune response.
  • Suitable viral vectors have been described in Dicks et al (Vaccine. 2015 Feb 25;33(9): 1121-8. doi: 10.1016/j .vaccine.2015.01.042. Epub 2015 Jan 25), Antrobus et al (Mol Ther. 2014 Mar;22(3):668-74. doi: 10.1038/mt.2013.284. Epub 2013 Dec 30.), and (Warimwe et al. (Virol J. 2013 Dec 5; 10:349. doi: 10.1186/1743-422X-10-349), which are incorporated herein by reference.
  • composition comprising one or more of:
  • the composition may be immunogenic, for example in a mammal, such as a human.
  • the composition may comprise a pharmaceutically acceptable carrier.
  • the composition may be a pharmaceutical composition comprising a pharmaceutically acceptable carrier.
  • the composition may be for use in the prophylaxis or treatment of HPV infection.
  • the method of treatment or prophylaxis of HPV infection may be a method of vaccination.
  • an agent for use in the prophylaxis or treatment of HPV infection comprising or consisting of:
  • the treatment or prophylaxis of HPV infection comprises the treatment or prophylaxis of an anogenital HPV-driven lesion, such as anal, vulval, vaginal, or penile intraepithelial neoplasia. Additionally or alternatively, the treatment or prophylaxis of HPV infection comprises the treatment or prophylaxis of an oropharyngeal lesion that is caused by HPV.
  • polypeptide according to the invention there is provided the polypeptide according to the invention; the composition according to the invention; the nucleic acid according to the invention; or the viral vector according to the invention; for use in, or as, a vaccine.
  • a vaccine comprising the nucleic acid of the invention; the polypeptide according to the invention; the composition according to the invention; or the viral vector according to the invention.
  • the vaccine may be a prime vaccine.
  • the vaccine may be a boost vaccine .
  • the polypeptide may be different.
  • the polypeptide may comprise a re-ordered sequence of conserved peptide sequences.
  • the conserved peptide sequences may be identical, but the order in which they are provided in the polypeptide may be changed. Therefore, the invention herein provides any of the sequences/embodiments of the invention wherein the order in which conserved peptide sequences are provided may be changed.
  • Such embodiments may also include re-ordered or differed linker/junction sequences.
  • the re-ordering of the conserved peptide sequences of the polypeptide between prime and boost vaccines can avoid the provision of "false" epitopes formed across junctions of one conserved peptide sequence with another conserved peptide sequence, i.e. the same junction may not occur in the re-ordered polypeptide.
  • a nucleic acid or polypeptide according to the invention for use in, or as, a vaccine.
  • a prime boost vaccination kit comprising
  • the prime and boost vaccinations may be different.
  • the prime and boost vaccination may differ in the polypeptide sequence.
  • the prime and boost vaccination may comprise different viral vectors (i.e. from different virus families such as MVA vs adenovirus).
  • composition comprising a nucleic acid according to the invention herein, and a pharmaceutically acceptable carrier.
  • the composition may not comprise wild-type HPV.
  • the composition may not comprise full length HPV protein sequence.
  • the viral vector or nucleic acid may not encode non-conserved protein/peptide sequence of HPV.
  • the use may be with a pharmaceutically acceptable carrier. Additionally or alternatively, the use may be with an adjuvant.
  • immunogenic when applied to the nucleic acid, polypeptide or composition of the present invention means capable of eliciting an immune response in a human or animal body.
  • the immune response may be protective .
  • protecting means prevention of a disease, a reduced risk of disease infection, transmission and/or progression, reduced severity of disease, a cure of a condition or disease, an alleviation of symptoms, or a reduction in severity of a disease or disease symptoms.
  • the term “prophylaxis” means prevention of or protective treatment for a disease .
  • the prophylaxis may include a reduced risk of disease infection, transmission and/or progression, or reduced severity of disease .
  • treatment means a cure of a condition or disease, an alleviation of symptoms, or a reduction in severity of a disease or disease symptoms.
  • Figure 3 A) Regions identified as conserved in the two genotypes used to form chimerics. B) Conservation plot of Modified variant.
  • Figure 5 Regions identified as conserved in the two genotypes used to form chimerics
  • Figure 6 Regions identified as conserved in the two genotypes used to form chimeric-variants
  • Figure 7 Regions identified as conserved in the two genotypes used to form chimeric
  • Figure 8 High frequencies of vaccine-specific T cells are induced following prime boost vaccination.
  • IFNy Elispot performed on PBMCs from C57BL/6 mice (six/group) primed intramuscularly with DNA-HPV, MVA-HPV or ChAdOxl -5GHPV3 and then boosted intramuscularly with a heterologous or homologous vaccine two weeks later.
  • PBMCs were collected by tail vein bleed two weeks post prime and one and two weeks post boost.
  • Figure 9 Prime boost vaccination is capable of inducing responses to all antigens encoded in the immunogen.
  • PBMCs were collected at two weeks boost and used in an IFNy Elispot with peptides spanning the entire immunogen sequence, pooled according to protein source. Peptides spanning the E2 region of the immunogen were split into two pools because of the large number of peptides and peptides for regions spanning E4 and E5 were combined into one pool.
  • Figure 10 - Vaccine-specific CD8+ T cells can be detected at high frequencies six weeks after ChAdOxl-5GHPV3 prime MVA-5GHPV3 boost.
  • 10b ICS performed on PBMCs obtained one week and six weeks post ChAdOxl - 5GHPV3 prime, MVA-5GHPV3 boost.
  • PBMCs stimulated with E6 and E7 peptide pools. Measured IFN- ⁇ , CD 107, TNF-a and IL2.
  • FIG 11 - HPV E6- and E7-specific CD8+ T cell responses are polyfunctional and have cytotoxic potential.
  • PBMCs from a tail vein bleed collected one week post ChAdOxl -5GHPV3 prime MVA-5GHPV3 boost were stimulated with immunodominant peptide pools E6 and E7 and sub pool 22 which is the dominant sub pool within E6.
  • Responding CD8+ T cells predominantly express three functions (CD 107, IFNy and TNFa) .
  • FIG 12 ChAdOxl-5GHPV3 prime MVA-5GHPV3 boost also primes HPV E6- and E7-specific CD4+ T cell responses that are still detectable six weeks post boost.
  • ICS performed on PBMCs obtained one week and six weeks post ChAdOxl -5GHPV3 prime, MVA-5GHPV3 boost.
  • PBMCs stimulated with E6 and E7 peptide pools. Measured IFN- ⁇ , CD 107, TNF-a and IL2.
  • Figure 13 Most E6 and E7-specific CD4+ T cells express two functions.
  • FIG. 14 HPV E6- and E7-specific CD8+ T cells can be detected in the cervix.
  • ICS was performed on cervicovaginal lymphocytes isolated from mice two weeks post ChAdOxl -5GHPV3 prime MVA-5GHPV3 boost and stimulated with immunodominant peptide pools E6 and E7 and sub pool 22. Measured
  • IFN- ⁇ IFN- ⁇ , CD 107, TNF-a and IL2.
  • FIG 15 Cervicovaginal HPV E6- and E7-specific CD8+ T cell responses are polyfunctional. Cervicovaginal lymphocytes collected one week post ChAdOxl -5GHPV3 prime MVA-5GHPV3 boost were stimulated with immunodominant peptide pools E6 and E7 and sub pool 22 which is the dominant sub pool within E6. Responding CD8+ T cells predominantly express three functions (CD 107, IFNy and TNFa) .
  • Figure 16 - Vaccine-induced E6 and E7-specific CD8+ and CD4+ T cells in the cervix are almost exclusively of effector phenotype. Naive: CD44- CD62L+.
  • FIG. 18 Mice vaccinated with ChAdOxl-5GHPV3 prime, MVA- 5GHPV3 boost show increased survival over control mice. Mice were inoculated with 5xl 0 4 TC- 1 cells on day 0 and then primed on day 3 and boosted on day 17. Tumours were measured with digital callipers every two days and mice culled when tumours reached 10mm in any one direction.
  • FIG 19 - Vaccination of outbred CD1 mice induces high frequency T cell responses.
  • IFNy Elispot performed on PBMCs from CD 1 mice (ten/group) primed intramuscularly with DNA-5GHPV3, MVA-5GHPV3 or ChAdOxl - 5GHPV3 and then boosted intramuscularly with a heterologous or homologous vaccine two weeks later.
  • PBMCs were collected by tail vein bleed two weeks post prime and two and three weeks post boost.
  • FIG. 20 T cell responses in vaccinated CD1 mice are directed across the entire immunogen.
  • PBMCs were collected at two weeks boost and used in an IFNy Elispot with peptides spanning the entire immunogen sequence, pooled according to protein source.
  • Peptides spanning the E2 region of the immunogen were split into two pools because of the large number of peptides and peptides for regions spanning E4 and E5 were combined into one pool.
  • FIG. 21 - Top panel Peripheral blood mononuclear cells (PBMC) from 76 women aged 16-24 years were tested for recognition of peptides based on early proteins from high risk HPV (hrHPV) in ex vivo IFN- ⁇ Elispot assays.
  • PBMC Peripheral blood mononuclear cells
  • hrHPV high risk HPV
  • 'Insert' is a pool of 15-mer peptides overlapping by 11 amino acid spanning the hrHPV transgene.
  • 'Reference' peptides were pools of peptides based on early proteins from HPV16 and HPV52, which were combined as follows: E1/E2, E4/E5 and E6/E7.
  • FIG 22 Subpool mapping in C57BL/6 mice (top panel) and CD1 mice (bottom panel) following ChAdOXl-5G-HPV3 prime MVA-5GHPV3 boost. Mice were culled two weeks post boost and splenocytes isolated. Splenocytes used in an IFNy Elispot assay using subpools that cover the immunogen sequence. Subpools 21, 25 and 26 (for example) contain no HPV53 sequences and still get high magnitude responses, thus providing evidence that a sequence without the HPV53 segments would still be immunogenic.
  • the HPV immunogen is composed of amino acid fragments conserved and geographically representative of the global HPV population at a protein level. Each fragment is created using a conservation algorithm which has been utilised to create either Chimeric or Variant based fragments. The choice being dependent on characteristics of each HPV protein used.
  • the core conservation algorithm uses a sliding window approach in combination with a normalisation method that accounts for collection bias to identify windows which are conserved both within (intra-genotype) and between (inter-genotype) genotypes.
  • Intra-genotype conserved windows are classed as windows with a conservation value less than one quartile of the sum of all window conservation values for the whole sequence .
  • a normalised representative consensus sequence is created for each genotype during this process.
  • inter-genotype windows are identified as windows at the same position in each genotype which are conserved and have a shared consensus identity of > 60%.
  • a key challenge in creating sequences which represent all the selected genotypes for a region of each protein was that many genotypes showed unique phylogenetic clustering.
  • a phylogeny was created from the resultant regions and ingroup sequences combined to create a consensus with a high level of shared consensus identity (Fig lb), (ii) Chimerics; in some instances the distance between genotypes is so significant that genotypes do not align suitably. Therefore, only genotype ingroups are inputted together into the algorithm, and regions conserved between ingroups with > 60% shared consensus identity are identified (Fig la).
  • Candidate sequences were created for six HPV proteins (E l -2, E4-7) using input sequences collected from the NCBI protein database, aligned and manually audited to remove incomplete and poor quality sequences (Table 1).
  • DENENDSDTGEDMVDFIDN (SEQ ID NO: 2) El VI 53: DETDEESTESDLDGFIDNS (SEQ ID NO: 3)
  • E l_V3_52+58+ 18+16 AQLADVNSNAAAFLK (SEQ ID NO: 5)
  • NCILLYGAANTGKSLFGMSL (SEQ ID NO: 6) El_V4_18+52+58:
  • NCLVLCGPANTGKSYFGMSL (SEQ ID NO: 7)
  • NCLVIYGPPNTGKSCFAMSL SEQ ID NO: 8
  • E1 V5 18+58 WPYLESRITVFEFPNAF (SEQ ID NO: 10)
  • V5 53 LRYLHSRIHVLQFLNPF (SEQ ID NO: 11)
  • E4 V1 16+31 PIPKPSPWAP SEQ ID NO: 41
  • E4 V1 18 RIPAPCPWAP SEQ ID NO: 42
  • VVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTN TGLYNLLIRCLR SEQ ID NO: 49
  • E6 CV2-2 53 SKVRKLRYYNCSVYGASL (SEQ ID NO: 5 1)
  • E6 CV2- 1 3 1 VYCKGQLTETEVLDFAFTDLTIVYRD (SEQ ID NO: 52)
  • E6 CV2-2 3 1 SKVSEFRWYRYSVYGTTL (SEQ ID NO: 53)
  • the E6 protein showed very limited conservation across genotypes. Instead ingroups were processed to produce chimerics without the shared % consensus identity filter, but the conserved windows were not combined to produce a consensus, except for genotypes 52 and 58. (Fig 6)
  • Genotypes 16 & 31 and 52 & 58 are chimeric variants.
  • HPV3 polypeptide sequence (SEQ ID NO: 61)
  • HPV3 polypeptide sequence without the TPA/peptide adjuvant sequence (SEQ ID NO: 66)
  • ChAdOx2 sequence (SEQ ID NO: 67 + 68)
  • ChAdOx2 sequence 5' to the immunogen cassette is provided as SEQ ID NO: 67 and the ChAdOx2 sequence 3' to the immunogen cassette is provided as SEQ ID NO: 68.
  • the MVA sequence 5' to the immunogen cassette is provided as SEQ ID NO: 69 and the MVA sequence 3' to the immunogen cassette is provided as SEQ ID NO: 70.
  • MVA vaccines have been made using two different shuttle plasmids:
  • HPV insert with upstream and downstream flanks that are homologous to regions of the TK locus in parental MVA virus. Insert under control of p7.5 promoter.
  • Fll shuttle plasmid HPV insert with upstream and downstream flanks that are homologous to regions of the Fll locus in parental MVA virus. Insert under control of Fl 1 promoter.
  • Chicken embryo fibroblast cells are then infected with MVA parental virus and transfected with either p7.5 or Fll MVA shuttle plasmids to allow homologous recombination with the MVA genome. So you get parental MVA with the gene of interest inserted into the MVA genome at either the TK locus (p7.5 shuttle plasmid) or F l l locus (F l l shuttle plasmid) . Resulting in two versions of the MVA vaccine.
  • P7.5 shuttle plasmid (SEQ ID NO: 158) (insert underlined) agcgcccaatacgcaaaccgcctctccccgcgcgttggccgattcattaatgcagctggcacgacaggtttcccgactgga aagcgggcagtgagcgcaacgcaattaatgtgagttagctcactcattaggcaccccaggctttacactttatgcttccggct cgt cgttgtggaattgtgagcggataacaatttcacacaggaaacagctatgaccatgattacgccaagcttgcatgcA TCTGGAAACGGGCATCTCCATTTAAGACTAGAtGCCACGGGGTTTAAAATACT AATCATGACATTTTGTAGAGCGTAATTACTTAGTAAATCCGCCGTACTAG
  • Fll-HPV shuttle plasmid (SEQ ID NO: 159) (vaccine construct insert is underlined) AGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGAC AGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTA GGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAAC AATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTATTTAGGTGACACTATAGAATA CTCAAGCTATGCATCAAGCTTGGTACCGAGCTCGGATCCACTAGTAACGGCCGCCAGTGTGCTGG AATTCGCCCTTgtaatctattcgatataccgttgctaacagtatactggcccaataactgtggat ggat ggaaaatctataataatacattaatatcatccgatggtgctagggt
  • HPV2-randomised nucleotide sequence (segments are in a randomisd order) (includes tPA leading sequence and Hindlll cloning linker, underlined) (SEQ ID NO: 71)
  • HPV2-randomised sequence polypeptide (includes tPA leading sequence and Hind!II cloning linker, underlined) (SEQ ID NO: 72) MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGSKLAAQLADSDSNACAFLKLRYLHSRIHVLQF LNPFTLHEYMLDLQPETTDLYCYEQDEDEDEVDHLQEQPQQARRDEQHPCYLI ETQCCRCESLVA QLADVNSNAAAFLKNS I DCNDSMCSTFDDNVSATELVKRI PAPCPWAPEENDEI DGVNHQHLPAR RAEPQRHTMLCMCCKCEARI CFLLCFCVLLCVCLLI RPLLLSVSTYCQRPLCPQEKKRHVDLNKR FHI YI CEDAQCTVVEGQVDSKVSEFRWYRYSVYGTTLGQRRI KRPRSEVYCKGQLTETEVLDFAF TDLTI VYRDI RLECAIMYKA
  • HPV53del nucleotide sequence (segments from HPV53 have been removed) (includes tPA leading sequence and Hind!II cloning linker, underlined) (SEQ ID NO: 73)
  • HPV53del polypeptide sequence (includes tPA leading sequence and Hindlll cloning linker, underlined) (SEQ ID NO: 74)
  • HPV3-linkers nucleotide sequence includes tPA leading sequence and Hindlll cloning linker, underlined (SEQ ID NO: 75)
  • HPV3-linkers polypeptide sequence (includes tPA leading sequence and Hindlll cloning linker, underlined) (SEQ ID NO: 76)

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Virology (AREA)
  • Medicinal Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Mycology (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/GB2018/052335 2017-08-16 2018-08-16 HPV VACCINE Ceased WO2019034887A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
US16/639,144 US11179456B2 (en) 2017-08-16 2018-08-16 HPV vaccine
KR1020207006062A KR102713224B1 (ko) 2017-08-16 2018-08-16 Hpv 백신
JP2020508007A JP7551495B2 (ja) 2017-08-16 2018-08-16 Hpvワクチン
AU2018316734A AU2018316734B2 (en) 2017-08-16 2018-08-16 HPV vaccine
SG11202001244SA SG11202001244SA (en) 2017-08-16 2018-08-16 Hpv vaccine
CA3072536A CA3072536A1 (en) 2017-08-16 2018-08-16 Hpv vaccine
EP18759700.0A EP3668542A1 (en) 2017-08-16 2018-08-16 Hpv vaccine
CN201880053063.XA CN111212659B (zh) 2017-08-16 2018-08-16 Hpv疫苗
MX2020001655A MX2020001655A (es) 2017-08-16 2018-08-16 Vacuna vph.
US17/532,177 US12064477B2 (en) 2017-08-16 2021-11-22 HPV vaccine

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GBGB1713163.2A GB201713163D0 (en) 2017-08-16 2017-08-16 HPV vaccine
GB1713163.2 2017-08-16

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/639,144 A-371-Of-International US11179456B2 (en) 2017-08-16 2018-08-16 HPV vaccine
US17/532,177 Continuation US12064477B2 (en) 2017-08-16 2021-11-22 HPV vaccine

Publications (1)

Publication Number Publication Date
WO2019034887A1 true WO2019034887A1 (en) 2019-02-21

Family

ID=59895974

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2018/052335 Ceased WO2019034887A1 (en) 2017-08-16 2018-08-16 HPV VACCINE

Country Status (11)

Country Link
US (2) US11179456B2 (https=)
EP (1) EP3668542A1 (https=)
JP (1) JP7551495B2 (https=)
KR (1) KR102713224B1 (https=)
CN (1) CN111212659B (https=)
AU (1) AU2018316734B2 (https=)
CA (1) CA3072536A1 (https=)
GB (1) GB201713163D0 (https=)
MX (1) MX2020001655A (https=)
SG (1) SG11202001244SA (https=)
WO (1) WO2019034887A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022129881A1 (en) 2020-12-15 2022-06-23 Chain Biotechnology Limited Compositions and methods
CN114828878A (zh) * 2019-10-16 2022-07-29 癌症研究科技有限公司 用于癌症治疗的载体
WO2023247936A1 (en) 2022-06-21 2023-12-28 Chain Biotechnology Limited Compositions and methods

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB201713163D0 (en) 2017-08-16 2017-09-27 Univ Oxford Innovation Ltd HPV vaccine
TWI852977B (zh) * 2019-01-10 2024-08-21 美商健生生物科技公司 前列腺新抗原及其用途
EP4175664A2 (en) 2020-07-06 2023-05-10 Janssen Biotech, Inc. Prostate neoantigens and their uses
WO2024218165A1 (en) * 2023-04-17 2024-10-24 Barinthus Biotherapeutics (Uk) Limited Hpv viral vector vaccine
WO2025092908A1 (zh) * 2023-11-01 2025-05-08 仁景(苏州)生物科技有限公司 治疗HPV感染相关疾病的mRNA疫苗
CN119464385B (zh) * 2024-12-04 2026-04-07 华中科技大学同济医学院附属同济医院 Matv11重组腺病毒载体、应用、制备方法及hpv治疗性疫苗

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009059325A2 (en) * 2007-11-02 2009-05-07 The Johns Hopkins University Multitype hpv peptide compositions and methods for treatment or prevention of human papillomavirus infection

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7026443B1 (en) 1999-12-10 2006-04-11 Epimmune Inc. Inducing cellular immune responses to human Papillomavirus using peptide and nucleic acid compositions
AU2005222776A1 (en) 2003-12-31 2005-09-29 Genimmune N.V. Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions
EP2093410B1 (en) 2008-02-21 2014-04-09 Delphi International Operations Luxembourg S.à r.l. A fuel injector with an improved valve control arrangement
CN102498217A (zh) 2009-04-20 2012-06-13 阿波维塔公司 Hpv的e6蛋白的特异性抗体及其应用
EP2940133A4 (en) 2012-12-25 2016-07-06 Chemo Sero Therapeut Res Inst VACCINE FOR HPV INFECTION AND / OR HEPATITIS B WITH CHIMERIC HPV / HBS PROTEIN AS AN ACTIVE SUBSTANCE
AU2014248535B2 (en) 2013-03-12 2017-03-30 Inovio Pharmaceuticals, Inc. Improved vaccines for human papilloma virus and methods for using the same
WO2018060288A1 (en) 2016-09-29 2018-04-05 Glaxosmithkline Biologicals S.A. Compositions and methods of treatment of persistent hpv infection
GB201713163D0 (en) 2017-08-16 2017-09-27 Univ Oxford Innovation Ltd HPV vaccine

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009059325A2 (en) * 2007-11-02 2009-05-07 The Johns Hopkins University Multitype hpv peptide compositions and methods for treatment or prevention of human papillomavirus infection

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
KRISHNA P. SINGH ET AL: "Sequence-based approach for rapid identification of cross-clade CD8+ T-cell vaccine candidates from all high-risk HPV strains", 3 BIOTECH, vol. 6, no. 1, 27 January 2016 (2016-01-27), DE, XP055507933, ISSN: 2190-572X, DOI: 10.1007/s13205-015-0352-z *
YAN J ET AL: "Induction of antitumor immunity in vivo following delivery of a novel HPV-16 DNA vaccine encoding an E6/E7 fusion antigen", VACCINE, ELSEVIER, AMSTERDAM, NL, vol. 27, no. 3, 14 January 2009 (2009-01-14), pages 431 - 440, XP025815588, ISSN: 0264-410X, [retrieved on 20081118], DOI: 10.1016/J.VACCINE.2008.10.078 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114828878A (zh) * 2019-10-16 2022-07-29 癌症研究科技有限公司 用于癌症治疗的载体
US20230110588A1 (en) * 2019-10-16 2023-04-13 Cancer Research Technology Limited Vector for cancer treatment
US20240401075A1 (en) * 2019-10-16 2024-12-05 Cancer Research Technology Limited Vector for cancer treatment
WO2022129881A1 (en) 2020-12-15 2022-06-23 Chain Biotechnology Limited Compositions and methods
US12472245B2 (en) 2020-12-15 2025-11-18 Chain Biotechnology Limited Compositions and methods
WO2023247936A1 (en) 2022-06-21 2023-12-28 Chain Biotechnology Limited Compositions and methods

Also Published As

Publication number Publication date
US20200306358A1 (en) 2020-10-01
AU2018316734B2 (en) 2025-08-21
KR102713224B1 (ko) 2024-10-07
JP7551495B2 (ja) 2024-09-17
CN111212659B (zh) 2023-09-22
CN111212659A (zh) 2020-05-29
KR20200056384A (ko) 2020-05-22
SG11202001244SA (en) 2020-03-30
CA3072536A1 (en) 2019-02-21
US20220152189A1 (en) 2022-05-19
GB201713163D0 (en) 2017-09-27
AU2018316734A1 (en) 2020-02-27
US11179456B2 (en) 2021-11-23
MX2020001655A (es) 2020-08-17
EP3668542A1 (en) 2020-06-24
JP2020536489A (ja) 2020-12-17
US12064477B2 (en) 2024-08-20

Similar Documents

Publication Publication Date Title
US12064477B2 (en) HPV vaccine
AU2021232660B2 (en) HPV vaccines
CN112618707B (zh) 一种SARS-CoV-2冠状病毒疫苗及其制备方法
KR101196178B1 (ko) Hiv 조절/부속 단백질의 융합 단백질
US20110158952A1 (en) Compositions and methods for treating human papillomavirus-mediated disease
Dale et al. Chimeric human papilloma virus–simian/human immunodeficiency virus virus-like-particle vaccines: immunogenicity and protective efficacy in macaques
Yan et al. Cellular immunity induced by a novel HPV18 DNA vaccine encoding an E6/E7 fusion consensus protein in mice and rhesus macaques
CN111328420A (zh) 用于预防和治疗微卫星不稳定(msi)癌症的基于共有肿瘤新抗原的通用疫苗
CN112760341B (zh) 重组载体、包装有该重组载体的黑猩猩腺病毒在制备2019新型冠状病毒疫苗中的应用
TWI901715B (zh) 大猩猩腺病毒核酸及胺基酸序列,包含彼之載體,及其用途
CA3181431A1 (en) A recombinant modified vaccinia virus ankara (mva) vaccine against coronavirus disease
CN114106115B (zh) 一种腺病毒载体重组新冠病毒b.1.351变异株疫苗及其应用
WO2024218165A1 (en) Hpv viral vector vaccine
Blomquist et al. Induction of a strong HIV-specific CD8+ T cell response in mice using a fowlpox virus vector expressing an HIV-1 multi-CTL-epitope polypeptide
WO2025112200A1 (zh) 狂犬病疫苗免疫原组合物
US11154613B2 (en) HCV vaccines
Zhao et al. Immunogenicity in mice and rhesus monkeys vaccinated with recombinant vaccinia virus expressing bivalent E7E6 fusion proteins from human papillomavirus types 16 and 18
JP2010168288A (ja) 最適化した抗原遺伝子の使用によるウイルスワクチンの免疫原性の増強
TW202519538A (zh) 基於cmv之人類乳頭瘤病毒疫苗
CN121627808A (zh) Hpv-52型e6蛋白的特异性ctl表位肽及其应用
CN108440669A (zh) 一种融合蛋白及治疗非小细胞肺癌的重组病毒疫苗和制备方法
WO2025231384A1 (en) Human papilloma virus immunogen compositions and uses thereof
HK40082300A (en) Hpv vaccines
EP2598520A2 (en) Recombinant proteins as vaccines for protection against disease induced by infection with mink astrovirus
Huber et al. A Chimeric L1-L2 Virus-like Particle (VLP) Vaccine targeting Common Cutaneous Human Papillomavirus (HPV) Types HPV1 and HPV63

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18759700

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3072536

Country of ref document: CA

Ref document number: 2020508007

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018316734

Country of ref document: AU

Date of ref document: 20180816

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20207006062

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018759700

Country of ref document: EP

Effective date: 20200316

WWW Wipo information: withdrawn in national office

Ref document number: 2018759700

Country of ref document: EP