WO2019028098A1 - METHODS AND COMPOSITIONS FOR TREATING CANCER - Google Patents
METHODS AND COMPOSITIONS FOR TREATING CANCER Download PDFInfo
- Publication number
- WO2019028098A1 WO2019028098A1 PCT/US2018/044740 US2018044740W WO2019028098A1 WO 2019028098 A1 WO2019028098 A1 WO 2019028098A1 US 2018044740 W US2018044740 W US 2018044740W WO 2019028098 A1 WO2019028098 A1 WO 2019028098A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- cells
- myc
- immune cells
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/82—Translation products from oncogenes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/50—Colon
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/57—Skin; melanoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/41—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/998—Proteins not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16311—Human Immunodeficiency Virus, HIV concerning HIV regulatory proteins
- C12N2740/16322—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- Adoptive cell transfer is a form of immunotherapy that involves the transfer of immune cells with antitumor activity into patients.
- ACT typically involves isolation of lymphocytes with antitumor activity from a patient, culturing the lymphocytes in vitro to expand the population, and then infusing the lymphocytes into the cancer-bearing host.
- Lymphocytes used for adoptive transfer can either be derived from the stroma of resected tumors (e.g., tumor infiltrating lymphocytes), from the lymphatics or lymph nodes, or from the blood.
- the isolated lymphocytes are genetically engineered to express antitumor T cell receptors (TCRs) or chimeric antigen receptors (CARs).
- TCRs antitumor T cell receptors
- CARs chimeric antigen receptors
- the lymphocytes used for infusion can be isolated from a donor (allogeneic ACT), or from the cancer-bearing host (autologous ACT).
- kits for adoptive cell transfer for the treatment of cancer comprising administering a therapeutically effective amount of immune cells having antitumor activity to the subject, wherein the immune cells are contacted with a protein transduction domain (PTD)-MYC fusion polypeptide prior to administration to the subject.
- the immune cells comprise one or more lymphocytes.
- the one or more lymphocytes comprise T cells and/or B cells. In some embodiments, the one or more lymphocytes comprise T cells and/or B cells.
- the one or more lymphocytes comprise tumor-infiltrating lymphocytes.
- the cancer is a metastatic cancer. In some embodiments, the cancer is a carcinoma, adenoma, adenocarcinoma, blastoma, sarcoma, or lymphoma.
- the cancer is a basal cell carcinoma, biliary tract cancer, bladder cancer, breast cancer, cervical cancer, choriocarcinoma, CNS cancer, colon cancer, colorectal cancer, connective tissue cancer, cancer of the digestive system, endometrial cancer, esophageal cancer, eye cancer, gastric cancer, glial cell tumor, head and neck cancer, hepatoma, hepatic carcinoma, Hodgkin's lymphoma, Non- Hodgkin's lymphoma, intra-epithelial neoplasm, kidney cancer, larynx cancer, liver cancer, small-cell lung cancer, non-small cell lung cancer, melanoma, myeloma, neuroblastoma, oral cavity cancer, ovarian cancer, pancreatic cancer, prostate cancer, rectal cancer, renal cancer, cancer of the respiratory system, retinoblastoma, rhabdomyosarcoma, salivary gland carcinoma, squamous cell cancer, stomach cancer, test
- the immune cells are obtained from a donor subject having solid tumor.
- the solid tumor is a metastatic tumor.
- the immune cells are obtained from a donor subject having a melanoma or a colon cancer.
- donor subject and the subject receiving the immune cells are the same (i.e., autologous ACT). In some embodiments, donor subject and the subject receiving the immune cells are different (i.e., allogeneic ACT).
- the PTD-MYC fusion polypeptide comprises: (i) an HIV TAT protein transduction domain; and (ii) a MYC polypeptide sequence.
- the PTD-MYC fusion polypeptide translocates to the nucleus of the immune cell.
- the PTD-MYC fusion polypeptide exhibits a biological activity of MYC, such as the activation of MYC target genes.
- the fusion peptide comprises SEQ ID NO: 1.
- compositions comprising (a) a MYC fusion peptide, comprising (i) a protein transduction domain; (ii) a MYC polypeptide sequence; and (b) one or more primary immune cells isolated from a donor subject that has a tumor, wherein the one or more primary immune cells are reactive against a tumor-specific antigen.
- the MYC fusion peptide translocates to the nucleus of the one or more primary immune cells.
- the MYC fusion peptide exhibits a biological activity of MYC.
- the MYC fusion peptide further comprises one or more molecules that link the protein transduction domain and the MYC polypeptide.
- the MYC fusion peptide comprises a MYC fusion peptide with the following general structure:
- the protein transduction domain sequence is a TAT protein transduction domain sequence.
- the TAT protein transduction domain sequence is selected from the group consisting of TAT[48-57] and TAT[57-48].
- the MYC fusion peptide comprises SEQ ID NO: 1.
- the MYC fusion peptide is acetylated.
- the one or more immune cells have antitumor activity against the tumor cells.
- the one or more immune cells comprises one or more lymphocytes.
- the one or more lymphocytes comprises a T cell, a B cell, an NK cell, or any combination thereof.
- the T cell is selected from the group consisting of naive T cells, CD4+ T cells, CD8+ T cells, memory T cells, activated T cells, anergic T cells, tolerant T cells, chimeric B cells, and antigen-specific T cells.
- the B cells are selected from the group consisting of naive B cells, plasma B cells, activated B cells, memory B cells, anergic B cells, tolerant B cells, chimeric B cells, and antigen-specific B cells.
- the one or more lymphocytes is a tumor-infiltrating lymphocyte, T-cell receptor modified lymphocyte, or a chimeric antigen receptor modified lymphocyte.
- the tumor-infiltrating lymphocyte has a CD8+CD25+ signature.
- the lymphocyte has a CD4+CD25+ signature.
- the one or more immune cells comprises a detectable moiety.
- Described herein, in certain embodiments are methods for treating a tumor in a subject, comprising administering one or more modified immune cells to the subject in need thereof, wherein the one or more modified immune cells comprise a MYC fusion peptide comprising (i) a protein transduction domain; (ii) a MYC polypeptide sequence and are reactive to a tumor-specific antigen.
- the one or more modified immune cells are derived from primary immune cells isolated from the subject.
- the one or more modified immune cells are derived from primary immune cells isolated from a separate donor subject having the same type of tumor.
- the one or more modified immune cells are prepared by contacting the primary immune cells in vitro with the MYC fusion peptide following isolation. In some embodiments, the methods further comprise expanding the primary immune cells in vitro prior to contacting with the MYC fusion peptide. In some embodiments, the methods further comprise expanding the primary immune cells following contacting with the MYC fusion peptide. In some embodiments, the cells are expanded using an anti-CD3 antibody. In some embodiments, the cells are expanded using an irradiated allogenic feeder cells. In some embodiments, the cells are expanded in the presence of an exogenous cytokine. In some embodiments, the cytokine is interleukin-2.
- the MYC fusion peptide translocates to the nucleus of the immune cell. In some embodiments, the MYC fusion peptide exhibits a biological activity of MYC. In some embodiments, the MYC fusion peptide further comprises one or more molecules that link the protein transduction domain and the MYC polypeptide. In some embodiments, the MYC fusion peptide comprises a MYC fusion peptide with the following general structure:
- the protein transduction domain sequence is a TAT protein transduction domain sequence.
- the TAT protein transduction domain sequence is selected from the group consisting of TAT[48-57] and TAT[57-48].
- the MYC fusion peptide comprises SEQ ID NO: 1.
- the MYC fusion peptide is acetylated.
- the one or more modified immune cells have antitumor activity against the tumor cells in the subject.
- the one or more modified immune cells have antitumor activity against tumor cells in the subject.
- the cancer cells are solid tumor cells.
- the solid tumor is a metastatic tumor.
- the cancer cells are melanoma or colon tumor cells.
- the cancer cells are from a basal cell carcinoma, biliary tract cancer, bladder cancer, breast cancer, cervical cancer, choriocarcinoma, CNS cancer, colon cancer, colorectal cancer, connective tissue cancer, cancer of the digestive system, endometrial cancer, esophageal cancer, eye cancer, gastric cancer, glial cell tumor, head and neck cancer, hepatoma, hepatic carcinoma, Hodgkin's lymphoma, Non-Hodgkin's lymphoma, intra-epithelial neoplasm, kidney cancer, larynx cancer, liver cancer, small-cell lung cancer, non-small cell lung cancer, melanoma, myeloma, neuroblastoma, oral cavity cancer, ovarian cancer, pancreatic cancer, prostate cancer, rectal cancer, renal cancer, cancer of the respiratory system,
- the immune cells are obtained from a donor subject having solid tumor.
- the one or more modified immune cells comprise one or more anergic immune cells.
- the one or more immune cells comprises one or more lymphocytes.
- the one or more lymphocytes comprises a T cell, a B cell, an K, or any combination thereof.
- the T cell is selected from the group consisting of naive T cells, CD4+ T cells, CD8+ T cells, memory T cells, activated T cells, anergic T cells, tolerant T cells, chimeric B cells, and antigen-specific T cells.
- the B cells are selected from the group consisting of naive B cells, plasma B cells, activated B cells, memory B cells, anergic B cells, tolerant B cells, chimeric B cells, and antigen-specific B cells.
- the one or more lymphocytes is a tumor-infiltrating lymphocyte, T-cell receptor modified lymphocyte, or a chimeric antigen receptor modified lymphocyte.
- the lymphocyte has a CD8+CD28-CD152- signature.
- the lymphocyte has a CD8+CD25+ signature.
- the lymphocyte has a
- the methods further comprise isolating the primary immune cells from the donor subject.
- the donor subject has cancer.
- the one or more modified immune cells are administered intravenously, intraperitoneally, subcutaneously, intramuscularly, or intratum orally.
- the methods further comprise lymphodepleting the subject prior to administration of the one or more modified immune cells.
- the methods further comprise administering a cytokine to the subject.
- the cytokine is administered prior to, during, or subsequent to administration of the one or more modified immune cells.
- the cytokine is selected from a group consisting of interferon a, interferon ⁇ , interferon ⁇ , complement C5a, IL-2, TNF alpha, CD40L, IL12, IL-23, IL15, IL17, CCL1, CCL11, CCL12, CCL13, CCL14-1, CCL14-2, CCL14-3, CCL15-1, CCL15-2, CCL16, CCL17, CCL18, CCL19, CCL19, CCL2, CCL20, CCL21, CCL22, CCL23-1, CCL23-2, CCL24, CCL25- 1, CCL25-2, CCL26, CCL27, CCL28, CCL3, CCL3L1, CCL4, CCL4L1, CCL5, CCL6, CCL7, CCL8, CCL9, CCR10, CCR2, CCR5, CCR6, CCR7, CCR8, CCRL1, CCRL2, CX3CL1, CX3CR, C
- the tumor is metastatic.
- the subject is a human or an animal.
- the methods further comprise administering an additional cancer therapy.
- the additional cancer therapy is selected from among chemotherapy, radiation therapy, immunotherapy, monoclonal antibodies, anti-cancer nucleic acids or proteins, anti-cancer viruses or microorganisms, and any combinations thereof.
- the one or more modified immune cells comprises a detectable moiety.
- a MYC fusion polypeptide comprising contacting one or more immune cells in vitro with a MYC fusion polypeptide, wherein the immune cells are from a donor that has been exposed to one or more tumor antigens and wherein the MYC fusion peptide comprises (i) a protein transduction domain; (ii) a MYC polypeptide sequence and are reactive to a tumor-specific antigen.
- the one or more modified immune cells are derived from primary immune cells isolated from a subject having a tumor.
- the methods further comprise expanding the primary immune cells in vitro prior to contacting with the MYC fusion peptide.
- the methods further comprise expanding the primary immune cells following contacting with the MYC fusion peptide.
- the cells are expanded using an anti-CD3 antibody.
- the cells are expanded using an irradiated allogenic feeder cells.
- the cells are expanded in the presence of an exogenous cytokine.
- the cytokine is interleukin-2.
- the MYC fusion peptide translocates to the nucleus of the immune cell. In some embodiments, the MYC fusion peptide exhibits a biological activity of MYC. In some embodiments, the MYC fusion peptide further comprises one or more molecules that link the protein transduction domain and the MYC polypeptide. In some embodiments, the MYC fusion peptide comprises a MYC fusion peptide with the following general structure:
- the protein transduction domain sequence is a TAT protein transduction domain sequence.
- the TAT protein transduction domain sequence is selected from the group consisting of TAT[48-57] and TAT[57-48].
- the MYC fusion peptide comprises SEQ ID NO: 1.
- the MYC fusion peptide is acetylated.
- the one or more modified immune cells have antitumor activity. In some embodiments, the one or more modified immune cells have antitumor activity against tumor cells in the subject.
- the one or more modified immune cells comprise one or more anergic immune cells.
- the one or more immune cells comprises one or more lymphocytes.
- the one or more lymphocytes comprises a T cell, a B cell, an NK, or any combination thereof.
- the T cell is selected from the group consisting of naive T cells, CD4+ T cells, CD8+ T cells, memory T cells, activated T cells, anergic T cells, tolerant T cells, chimeric B cells, and antigen-specific T cells.
- the B cells are selected from the group consisting of naive B cells, plasma B cells, activated B cells, memory B cells, anergic B cells, tolerant B cells, chimeric B cells, and antigen-specific B cells.
- the one or more lymphocytes is a tumor-infiltrating lymphocyte, T-cell receptor modified lymphocyte, or a chimeric antigen receptor modified lymphocyte.
- the lymphocyte has a CD8+CD28-CD152- signature.
- the lymphocyte has a CD8+CD25+ signature.
- the lymphocyte has a CD4+CD25+ signature.
- compositions comprising: (a) one or more isolated primary immune cells that have been exposed to a tumor cell line; and (b) a MYC fusion peptide, comprising (i) a protein transduction domain; (ii) a MYC polypeptide sequence; wherein the one or more primary immune cells are reactive against a tumor-specific antigen.
- compositions for use in treating a cancer are any of the aforementioned compositions for use in the manufacture of a medicaments for treating a cancer.
- compositions for increasing the efficacy of adoptive cell therapy or T-cell therapy in a subject comprising administering any of the aforementioned compositions.
- tumor-infiltrating lymphocytes comprising a MYC fusion peptide, comprising (i) a protein transduction domain; (ii) a MYC polypeptide sequence.
- the tumor-infiltrating lymphocytes are derived from primary tumor-infiltrating lymphocytes isolated from a subject that has cancer.
- lymphocytes comprising a chimeric antigen receptor and a MYC fusion peptide, comprising (i) a protein transduction domain; (ii) a MYC polypeptide sequence.
- the lymphocytes are derived from primary lymphocytes isolated from a subject that has cancer.
- compositions for adoptive cell therapy comprising contacting one or more primary immune cells with MYC fusion peptide, comprising (i) a protein transduction domain; (ii) a MYC polypeptide sequence, wherein one or more primary immune cells are isolated from a patient having a tumor, and wherein one or more primary immune cells are reactive to a tumor-specific antigen.
- kits comprising the MYC-fusion polypeptides and/or MYC-fusion polypeptide-modified immune cells provided herein for use in treating a cancer.
- the kit comprises one for more reagents for the detection of the administered MYC-fusion polypeptides and/or MYC-fusion polypeptide-modified immune cells.
- the kit comprises cells for treatment with a MYC-fusion polypeptide provided herein, for example, hematopoietic stem cells, donor leukocytes, T cells, or K cells.
- the kit comprises associated instructions for using the MYC-fusion polypeptides and/or MYC-fusion polypeptide-modified immune cells.
- FIG. 1 illustrates results for survival of melanoma tumor-bearing mice following infusion of lymphocytes from tumor-bearing donor mice treated with TAT-MYC for 1 hour. Mice were treated with TAT-MYC lymphocytes, lymph cells treated with a control protein or left untreated. Day of death recorded with day of treatment as Day 0.
- FIG. 2 illustrates results for survival of melanoma tumor-bearing mice following infusion of lymphocytes from tumor-bearing donor mice treated with TAT-MYC (repeat of experiment shown in Fig. 1). Mice were treated with TAT-MYC lymphocytes, lymph cells treated with a control protein or left untreated. Day of death recorded with day of treatment as Day 0.
- FIG. 3 illustrates results for survival of melanoma tumor-bearing mice following infusion of different amounts of lymphocytes from tumor-bearing donor mice treated with TAT- MYC. Mice were treated with TAT-MYC lymphocytes, lymph cells treated with a control protein or left untreated. Day of death recorded with day of treatment as Day 0.
- FIG. 4 illustrates results for survival of melanoma tumor-bearing mice following infusion of different amounts of lymphocytes from tumor-bearing donor mice treated with TAT- MYC. Mice were treated with TAT-MYC lymphocytes, lymph cells treated with a control protein or left untreated. Day of death recorded with day of treatment as Day 0.
- FIG. 5 illustrates results for survival of colon tumor-bearing mice following infusion of lymphocytes from tumor-bearing donor mice treated with TAT-MYC. Mice were treated with TAT-MYC lymphocytes, lymph cells treated with a control protein or left untreated. Day of death recorded with day of treatment as Day 0.
- FIG. 6 illustrates results for survival of colon tumor-bearing mice following infusion of different amounts of lymphocytes from tumor-bearing donor mice treated with TAT-MYC. Mice were treated with TAT-MYC lymphocytes or left untreated. Day of death recorded with day of treatment as Day 0.
- a range includes each individual member.
- a group having 1-3 cells refers to groups having 1, 2, or 3 cells.
- a group having 1-5 cells refers to groups having 1, 2, 3, 4, or 5 cells, and so forth.
- a concentration of about 200 IU/mL encompasses a concentration between 160 IU/mL and 240 IU/mL.
- the term "administration" of an agent to a subject includes any route of introducing or delivering the agent to a subject to perform its intended function.
- Administration can be carried out by any suitable route, including intravenously,
- Administration includes self- administration and the administration by another.
- amino acid refers to naturally occurring and non-naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrolysine and selenocysteine.
- Amino acid analogs refers to agents that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
- Such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- amino acids forming a polypeptide are in the D form.
- the amino acids forming a polypeptide are in the L form.
- a first plurality of amino acids forming a polypeptide are in the D form and a second plurality are in the L form.
- polypeptide polypeptide
- peptide protein
- protein protein
- the terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non- naturally occurring amino acid, e.g., an amino acid analog.
- the terms encompass amino acid chains of any length, including full length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
- control is an alternative sample used in an experiment for comparison purpose.
- a control can be "positive” or “negative.”
- a positive control a composition known to exhibit the desired therapeutic effect
- a negative control a subject or a sample that does not receive the therapy or receives a placebo
- the term "effective amount” or “therapeutically effective amount” refers to a quantity of an agent sufficient to achieve a desired therapeutic effect.
- the amount of a therapeutic peptide administered to the subject can depend on the type and severity of the infection and on the characteristics of the individual, such as general health, age, sex, body weight and tolerance to drugs. It can also depend on the degree, severity and type of disease. The skilled artisan will be able to determine appropriate dosages depending on these and other factors.
- the term "expression” refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression can include splicing of the mRNA in a eukaryotic cell. The expression level of a gene can be determined by measuring the amount of mRNA or protein in a cell or tissue sample. In one aspect, the expression level of a gene from one sample can be directly compared to the expression level of that gene from a control or reference sample.
- the expression level of a gene from one sample can be directly compared to the expression level of that gene from the same sample following administration of the compositions disclosed herein.
- expression also refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription) within a cell; (2) processing of an RNA transcript (e.g., by splicing, editing, 5' cap formation, and/or 3 ' end formation) within a cell; (3) translation of an RNA sequence into a polypeptide or protein within a cell; (4) post-translational modification of a polypeptide or protein within a cell; (5) presentation of a polypeptide or protein on the cell surface; and (6) secretion or presentation or release of a polypeptide or protein from a cell.
- linker refers to synthetic sequences (e.g., amino acid sequences) that connect or link two sequences, e.g., that link two polypeptide domains. In some embodiments, the linker contains 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 of amino acid sequences.
- lyophilized refers to a process by which the material (e.g., nanoparticles) to be dried is first frozen and then the ice or frozen solvent is removed by sublimation in a vacuum environment.
- An excipient can be included in pre-lyophilized formulations to enhance stability of the lyophilized product upon storage.
- the lyophilized sample can further contain additional excipients.
- immune cell refers to any cell that plays a role in the immune response.
- Immune cells are of hematopoietic origin, and include lymphocytes, such as B cells and T cells; natural killer cells; myeloid cells, such as monocytes, macrophages, dendritic cells, eosinophils, neutrophils, mast cells, basophils, and granulocytes.
- lymphocyte refers to all immature, mature, undifferentiated and differentiated white lymphocyte populations including tissue specific and specialized varieties. It encompasses, by way of non-limiting example, B cells, T cells, KT cells, and NK cells. In some embodiments, lymphocytes include all B cell lineages including pre-B cells, progenitor B cells, early pro-B cells, late pro-B cells, large pre-B cells, small pre-B cells, immature B cells, mature B cells, plasma B cells, memory B cells, B-l cells, B-2 cells and anergic AN1/T3 cell populations.
- T-cell includes naive T cells, CD4+ T cells, CD8+ T cells, memory T cells, activated T cells, anergic T cells, tolerant T cells, chimeric B cells, and antigen- specific T cells.
- B cell refers to, by way of non-limiting example, a pre-B cell, progenitor B cell, early pro-B cell, late pro-B cell, large pre-B cell, small pre-B cell, immature B cell, mature B cell, naive B cells, plasma B cells, activated B cells, anergic B cells, tolerant B cells, chimeric B cells, antigen-specific B cells, memory B cell, B-l cell, B-2 cells and anergic AN1/T3 cell populations.
- the term B cell includes a B cell that expresses an immunoglobulin heavy chain and/or light chain on its cells surface.
- the term B cell includes a B cell that expresses and secretes an immunoglobulin heavy chain and/or light chain. In some embodiments, the term B cell includes a cell that binds an antigen on its cell-surface. In some embodiments disclosed herein, B cells or AN1/T3 cells are utilized in the processes described. In certain embodiments, such cells are optionally substituted with any animal cell suitable for expressing, capable of expressing (e.g., inducible expression), or capable of being differentiated into a cell suitable for expressing an antibody including, e.g., a
- hematopoietic stem cell a naive B cell, a B cell, a pre-B cell, a progenitor B cell, an early Pro-B cell, a late pro-B cell, a large pre-B cell, a small pre-B cell, an immature B cell, a mature B cell, a plasma B cell, a memory B cell, a B-l cell, a B-2 cell, an anergic B cell, or an anergic AN1/T3 cell.
- adoptive cell therapeutic composition refers to any composition comprising cells suitable for adoptive cell transfer.
- the adoptive cell therapeutic composition comprises a cell type selected from a group consisting of a tumor infiltrating lymphocyte (TIL), TCR (i.e. heterologous T-cell receptor) modified lymphocytes and CAR (i.e. chimeric antigen receptor) modified lymphocytes.
- TIL tumor infiltrating lymphocyte
- CAR i.e. chimeric antigen receptor
- the adoptive cell therapeutic composition comprises a cell type selected from a group consisting of T-cells, CD8+ cells, CD4+ cells, K-cells, delta-gamma T-cells, regulatory T-cells and peripheral blood mononuclear cells.
- TILs, T-cells, CD8+ cells, CD4+ cells, NK-cells, delta-gamma T-cells, regulatory T-cells or peripheral blood mononuclear cells form the adoptive cell therapeutic composition.
- the adoptive cell therapeutic composition comprises T cells.
- tumor-infiltrating lymphocytes or TILs refer to white blood cells that have left the bloodstream and migrated into a tumor.
- MYC and “MYC gene” are synonyms. They refer to a nucleic acid sequence that encodes a MYC polypeptide.
- a MYC gene comprises a nucleotide sequence of at least 120 nucleotides that is at least 60% to 100% identical or homologous, e.g., at least 60, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 70% to about 100% identical to sequences of NCBI Accession Number NM— 002467.
- the MYC gene is a proto-oncogene.
- a MYC gene is found on chromosome 8, at 8q24.21. In certain instances, a MYC gene begins at 128,816,862 bp from pter and ends at 128,822,856 bp from pter. In certain instances, a MYC gene is about 6 kb. In certain instances, a MYC gene encodes at least eight separate mRNA sequences— 5 alternatively spliced variants and 3 unspliced variants.
- MYC protein MYC polypeptide
- MYC sequence MYC sequence
- UniProtKB/Swiss-Prot:P01106.1 (MYC isoform 1) or NP_002458.2 (UniProtKB/Swiss- Pro POl 106.2; MYC isoform 2), and functional homologs, analogs or fragments thereof.
- the sequence of or UniProtKB/Swiss-Prot:P01106.1 is: MPLNVSFTNRNYDLDYDSVQPYFYCDEEE FYQQQQSELQPPAPSEDIWKKFELLPTP
- NP_002458.2 (UniProtKB/Swiss-Prot:P01106.2) is:
- the MYC polypeptide is a complete MYC polypeptide sequence. In some embodiments, the MYC polypeptide is a partial MYC polypeptide sequence. In some embodiments, the MYC polypeptide comprises at least 400 consecutive amino acids of SEQ ID NO: 2 OR 11. In some embodiments, the MYC polypeptide comprises at least 400 consecutive amino acids of SEQ ID NO: 2 OR 11 and retains at least one MYC activity. In some embodiments, the MYC polypeptide comprises at least 400, at least 410, at least 420, at least 430, or at least 450 consecutive amino acids of SEQ ID NO: 2 OR 11.
- the MYC polypeptide comprises at least 400, at least 410, at least 420, at least 430, or at least 450 consecutive amino acids of SEQ ID NO: 2 OR 11 and retains at least one MYC activity.
- the MYC polypeptide is c-MYC.
- the MYC polypeptide sequence comprises the sequence shown below: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEE FYQQQQSELQPP
- VQ AEEQKLI SEEDLLRKRREQLKHKLEQLR SEQ ID NO: 3
- the MYC polypeptide sequence comprises the sequence shown below:
- a MYC polypeptide comprises an amino acid sequence that is at least 40% to 100% identical, e.g., at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, 99%), or any other percent from about 40% to about 100% identical to the sequence of NCBI Accession Number NP002458.2 or UniProtKB/Swiss-Prot Accession Number P01106.1.
- MYC polypeptide refers to a polymer of 439 amino acids, a MYC polypeptide that has not undergone any post-translational modifications. In some embodiments, MYC polypeptide refers to a polymer of 439 amino acids that has undergone post-translational modifications. In some embodiments, the MYC polypeptide is 48,804 kDa. In some embodiments, the MYC polypeptide contains a basic Helix-Loop-Helix Leucine Zipper (bHLH/LZ) domain.
- the bHLH/LZ domain comprises the sequence of: ELKRSFFALRDQIPELEN EKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKH KLEQLR (SEQ ID NO: 5).
- the MYC polypeptide is a transcription factor (e.g., Transcription Factor 64).
- the MYC polypeptide contains an E-box DNA binding domain.
- the MYC polypeptide binds to a sequence comprising CACGTG.
- the MYC polypeptide promotes one or more of cell survival and/or proliferation.
- a MYC polypeptide includes one or more of those described above, and includes one or more post-translational modifications (e.g., acetylation).
- the MYC polypeptides comprise one or more additional amino acid residues at the N-terminus or C-terminus of the polypeptide.
- the MYC polypeptides are fusion proteins.
- the MYC polypeptides are linked to one or more additional peptides at the N-terminus or C-terminus of the polypeptide.
- Proteins suitable for use in the methods described herein also includes functional variants, including proteins having between 1 to 15 amino acid changes, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acid substitutions, deletions, or additions, compared to the amino acid sequence of any protein described herein.
- the altered amino acid sequence is at least 75% identical, e.g., 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of any protein inhibitor described herein.
- sequence-variant proteins are suitable for the methods described herein as long as the altered amino acid sequence retains sufficient biological activity to be functional in the compositions and methods described herein. Where amino acid substitutions are made, the substitutions can be conservative amino acid substitutions.
- a “conservative amino acid substitution” is illustrated by a substitution among amino acids within each of the following groups: (1) glycine, alanine, valine, leucine, and isoleucine, (2) phenylalanine, tyrosine, and tryptophan, (3) serine and threonine, (4) aspartate and glutamate, (5) glutamine and asparagine, and (6) lysine, arginine and histidine.
- BLOSUM62 table is an amino acid substitution matrix derived from about 2,000 local multiple alignments of protein sequence segments, representing highly conserved regions of more than 500 groups of related proteins (Henikoff et al, (1992), Proc. Natl Acad. Sci. USA, 89: 10915- 10919). Accordingly, the BLOSUM62 substitution frequencies are used to define conservative amino acid substitutions that, in some embodiments, are introduced into the amino acid sequences described or disclosed herein. Although it is possible to design amino acid substitutions based solely upon chemical properties (as discussed above), the language
- “conservative amino acid substitution” preferably refers to a substitution represented by a BLOSUM62 value of greater than -1.
- an amino acid substitution is conservative if the substitution is characterized by a BLOSUM62 value of 0, 1, 2, or 3.
- preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 1 (e.g., 1, 2 or 3), while more preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 2 (e.g., 2 or 3).
- the E-box sequence comprises CACGTG.
- the basic helix-loop-helix domain of a transcription factor encoded by MYC binds to the E-box sequence.
- the E-box sequence is located upstream of a gene (e.g., p21, Bcl- 2, or ornithine decarboxylase).
- the MYC polypeptide contains an E-box DNA binding domain.
- the E-box DNA binding domain comprises the sequence of KRRTHNVLERQRRN (SEQ ID NO: 6).
- the binding of the transcription factor encoded by MYC to the E-box sequence allows RNA polymerase to transcribe the gene downstream of the E-box sequence.
- MYC activity or “MYC biological activity” or “biologically active MYC” includes one or more of enhancing or inducing cell survival, cell proliferation, and/or antibody production.
- MYC activity includes enhancement of expansion of anti-CD3 and anti-CD28 activated T-cells and/or increased proliferation of long-term self-renewing hematopoietic stem cells.
- MYC activity also includes entry into the nucleus of a cell, binding to a nucleic acid sequence (e.g., binding an E-box sequence), and/or inducing expression of MYC target genes.
- patient refers to an animal, typically a mammal.
- patient, subject, or individual is a mammal.
- patient, subject or individual is a human.
- patient, subject or individual is an animal, such as, but not limited to, domesticated animals, such as equine, bovine, murine, ovine, canine, and feline.
- protein transduction domain PTD
- transporter peptide sequence also known as cell permeable proteins (CPP) or membrane translocating sequences (MTS)
- CPP cell permeable proteins
- MTS membrane translocating sequences
- a nuclear localization signal can be found within the protein transduction domain, which mediates further translocation of the molecules into the cell nucleus.
- treating covers the treatment of a disease in a subject, such as a human, and includes: (i) inhibiting a disease, i.e., arresting its development; (ii) relieving a disease, i.e., causing regression of the disease; (iii) slowing progression of the disease; and/or (iv) inhibiting, relieving, or slowing progression of one or more symptoms of the disease.
- treating or “treatment” also encompasses regression of a tumor, slowing tumor growth, inhibiting metastasis of a tumor, inhibiting relapse or recurrent cancer and/or maintaining remission.
- the various modes of treatment or prevention of medical diseases and conditions as described are intended to mean “substantial,” which includes total but also less than total treatment or prevention, and wherein some biologically or medically relevant result is achieved.
- the treatment can be a continuous prolonged treatment for a chronic disease or a single, or few time administrations for the treatment of an acute condition.
- terapéutica means a treatment and/or prophylaxis. A therapeutic effect is obtained by suppression, remission, or eradication of a disease state.
- the present disclosure relates, in part, to the treatment of cancer in a subject by administering a composition comprising one or more immune cells having anti-tumor activity (e.g., immune cells that modulate a response against a tumor, such as tumor-infiltrating lymphocytes (TILs)), wherein the one or more immune cells are contacted with a PTD-MYC fusion polypeptide in vitro prior to administration to the subject.
- the immune cells are obtained from a donor subject that has a tumor.
- the cells are autologous to the subject receiving treatment.
- the tumor is a melanoma tumor.
- the present disclosure is based, at least in part, on the discovery, that treating lymphocytes isolated from a donor subject having a melanoma tumor with a MYC fusion polypeptide containing a MYC polypeptide and a protein transduction domain (PTD), such as the HIV TAT protein transduction domain, and administering the treated lymphocytes to a subject bearing a melanoma tumor significantly increases the survival of the tumor-bearing subject.
- PTD protein transduction domain
- the method for the treatment of cancer in a subject comprises administering immune cells that have been contacted in vitro with a PTD-MYC fusion polypeptide.
- the immune cells for use in the present methods are primed in vivo with tumor antigen.
- the immune cells are from a donor having cancer.
- the immune cells are from a donor having a solid tumor, such as a melanoma, carcinoma, adenoma, adenocarcinoma, blastoma, sarcoma, or lymphoma.
- the immune cells are contacted in vivo with a tumor antigen.
- the immune cells are from a donor that has been exposed to a one or more tumor antigens. In some embodiments, the immune cells are from a donor that has been exposed to an anti-tumor vaccine. In some embodiments, the immune cells are B cells, T cells, NK cells, or any combination thereof. In some embodiments, the immune cells are tumor infiltrating lymphocytes (TIL). In some embodiments, the immune cells are chimeric antigen receptor (CAR)-T cells.
- TIL tumor infiltrating lymphocytes
- CAR chimeric antigen receptor
- the method for the treatment of cancer in a subject comprises administering one or more modified immune cells to the subject in need thereof, wherein the one or more modified immune cells comprise a MYC fusion peptide comprising (i) a protein transduction domain; (ii) a MYC polypeptide sequence and are reactive to a tumor-specific antigen.
- the method for the treatment of cancer in a subject comprises the steps of:
- contacting the immune cells in vitro with a PTD-MYC fusion polypeptide is performed by culturing the immune cells in the presence of the MYC fusion polypeptide.
- the immune cells are cultured in the presence of one or more cytokines and/or growth factors (e.g., interleukin-2 (IL-2), IL-4, IL-7, IL-9, and IL-15).
- IL-2 interleukin-2
- IL-4 interleukin-4
- IL-7 interleukin-7
- IL-9 interleukin-9
- IL-15 interleukin-15
- the immune cells are not expanded prior to administration.
- the immune cells are expanded prior to administration.
- the donor and subject for treatment are the same.
- the immune cells are tumor-infiltrating lymphocytes.
- the tumor-infiltrating lymphocytes are autologous tumor-infiltrating lymphocytes.
- the method for the treatment of cancer in a subject comprises administering lymphocytes that have been contacted in vitro with a PTD-MYC fusion polypeptide, wherein the immune cells are from lymphocytes are autologous tumor-infiltrating lymphocytes from the subject.
- the method for the treatment of cancer in a subject comprises the steps of:
- lymphocytes in vitro with a PTD-MYC fusion polypeptide, wherein the lymphocytes are autologous tumor-infiltrating lymphocytes from the subject, and
- the immune cells are primary immune cells.
- the immune cells are lymphocytes, such as T and B cells.
- the immune cells are natural killer (NK) cells.
- the immune cells are a mixture of lymphocytes and NK cells.
- the immune cells are peripheral blood mononuclear cells (PBMC).
- the immune cells are T cells that have infiltrated a tumor (e.g., tumor infiltrating lymphocytes).
- the T cells are removed during surgery of a tumor.
- the T cells are isolated after removal of tumor tissue by biopsy.
- the immune cells are modified following isolation from a donor.
- the immune cells are chimeric antigen receptor (CAR)-T cells.
- the T cells are isolated from sample containing a population of cells, such as a blood, lymph or tissue biopsy sample.
- T cells can be isolated from a population of cells by any means known in the art.
- the method comprises obtaining a bulk population of T cells from a tumor sample by any suitable method known in the art.
- a bulk population of T cells can be obtained from a tumor sample by dissociating the tumor sample into a cell suspension from which specific cell populations can be selected.
- Suitable methods of obtaining a bulk population of T cells can include, but are not limited to, any one or more of mechanically dissociating (e.g., mincing) the tumor, enzymatically dissociating (e.g., digesting) the tumor, and aspiration (e.g., as with a needle).
- mechanically dissociating e.g., mincing
- enzymatically dissociating e.g., digesting
- aspiration e.g., as with a needle
- the bulk population of T cells obtained from a tumor sample can comprise any suitable type of T cell.
- the bulk population of T cells obtained from a tumor sample comprises tumor infiltrating lymphocytes (TILs).
- the tumor sample can be obtained from any mammal.
- mammal refers to any mammal including, but not limited to, mammals of the order Logomorpha, such as rabbits; the order Carnivora, including Felines (cats) and Canines (dogs); the order Artiodactyla, including Bovines (cows) and Swines (pigs); or of the order Perssodactyla, including Equines (horses).
- the mammals can be non-human primates, e.g., of the order Primates, Ceboids, or Simoids (monkeys) or of the order Anthropoids (humans and apes).
- the mammal can be a mammal of the order Rodentia, such as mice and hamsters.
- the mammal is a non-human primate or a human.
- An exemplary mammal is a human.
- the subject to receive the immune cells is also the donor of the tumor sample (i.e., autologous ACT)
- T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, spleen tissue, and tumors.
- T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll separation.
- cells from the circulating blood of an individual are obtained by apheresis or leukopheresis.
- the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
- the cells collected by apheresis can be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
- the cells are washed with phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- the wash solution lacks calcium and can lack magnesium or can lack many if not all divalent cations. Initial activation steps in the absence of calcium lead to magnified activation. As those of ordinary skill in the art would readily appreciate, a washing step can be
- the cells can be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS.
- a semi-automated "flow- through” centrifuge for example, the Cobe 2991 cell processor
- the cells can be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS.
- the undesirable components of the apheresis sample can be removed and the cells directly resuspended in culture media.
- T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient.
- a specific subpopulation of T cells such as CD28+, CD4+, CDC, CD45RA+, and CD45RO+ T cells, can be further isolated by positive or negative selection techniques.
- T cells are isolated by incubation with anti- CD3/anti-CD28 (i.e., 3 28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, or XCYTE DYNABEADSTM for a time period sufficient for positive selection of the desired T cells.
- the time period is about 30 minutes.
- the time period ranges from 30 minutes to 36 hours or longer and all integer values there between.
- the time period is at least 1, 2, 3, 4, 5, or 6 hours.
- the time period is 10 to 24 hours. In one embodiment, the incubation time period is 24 hours.
- use of longer incubation times, such as 24 hours can increase cell yield. Longer incubation times can be used to isolate T cells in any situation where there are few T cells as compared to other cell types, such in isolating tumor infiltrating lymphocytes (TIL) from tumor tissue or from immunocompromised individuals. Further, use of longer incubation times can increase the efficiency of capture of CD8+ T cells.
- TIL tumor infiltrating lymphocytes
- Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
- the method is cell sorting and/or selection via negative magnetic
- a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CDl lb, CD16, HLA-DR, and CD8.
- monocyte populations i.e., CD14+ cells
- monocyte populations can be depleted from blood preparations by a variety of methodologies, including anti-CD 14 coated beads or columns, or utilization of the phagocytotic activity of these cells to facilitate removal.
- the invention uses paramagnetic particles of a size sufficient to be engulfed by phagocytotic monocytes.
- the paramagnetic particles are commercially available beads, for example, those produced by Life Technologies under the trade name DynabeadsTM.
- other non-specific cells are removed by coating the paramagnetic particles with "irrelevant" proteins (e.g., serum proteins or antibodies).
- Irrelevant proteins and antibodies include those proteins and antibodies or fragments thereof that do not specifically target the T cells to be isolated.
- the irrelevant beads include beads coated with sheep anti-mouse antibodies, goat anti-mouse antibodies, and human serum albumin.
- depletion of monocytes is performed by preincubating T cells isolated from whole blood, apheresed peripheral blood, or tumors with one or more varieties of irrelevant or non-antibody coupled paramagnetic particles at any amount that allows for removal of monocytes (approximately a 20: 1 beadxell ratio) for about 30 minutes to 2 hours at 22 to 37 degrees C, followed by magnetic removal of cells which have attached to or engulfed the paramagnetic particles.
- Such separation can be performed using standard methods available in the art.
- any magnetic separation methodology can be used including a variety of which are commercially available, (e.g., DYNAL® Magnetic Particle Concentrator (DYNAL MPC®)).
- DYNAL MPC® Magnetic Particle Concentrator
- Assurance of requisite depletion can be monitored by a variety of methodologies known to those of ordinary skill in the art, including flow cytometric analysis of CD 14 positive cells, before and after depletion.
- the concentration of cells and surface can be varied.
- it can be desirable to significantly decrease the volume in which beads and cells are mixed together i.e., increase the concentration of cells, to ensure maximum contact of cells and beads.
- a concentration of 2 billion cells/ml is used.
- a concentration of 1 billion cells/ml is used.
- greater than 100 million cells/ml is used.
- a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
- a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used.
- concentrations can result in increased cell yield, cell activation, and cell expansion.
- use of high cell concentrations allows more efficient capture of cells that can weakly express target antigens of interest, such as CD28- negative T cells, or from samples where there are many tumor cells present (e.g., leukemic blood, tumor tissue). Such populations of cells can have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
- the mixture of T cells and surface e.g., particles such as beads
- interactions between the particles and cells is minimized.
- This selects for cells that express high amounts of desired antigens to be bound to the particles.
- CD4+ T cells express higher levels of CD28 and are more efficiently captured than CD8+ T cells in dilute
- the concentration of cells used is 5x l0 6 /ml. In other embodiments, the concentration used can be from about 1 x 10 5 /ml to 1 x 10 6 /ml, and any integer value in between.
- T cells can also be frozen.
- the freeze and subsequent thaw step can provide a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
- the cells can be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this context, one method involves using PBS containing 20% DMSO and 8% human serum albumin, or other suitable cell freezing media, the cells then are frozen to -80° C at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing can be used as well as uncontrolled freezing immediately at -20° C. or in liquid nitrogen.
- T cells for use in the present invention can also be antigen-specific T cells.
- tumor-specific T cells can be used.
- antigen-specific T cells can be isolated from a patient of interest, such as a patient afflicted with a cancer, such as patient with a tumor. In some embodiments, the patient has melanoma.
- neoepitopes are determined for a subject and T cells specific to these antigens are isolated.
- Antigen-specific cells for use in expansion can also be generated in vitro using any number of methods known in the art, for example, as described in U.S. Patent Publication No. US 20040224402 entitled, Generation And Isolation of Antigen-Specific T Cells, or in U.S. Pat. Nos. 6,040,177.
- Antigen-specific cells for use in the present invention can also be generated using any number of methods known in the art, for example, as described in Current Protocols in Immunology, or Current Protocols in Cell Biology, both published by John Wiley & Sons, Inc., Boston, Mass.
- sorting or positively selecting antigen-specific cells can be carried out using peptide- MHC tetramers (Altman, et al, 1996 Science. Oct. 4; 274(5284):94-6).
- the adaptable tetramer technology approach is used (Andersen et al., 2012 NatProtoc. 7:891- 902). Tetramers are limited by the need to utilize predicted binding peptides based on prior hypotheses, and the restriction to specific HLAs.
- Peptide-MHC tetramers can be generated using techniques known in the art and can be made with any MHC molecule of interest and any antigen of interest as described herein. Specific epitopes to be used in this context can be identified using numerous assays known in the art. For example, the ability of a polypeptide to bind to MHC class I can be evaluated indirectly by monitoring the ability to promote
- the T cells are recombinantly modified to express a modified or chimeric receptor (e.g., chimeric antigen receptor (CAR) modified T cells).
- a modified or chimeric receptor e.g., chimeric antigen receptor (CAR) modified T cells.
- CAR chimeric antigen receptor
- cells are directly labeled with an epitope-specific reagent for isolation by flow cytometry followed by characterization of phenotype and TCRs.
- T cells are isolated by contacting the T cell specific antibodies. Sorting of antigen- specific T cells, or generally any cells of the present invention, can be carried out using any of a variety of commercially available cell sorters, including, but not limited to, MoFlo sorter (DakoCytomation, Fort Collins, Colo.), FACSAriaTM, FACSArrayTM, FACSVantageTM, BDTM LSR II, and FACSCaliburTM (BD Biosciences, San Jose, Calif).
- the method comprises selecting cells that also express CD3.
- the method can comprise specifically selecting the cells in any suitable manner.
- the selecting is carried out using flow cytometry.
- the flow cytometry can be carried out using any suitable method known in the art.
- the flow cytometry can employ any suitable antibodies and stains.
- the antibody is chosen such that it specifically recognizes and binds to the particular biomarker being selected.
- the specific selection of CD3, CD8, TIM-3, LAG-3, 4-1BB, or PD-1 can be carried out using anti-CD3, anti-CD8, anti-TFM-3, anti-LAG-3, anti-4-lBB, or anti-PD-1 antibodies, respectively.
- the antibody or antibodies can be conjugated to a bead (e.g., a magnetic bead) or to a fluorochrome.
- the flow cytometry is fluorescence-activated cell sorting (FACS).
- TCRs expressed on T cells can be selected based on reactivity to autologous tumors.
- T cells that are reactive to tumors can be selected for based on markers using the methods described in patent publication Nos. WO2014133567 and WO2014133568, herein incorporated by reference in their entirety.
- activated T cells can be selected for based on surface expression of CD 107a.
- the method further comprises expanding the numbers of T cells in the enriched cell population.
- the T cells can be expanded before or after treatment of the cells with the PTD-MYC polypeptide.
- the numbers of T cells can be increased at least about 3-fold (or 4-, 5-, 6-, 7-, 8-, or 9-fold), more preferably at least about 10-fold (or 20- , 30-, 40-, 50-, 60-, 70-, 80-, or 90-fold), more preferably at least about 100-fold, more preferably at least about 1,000 fold, or most preferably at least about 100,000-fold.
- the numbers of T cells can be expanded using any suitable method known in the art. Exemplary methods of expanding the numbers of cells are described in patent publication No. WO 2003057171, U.S. Patent No. 8,034,334, and U.S. Patent Application Publication No. 2012/0244133, each of which is incorporated herein by reference.
- ex vivo T cell expansion can be performed by isolation of T cells and subsequent stimulation or activation followed by further expansion.
- the T cells can be stimulated or activated by a single agent.
- T cells are stimulated or activated with two agents, one that induces a primary signal and a second that is a co-stimulatory signal.
- Ligands useful for stimulating a single signal or stimulating a primary signal and an accessory molecule that stimulates a second signal can be used in soluble form. Ligands can be attached to the surface of a cell, to an Engineered
- both primary and secondary agents are co-immobilized on a surface, for example a bead or a cell.
- the molecule providing the primary activation signal can be a CD3 ligand
- the co-stimulatory molecule can be a CD28 ligand or 4- IBB ligand.
- the cells are expanded by stimulation with one or more antigens, such as a melanoma tumor antigen or antigens derived from the patient's tumor.
- the isolated immune cells are immediately treated with the PTD-MYC fusion polypeptide following isolation.
- the isolated immune cells are stored in a suitable buffer and frozen prior to treatment with the PTD-MYC fusion polypeptide. In some embodiments, the isolated immune cells are immediately treated with the PTD-MYC fusion polypeptide following isolation and the treated cells are stored in a suitable buffer and frozen until needed for administration to the patient.
- the isolated immune cells e.g., a mixed population immune cells or isolated types, such as tumor infiltrating lymphocytes
- a composition containing a PTD-MYC fusion polypeptide for a period of time sufficient to be taken up by the cells.
- the immune cells are contacted with a composition containing a PTD-MYC fusion polypeptide for less than about 24 hours, less than about 23 hours, less than about 22 hours, less than about 21 hours, less than about 20 hours, less than about 19 hours, less than about 18 hours, less than about 17 hours, less than about 16 hours, less than about 15 hours, less than about 14 hours, less than about 13 hours, less than about 12 hours, less than about 11 hours, less than about 10 hours, less than about 9 hours, less than about 8 hours, less than about 7 hours, less than about 6 hours, less than about 5 hours, less than about 4 hours, less than about 3 hours, less than about 2 hours, or less than about 1 hour.
- a composition containing a PTD-MYC fusion polypeptide for less than about 24 hours, less than about 23 hours, less than about 22 hours, less than about 21 hours, less than about 20 hours, less than about 19 hours, less than about 18 hours, less than about 17 hours, less than about 16 hours, less than about 15 hours, less than
- the immune cells are contacted with a composition containing a PTD-MYC fusion polypeptide for less than about 55 minutes, less than about 50 minutes, less than about 45 minutes, less than about 40 minutes, less than about 35 minutes, less than about 30 minutes, less than about 29 minutes, less than about 28 minutes, less than about 27 minutes, less than about 26 minutes, less than about 25 minutes, less than about 24 minutes, less than about 23 minutes, less than about 22 minutes, less than about 21 minutes, less than about 20 minutes, less than about 19 minutes, less than about 18 minutes, less than about 17 minutes, less than about 16 minutes, less than about 15 minutes, less than about 14 minutes, less than about 13 minutes, less than about 12 minutes, less than about 11 minutes, or less than about 10 minutes.
- the immune cells are contacted with a composition containing a PTD- MYC fusion polypeptide for about 1 hour.
- the immune cells are contacted with a composition containing a PTD-MYC fusion polypeptide for 24 hours or longer.
- the immune cells are contacted with a composition containing a PTD-MYC fusion polypeptide for less than about 12 days, less than about 11 days, less than about 10 days, less than about 9 days, less than about 8 days, less than about 7 days, less than about 6 days, less than about 5 days, less than about 4 days, less than about 2 days, or less than about 1 day.
- the cells are contacted with a MYC-fusion polypeptide at a concentration of 0 ⁇ g/ml to 500 ⁇ g/ml.
- a concentration of 0 ⁇ g/ml to 500 ⁇ g/ml. 0.5 ⁇ g/ml, at least 0 ⁇ g/ml, at least 0 ⁇ g/ml, at least 0 ⁇ g/ml, at least 0 ⁇ g/ml, at least ⁇ g/ml, at least 2 ⁇ g/ml, at least 3 ⁇ g/ml, at least 4 ⁇ g/ml, at least 5 ⁇ g/ml, at least 6 ⁇ g/ml, at least 7 ⁇ g/ml, at least 8 ⁇ g/ml, at least 9 ⁇ g/ml, at least 10 ⁇ g/ml, at least 15 ⁇ g/ml, at least 20 ⁇ g/ml, at least 25 ⁇ , at least 30 ⁇ g/ml, at least 35 ⁇ g/ml, at least 40 ⁇ g/ml, at least 45 ⁇ g/
- the PTD-MYC fusion polypeptide comprises a protein transduction domain (PTD), a MYC polypeptide that promotes one or more of cell survival or proliferation, and optionally a protein tag domain, e.g., one or more amino acid sequences that facilitate purification of the fusion protein.
- PTD protein transduction domain
- MYC polypeptide that promotes one or more of cell survival or proliferation
- a protein tag domain e.g., one or more amino acid sequences that facilitate purification of the fusion protein.
- a cell contacted with MYC polypeptide exhibits increased survival time (e.g., as compared to an identical or similar cell of the same type that was not contacted with MYC ), and/or increased proliferation (e.g., as compared to an identical or similar cell of the same type that was not contacted with MYC ).
- the fusion protein comprises (a) a protein transduction domain; and (b) a MYC polypeptide sequence.
- the fusion peptide is a peptide of Formula (I):
- a fusion peptide disclosed herein comprises (a) a protein transduction domain; (b) a MYC polypeptide sequence; and (c) one or more molecules that link the protein transduction domain and the MYC polypeptide sequence.
- the fusion peptide is a peptide of Formula (II):
- -X- is molecule that links the protein transduction domain and the MYC polypeptide sequence.
- -X- is at least one amino acid.
- a fusion peptide disclosed herein comprises (a) a protein transduction domain; (b) a MYC polypeptide sequence; (c) at least two protein tags; and (d) optionally linker(s).
- the fusion peptide is a peptide of Formula (III- VI): protein transduction domain-X-MYC polypeptide sequence-X-protein tag 1-X-protein tag 2
- -X- is a linker.
- -X- is one or more amino acids.
- a fusion peptide disclosed herein comprises (a) a protein transduction domain; (b) a MYC polypeptide sequence; (c) a 6-histidine tag; (d) a V5 epitope tag: and (e) optionally linker(s).
- the fusion peptide is a peptide of Formula (VII-XIV):
- -X- is a linker.
- -X- is one or more amino acids.
- the MYC fusion protein comprises one or more linker sequences.
- the linker sequences can be employed to link the protein transduction domain, MYC polypeptide sequence, V5 epitope tag and/or 6-histidine tag of the fusion protein.
- the linker comprises one or more amino acids.
- the amino acid sequence of the linker comprises KGELNSKLE.
- the linker comprises the amino acid sequence of RTG.
- the MYC fusion protein includes a protein transduction domain.
- Peptide transport provides an alternative for delivery of small molecules, proteins, or nucleic acids across the cell membrane to an intracellular compartment of a cell.
- PTD protein transduction domain
- One non- limiting example and well-characterized protein transduction domain (PTD) is a TAT-derived peptide.
- Frankel et al. (see, e.g., U.S. Pat. No. 5,804,604, U.S. Pat. No. 5,747,641, U.S. Pat. No. 5,674,980, U.S. Pat. No. 5,670,617, and U.S. Pat. No.
- TAT comprises an amino acid sequence of MRKKRRQRRR (SEQ ID NO: 7).
- Penetratin can transport hydrophilic macromolecules across the cell membrane (Derossi et a/., Trends Cell Biol, 8:84-87 (1998) incorporated herein by reference in its entirety). Penetratin is a 16 amino acid peptide that corresponds to amino acids 43-58 of the homeodomain of Antennapedia, a Drosophila transcription factor which is internalized by cells in culture.
- VP22 a tegument protein from Herpes simplex virus type 1 (HSV-1), has the ability to transport proteins and nucleic acids across a cell membrane (Elliot et al, Cell 88:223-233, 1997, incorporated herein by reference in its entirety). Residues 267-300 of VP22 are necessary but cannot be sufficient for transport. Because the region responsible for transport function has not been identified, the entire VP22 protein is commonly used to transport cargo proteins and nucleic acids across the cell membrane (Schwarze et al, Trends Pharmacol Sci, 21 :45-48, 2000).
- HSV-1 Herpes simplex virus type 1
- the PTD-MYC fusion polypeptide includes a protein transduction domain.
- the protein transduction domain comprises the protein transduction domain of one or more of TAT, penetratin, VP22, vpr, EPTD, R9, R15, VP 16, and Antennapedia.
- the protein transduction domain comprises the protein transduction domain of one or more of TAT, penetratin, VP22, vpr, and EPTD.
- the protein transduction domain comprises the protein transduction domain of at least one of TAT, penetratin, VP22, vpr, EPTD, R9, R15, VP16, and Antennapedia.
- the protein transduction domain comprises a synthetic protein transduction domain (e.g., polyarginine or PTD-5).
- the protein transduction domain comprises a TAT protein transduction domain.
- the protein transduction domain is covalently linked to the MYC
- the protein transduction domain is linked to the MYC polypeptide via a peptide bond. In some embodiments, the protein transduction domain is linked to the MYC polypeptide via a linker sequence. In some embodiments, the linker comprises a short amino acid sequence. By way of example, but not by way of limitation, in some embodiments, the linker sequences is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids in length.
- the MYC fusion protein of the present technology can be arranged in any desired order.
- the MYC fusion protein can be arranged in order of a) the protein transduction domain linked in frame to the MYC polypeptide, b) the MYC polypeptide linked in frame to the V5 domain, and c) the V5 domain linked in frame to the 6- histidine epitope tag.
- the MYC fusion protein has an order of components of a) the MYC polypeptide linked in frame to the protein transduction domain, b) the protein transduction domain linked in frame to the V5 domain, and c) the V5 domain linked in frame to the 6-histidine epitope tag.
- additional amino acid sequences can be included between each of the sequences.
- additional amino acids can be included at the start and/or end of the polypeptide sequences.
- the protein transduction domain is a TAT protein transduction domain. In some embodiments, the protein transduction domain is ⁇ [48 . 5 . In some embodiments, the protein transduction domain is TAT[ 57 . 48 ].
- the MYC fusion protein comprises a protein tag domain that comprises one or more amino acid sequences that facilitate purification of the fusion protein.
- the protein tag domain comprises one or more of a polyhistidine tag, and an epitope tag.
- exemplary tags include one or more of a V5, a histidine-tag (e.g., a 6-histidine tag), HA (hemagglutinin) tags, FLAG tag, CBP (calmodulin binding peptide), CYD (covalent yet dissociable NorpD peptide), Strepll, or HPC (heavy chain of protein C).
- the protein tag domain comprise about 10 to 20 amino acids in length. In some embodiments, the protein tag domain comprises 2 to 40 amino acids in length, for example 6-20 amino acids in length. In some embodiments, two of the above listed tags (for example, V5 and the HIS-tag) are used together to form the protein tag domain.
- the histidine tag is a 6-histidine tag.
- the histidine tag comprises the sequence HHHHHH (SEQ ID NO:8).
- the fusion peptide disclosed herein comprises a V5 epitope tag.
- the V5 tag comprises the amino acid sequence of: GKPIPNPLLGLDST (SEQ ID NO:9).
- the V5 tag comprises the amino acid sequence of IP PLLGLD (SEQ ID NO: 10).
- the protein tags can be added to the fusion protein disclosed herein by any suitable method.
- a TAT-MYC polypeptide sequence is cloned into an expression vector encoding one or more protein tags, e.g., a polyHis-tag and/or a V5 tag.
- a polyhistidine tag and/or a V5 tag is added by PCR (i.e., the PCR primers comprise a polyhistidine sequence and/ or V5 sequence).
- PTD-MYC fusion polypeptides e.g., TAT-MYC fusion polypeptide
- a nucleotide sequence encoding a TAT-MYC fusion polypeptide can be generated by PCR.
- a forward primer for a human MYC sequence comprises an in frame N-terminal 9-amino-acid sequence of the TAT protein transduction domain (e.g., RKKRRQRRR).
- a reverse primer for a human MYC sequence is designed to remove the stop codon.
- the PCR product is cloned into any suitable expression vector.
- the expression vector comprises a
- polyhistidine tag and a V5 tag polyhistidine tag and a V5 tag.
- a fusion peptide disclosed herein comprises (a) TAT, and (b) c-MYC . In some embodiments, a fusion peptide disclosed herein comprises (a) TAT[ 48-57 ], and (b) c-MYC . In some embodiments, a fusion peptide disclosed herein comprises (a) TAT[ 57-48 ], and (b) c-MYC .
- a fusion peptide disclosed herein comprises (a) TAT, (b) c- MYC , (c) linker(s), (d) V5 tag, and (e) 6-histidine tag.
- a fusion peptide disclosed herein comprises (a) TAT [48-57 ], (b) c-MYC , (c) linker(s), (d) V5 tag, and (e) 6- histidine tag.
- a fusion peptide disclosed herein comprises (a) TAT [57-48 ], (b) c-MYC , (c) linker(s), (d) V5 tag, and (e) 6-histidine tag.
- the PTD-MYC fusion polypeptide comprises SEQ ID NO: 1; in some embodiments, the PTD-MYC fusion polypeptide is SEQ ID NO: 1.
- the fusion protein can be modified during or after synthesis to include one or more functional groups.
- the protein can be modified to include one or more of an acetyl, phosphate, acetate, amide, alkyl, and/or methyl group. This list is not intended to be exhaustive, and is exemplary only.
- the protein includes at least one acetyl group.
- a PTD-MYC fusion polypeptide can be generated by any suitable method known the art, e.g. by recombinant protein expression in a cell, such as a bacterial cell, an insect cell, or mammalian cell.
- a PTD-MYC fusion polypeptide is recombinantly produced by microbial fermentation.
- microbial fermentation is performed in a fermentation volume of from about 1 to about 10,000 liters, for example, a fermentation volume of about 10 to about 1000 liters.
- the fermentation can utilize any suitable microbial host cell and culture medium.
- E. coli is utilized as the microbial host cell.
- microorganisms can be used, e.g., S. cerevisiae, P. pastoris, Lactobacilli, Bacilli and Aspergilli.
- the microbial host cell is BL- 21 StarTME. coli strain (Invitrogen).
- the microbial host cell is BLR DE3 E.coli. strain.
- the host cells are modified to provide tRNAs for rare codons, which are employed to overcome host microbial cell codon bias to improve translation of the expressed proteins.
- the host cells e.g., E. coli
- a plasmid such as pRARE (CamR), which express tRNAs for AGG, AGA, AUA, CUA, CCC, GGA codons.
- pRARE CamR
- Additional, suitable plasmids or constructs for providing tRNAs for particular codons are known in the art and can be employed in the methods provided.
- Integrative or self-replicative vectors can be used for the purpose of introducing the PTD-MYC fusion polypeptide expression cassette into a host cell of choice.
- the coding sequence for the PTD-MYC fusion polypeptide is operably linked to promoter, such as an inducible promoter.
- Inducible promoters are promoters that initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, e.g., the presence or absence of a nutrient or a change in temperature.
- the nucleic acid encoding the PTD-MYC fusion polypeptide is codon optimized for bacterial expression.
- promoters that are recognized by a variety of potential host cells are well known. These promoters can be operably linked to PTD-MYC fusion polypeptide-encoding DNA by removing the promoter from the source DNA, if present, by restriction enzyme digestion and inserting the isolated promoter sequence into the vector.
- Promoters suitable for use with microbial hosts include, but are not limited to, the ⁇ -lactamase and lactose promoter systems (Chang et al, (191 ) Nature, 275:617-624; Goeddel et al, (1979) Nature, 281 : 544), alkaline phosphatase, a tryptophan (tip) promoter system (Goeddel (1980) Nucleic Acids Res . 8: 4057; EP 36,776), and hybrid promoters such as the tac promoter (deBoer et al, (1983) Proc. Natl. Acad. Sci. USA 80: 21-25). Any promoter for suitable for expression by the selected host cell can be used.
- promoters for use in bacterial systems can contain a Shine- Dalgarno (S.D.) sequence operably linked to the coding sequence.
- the inducible promoter is the lacZ promoter, which is induced with Isopropyl ⁇ -D-l- thiogalactopyranoside (IPTG), as is well-known in the art.
- Promoters and expression cassettes can also be synthesized de novo using well known techniques for synthesizing DNA sequences of interest.
- the expression vector for expression of the PTD-MYC fusion polypeptides herein is pET101/D-Topo (Invitrogen).
- the microbial host containing the expression vector encoding the PTD-MYC fusion polypeptide is typically grown to high density in a fermentation reactor.
- the reactor has controlled feeds for glucose.
- a fermenter inoculum is first cultured in medium supplemented with antibiotics (e.g., overnight culture). The fermenter inoculum is then used to inoculate the fermenter culture for expression of the protein. At an OD600 of at least about 15, usually at least about 20, at least 25, at least about 30 or higher, of the fermenter culture, expression of the recombinant protein is induced.
- IPTG is added to the fermentation medium to induce expression of the PTD- MYC fusion polypeptide.
- the IPTG is added to the fermenter culture at an OD600 which represents logarithmic growth phase.
- induced protein expression is maintained for around about 2 to around about 5 hours post induction, and can be from around about 2 to around about 3 hours post-induction. Longer periods of induction may be undesirable due to degradation of the recombinant protein.
- the temperature of the reaction mixture during induction is preferably from about 28°C to about 37°C, usually from about 30°C to about 37°C. In particular embodiments, induction is at about 37°C.
- the PTD-MYC fusion polypeptide is typically expressed as cytosolic inclusion bodies in microbial cells.
- a cell pellet is collected by centrifugation of the fermentation culture following induction, frozen at -70°C or below, thawed and resuspended in disruption buffer.
- the cells are lysed by conventional methods, e.g., sonication, homogenization, etc.
- the lysate is then resuspended in solubilization buffer, usually in the presence of urea at a concentration effective to solubilize proteins, e.g., from around about 5M, 6M, 7M, 8M, 9M or greater. Resuspension may require mechanically breaking apart the pellet and stirring to achieve homogeneity.
- the cell pellet is directly
- the urea buffer resuspended in urea buffer and mixed until homogenous.
- the urea buffer resuspended in urea buffer and mixed until homogenous.
- resuspension/solubilization buffer is 8M Urea, 50 mM Phosphate pH 7.5 and the suspension is passed through a homogenizer.
- the homogenized suspension is sulfonylated.
- the homogenized suspension is adjusted to include 200 mM Sodium Sulfite and 10 mM Sodium Tetrathionate.
- the solution is then mixed at room temperature until homogeneous.
- the mixed lysate is then mixed for an additional period of time to complete the sulfonylation (e.g., at 2-8°C for > 12 hours).
- the sulfonylated lysate was then centrifuged for an hour.
- the supernatant containing the sulfonylated PTD-MYC fusion polypeptides is then collected by centnfugation and the cell pellet discarded.
- the supernatant is then passed through a filter, e.g., 0.22 ⁇ membrane filter to clarify the lysate.
- the solubilized protein is then purified.
- Purification methods may include affinity chromatography, reverse phase chromatography, gel exclusion chromatography, and the like.
- affinity chromatography is used.
- the protein is provided with an epitope tag or histidine 6 tag for convenient purification.
- exemplary PTD-MYC fusion polypeptide comprise histidine 6 tag for purification using Ni affinity chromatography using Ni- resin.
- the Ni- resin column is equilibrated in a buffer containing urea.
- the equilibration buffer is 6M Urea, 50 mM Phosphate, 500 mM NaCl, and 10% Glycerol solution.
- the sulfonylated and clarified supernatant comprising the PTD-MYC fusion polypeptide is then loaded onto the Ni- resin column.
- the column is then washed with a wash buffer, e.g., 6M Urea, 50mM Phosphate, 10% Glycerol, 500 mM NaCl, pH 7.5.
- the column was then washed with sequential wash buffers with decreasing salt concentration.
- exemplary subsequent washed can include 6M Urea, 50mM Phosphate, 10% Glycerol, and 2M NaCl, pH 7.5, followed another wash of 6M Urea, 50mM Phosphate, 10% Glycerol, 50mM NaCl, and 30mM Imidazole, pH 7.5.
- the PTD-MYC fusion polypeptide is eluted from the column by addition of elution buffer, e.g., 6M Urea, 50mM Phosphate, 10% Glycerol, and 50mM NaCl, pH 7.5 with a gradient from 100 to 300 mM
- elution buffer e.g., 6M Urea, 50mM Phosphate, 10% Glycerol, and 50mM NaCl, pH 7.5 with a gradient from 100 to 300 mM
- Imidazole and collecting fractions.
- the protein containing fractions to be pooled are then filtered through a 0.22 ⁇ membrane.
- Assessment of protein yield can be measured using any suitable method, e.g., spectrophotometry at UV wavelength 280.
- one or more additional purification methods can be employed to further purify the isolated PTD-MYC fusion polypeptides.
- the pooled fractions from the Ni-Sepharose chromatography step are further purified by anion exchange chromatography using a Q-Sepharose resin.
- the pool is prepared for loading onto the Q-Sepharose column by diluting the samples to the conductivity of the Q sepharose buffer (17.52 +/-1 mS/cm) with the second wash buffer (e.g., 6M Urea, 50mM Phosphate, 10% Glycerol, 2M NaCl, pH 7.5) from the Ni Sepharose chromatography step.
- the second wash buffer e.g., 6M Urea, 50mM Phosphate, 10% Glycerol, 2M NaCl, pH 7.5
- the diluted pool is then loaded onto the Q-Sepharose column, followed by two chase steps using a chase buffer (e.g., 6M Urea, 50mM Phosphate, 300mM NaCl, and 10% Glycerol), with further sequential applications of the chase buffer until the UV trace reaches baseline, indicating that the protein has eluted from the column.
- a chase buffer e.g., 6M Urea, 50mM Phosphate, 300mM NaCl, and 10% Glycerol
- the PTD-MYC fusion polypeptide-modified immune cells are administered for the treatment of a cancer in a patient.
- the patient has a solid tumor.
- the patient has a carcinoma, adenoma, adenocarcinoma, blastoma, sarcoma, or lymphoma.
- the patient has a metastatic tumor.
- the patient has received one or more agents for the treatment of the cancer prior to administration of the PTD-MYC fusion polypeptide-modified immune cells.
- the cancer is a relapsed or refractory cancer.
- the cancer is resistant to one or more agents for the treatment of the cancer.
- Exemplary tumors in humans for methods of treatment include, but are not limited to, melanoma, bladder tumor, breast tumor, prostate tumor, carcinoma, basal cell carcinoma, biliary tract cancer, bladder cancer, bone cancer, brain cancer, CNS cancer, glioma tumor, cervical cancer, choriocarcinoma, colon and rectum cancer, connective tissue cancer, cancer of the digestive system, endometrial cancer, esophageal cancer, eye cancer, cancer of the head and neck, gastric cancer, intra-epithelial neoplasm, kidney cancer, larynx cancer, leukemia, liver cancer, lung cancer, lymphoma, Hodgkin's lymphoma, Non-Hodgkin's lymphoma, myeloma, neuroblastoma, oral cavity cancer, ovarian cancer, pancreatic cancer, retinoblastoma, rhabdomyosarcoma, rectal cancer, renal cancer, cancer of the respiratory system, sar
- administration of the PTD-MYC fusion polypeptide-modified immune cells inhibits growth of a tumor or reduces the volume of a tumor.
- administration of the PTD-MYC fusion polypeptide-modified immune cells to a subject having a cancer alleviates one or more symptoms of the cancer. In some embodiments, administration of the PTD-MYC fusion polypeptide-modified immune cells to a subject having cancer increases the overall survival of the subject. In some embodiments, administration of the PTD-MYC fusion polypeptide-modified immune cells to a subject having cancer increases the regression of the cancer.
- the administration of the PTD-MYC fusion polypeptide-modified immune cells can be carried out in any suitable manner for administering cells to a subject, including but not limited to injection, transfusion, implantation or transplantation.
- the PTD-MYC fusion polypeptide-modified immune cells are administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary,
- the PTD-MYC fusion polypeptide-immune cells are administered into a cavity formed by the resection of tumor tissue (i.e., intracavity delivery) or directly into a tumor prior to resection (i.e. intratumoral delivery).
- the MYC-fusion polypeptide- immune cells are administered by intravenous injection.
- compositions for administration can comprise any other agents such as pharmaceutically acceptable carriers, buffers, excipients, adjuvants, additives, antiseptics, filling, stabilizing and/or thickening agents, and/or any components normally found in corresponding products. Selection of suitable ingredients and appropriate manufacturing methods for formulating the compositions for particular routes of administration generally known in the art.
- the adoptive cell therapeutic composition comprising PTD-MYC fusion polypeptide- modified immune cells can be in any form, such as solid, semisolid or liquid form, suitable for administration.
- a formulation can be selected from a group consisting of, but not limited to, solutions, emulsions, suspensions, tablets, pellets and capsules.
- the compositions are not limited to a certain formulation, instead the composition can be formulated into any known
- the administration of the MYC-fusion polypeptide-modified immune cells comprises administering of 10 4 - 10 10 of the cells per kg body weight, including 10 5 to 10 6 cells/kg body weight, including all integer values of cell numbers within those ranges.
- the cells are administered with or without a course of lymphodepletion, for example with cyclophosphamide.
- the MYC-fusion polypeptide-modified immune cells can be administrated in one or more doses.
- the therapeutically effective amount of PTD-MYC fusion polypeptide-modified immune cells are administrated as a single dose.
- administering a single dose of the PTD-MYC fusion polypeptide-modified immune cells has a therapeutic effect.
- the effective amount of MYC-fusion polypeptide- modified immune cells are administrated as more than one dose over a period time. Timing of administration is within the judgment of managing physician and depends on various factors, including, but not limited to the age, gender, or clinical condition of the patient and
- MYC-fusion polypeptide- modified immune cell for treatment of a particular disease or conditions. While individual needs vary, determination of optimal ranges of effective amounts of a MYC-fusion polypeptide- modified immune cell for treatment of a particular disease or conditions are within the skill of one in the art.
- PTD-MYC fusion polypeptide-modified immune cells can be administered for example from 1 to 10 times in the first 2 weeks, 3 weeks, 4 weeks, monthly or during the treatment period. In some embodiments, PTD-MYC fusion polypeptide-modified immune cells are administered 2, 3, 4, 5, 6, 7, 8, 9, or 10 times. In some embodiments, PTD-MYC fusion polypeptide-modified immune cells are administered weekly, every 2 weeks, every 3 weeks or monthly.
- a therapeutically effective amount means an amount which provides a therapeutic or prophylactic benefit.
- the dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.
- a patient receiving PTD-MYC modified immune cells are first pretreated with one or more cytokines and/or other immunomodulatory agents.
- a patient receiving PTD-MYC modified immune cells is lymphodepleted prior to administration of the PTD-MYC modified immune cells. The purpose of lymphodepletion is to make room for the infused lymphocytes, in particular by eliminating regulatory T cells and other non-specific T cells which compete for homeostatic cytokines.
- the PTD-MYC modified immune cells are administered with an additional therapeutic agent.
- additional therapeutic agent is administered prior to, simultaneously with, intermittently with, or following treatment with the PTD-MYC modified immune cells.
- the additional therapeutic agent is an immunomodulator, such as an interleukin (e.g. IL-2, IL-7, IL-12), a cytokine, a chemokine, or and immunomodulatory drug.
- an immunomodulator such as an interleukin (e.g. IL-2, IL-7, IL-12), a cytokine, a chemokine, or and immunomodulatory drug.
- the modified immune cells administered for the treatment of cancer are T cells with genetically modified antigen receptors, including chimeric antigen receptor (CAR)-T cells.
- CAR chimeric antigen receptor
- Various strategies can, for example, be employed to genetically modify T cells by altering the specificity of the T cell receptor (TCR), for example, by introducing new TCR a and ⁇ chains with selected peptide specificity (see, e.g., U.S. Patent No.
- Chimeric antigen receptors can be used in order to generate immunoresponsive cells, such as T cells, specific for selected targets, such as malignant cells, with a wide variety of receptor chimera constructs having been described (see, e.g. U.S. Patent Nos.
- CAR T cells comprising a MYC fusion polypeptide (e.g. PTD) as described herein.
- PTD MYC fusion polypeptide
- CARs are comprised of an extracellular domain, a transmembrane domain, and an intracellular domain, wherein the extracellular domain comprises an antigen-binding domain that is specific for a predetermined target.
- the antigen-binding domain of a CAR is often an antibody or antibody fragment (e.g., a single chain variable fragment, scFv)
- the binding domain is not particularly limited so long as it results in specific recognition of a target.
- the antigen-binding domain may comprise a receptor, such that the CAR is capable of binding to the ligand of the receptor.
- the antigen- binding domain may comprise a ligand, such that the CAR is capable of binding the endogenous receptor of that ligand.
- the T cells expressing a desired CAR are selected through co- culture with ⁇ -irradiated activating and propagating cells (AaPC), which co-express the cancer antigen and co-stimulatory molecules.
- AaPC ⁇ -irradiated activating and propagating cells
- the engineered CAR T-cells are expanded, for example by co-culture on AaPC in presence of soluble factors, such as IL-2 and IL-21. This expansion can for example be carried out so as to provide memory CAR+ T cells.
- CAR T cells can be provided that have specific cytotoxic activity against antigen- bearing tumors (optionally in conjunction with production of desired chemokines such as interferon- ⁇ ).
- the CAR T-cells are contacted with a PTD-MYC fusion polypeptide provided herein in vitro to generation a modified CAR T cells for the treatment of a cancer.
- the modified CAR T cells can be administered according any suitable method, including the methods for administration of the PTD-MYC fusion polypeptide-modified immune cells as described above.
- Kits [0147] Pharmaceutical compositions comprising MYC-fusion polypeptides and/or MYC- fusion polypeptide-modified immune cells provided herein can be assembled into kits or pharmaceutical systems for use in treating a cancer.
- Kits according to this embodiment can comprise a carrier means, such as a box, carton, tube, having in close confinement therein one or more containers, such as vials, tubes, ampoules, bottles, syringes, or bags.
- the kits can also comprise associated instructions for using the MYC-fusion polypeptides and/or MYC-fusion polypeptide-modified immune cells.
- the kit comprises an effective amount of an adoptive cell therapy, such as MYC-fusion polypeptide-modified immune cells.
- the kit comprises one for more reagents for the detection of the administered MYC-fusion polypeptides and/or MYC-fusion polypeptide-modified immune cells.
- the kit comprises cells for treatment with a MYC-fusion polypeptide provided herein, for example, hematopoietic stem cells, donor leukocytes, T cells, or NK cells.
- the kit further comprises an effective amount of a therapeutic agent to be administered in combination with MYC-fusion polypeptides and/or MYC-fusion polypeptide-modified immune cells provided herein.
- therapeutic agent is an anti-cancer agent.
- Kits provided herein also can include a device for administering MYC-fusion polypeptides and/or MYC-fusion polypeptide-modified immune cells provided herein to a subject.
- a device for administering MYC-fusion polypeptides and/or MYC-fusion polypeptide-modified immune cells provided herein to a subject can include a hypodermic needle, an intravenous needle, a catheter, a needle-less injection, but are not limited to, a hypodermic needle, an intravenous needle, a catheter, a needle-less injection device, an inhaler and a liquid dispenser such as an eyedropper.
- the device for administering the MYC- fusion polypeptides and/or MYC-fusion polypeptide-modified immune cells of the kit will be compatible with the desired method of administration of the composition.
- a composition to be delivered intravenously can be included in a kit with a hypodermic needle and a syringe.
- Example 1 Immune cells treated with TAT-MYC to generate TAT-MYC-treated lymphocytes for immunotherapy of melanoma tumors
- C57BL/6J is the most widely used inbred strain and the first to have its genome sequenced. Although this strain is refractory to many tumors, it is a permissive background for maximal expression of most mutations. C57BL/6J mice are resistant to audiogenic seizures, have a relatively low bone density, and develop age-related hearing loss. They are also susceptible to diet-induced obesity, type 2 diabetes, and atherosclerosis. Macrophages from this strain are resistant to the effects of anthrax lethal toxin.
- B16-F10 melanoma cells (ATCC CRL 6475, mouse skin melanoma) for implantation were cultured in D10 media (DMEM, 10% FBS, Pen/Strep (10,000 units per/ml) (Gibco Cat# 15140); L-glutamine (200mM) (Gibco Cat# 25030); MEM Non-essential Amino Acids (Gibco Cat# 11140)).
- D10 media DMEM, 10% FBS, Pen/Strep (10,000 units per/ml)
- Pen/Strep 10,000 units per/ml
- L-glutamine 200mM
- MEM Non-essential Amino Acids (Gibco Cat# 11140)).
- mice Jackson Laboratory #003548
- 1 x 10 4 B 16- F10 melanoma cells 1 x 10 4 B 16- F10 melanoma cells in 250 ⁇ ⁇ PBS via tail vein injection.
- each test mouse was placed under a 250W heat lamp for 1-2 minutes and then injected intravenously with the melanoma cells.
- lymph nodes from the injected mice were harvested and ground with the plunger of a 10 mL syringe.
- lymph nodes were harvested from 5 mice.
- the cells were washed with CIO, collected and spun at 260 x g for 5 min. After discarding the supernatant, the cells were resuspended in lOmL sterile TAC, spun at 260 x g for 5 minutes. After discarding the supernatant, the cells were resuspended in 2mL of sterile filtered PBS with 5% BSA.
- the lymph node cells were treated with TAT-MYC to generate TAT-MYC lymphocytes or treated with a control TAT -Fusion protein.
- the cells were split into 2, 15mL conical tubes (lmL each), treated with lmL of 25ug/ml of a control protein (TAT-CRE for experiment 1, TAT-GFP for experiment 2) or lmL of 25ug/ml of TAT-MYC lot CI 8. After one hour of room temp incubation, each tube was washed with sterile PBS three times, transferred to 5mL sterile tubes and placed on ice.
- test mice were prepared by injecting 1 x 10 4 B16-F10 melanoma cells in 250uL PBS into the tail vein for each cohort of 5 C57BL/6j mice. After injection, the mice were observed once daily. Changes in body weight, food consumption, activity, and mortality were monitored. At 7 days post-transplant, TAT-MYC lymphocytes or control lymphoid cells were then transplanted into melanoma cell injected mice.
- TAT-MYC- treated lymphocytes for immunotherapy of melanoma tumors was examined.
- This experiment was performed as described above in Example 1, except that several different doses of the TAT- MYC-treated lymphocytes were injected and compared. Two experiments were performed. In the first experiment, Experiment 3, TAT-MYC lymphocytes were administered to the first experiment.
- melanoma-bearing mice via tail vein injection according to the following dosing groups: 3. Ox 10 6 cells/kg, 6.0 l0 6 cells/kg, 14.0 10 6 cells/kg, and 70.0 ⁇ 10 6 cells/kg.
- the mice were administered 70.
- TAT-MYC lymphocytes were administered to the melanoma-bearing mice via tail vein injection according to the following dosing groups: 4.0x l0 3 cells/kg, 4.0x l0 4 cells/kg, 4.0x l0 5 cells/kg, 4.0 ⁇ 10 6 cells/kg and 4.0 ⁇ 10 7 cells/kg.
- mice were administered 4.0x l0 6 TAT-Cre treated or no cells (NT).
- NT no cells
- the results from Experiments 3 and 4 are shown in Figures 3 and 4, respectively.
- treating melanoma-bearing mice with increasing amounts of TAT-MYC lymphocytes (TBX-3400) led to a significantly improved overall survival rate in both experiments.
- Example 3 Immune cells treated with TAT-MYC to generate TAT-MYC-treated lymphocytes for immunotherapy of colon cancer
- MC-38 murine colon adenocarcinoma cells (Kerafast #ENH204) for implantation were cultured in D10 media (DMEM, 10% FBS, Pen/Strep (10,000 units per/ml) (Gibco Cat# 15140); L-glutamine (200mM) (Gibco Cat# 25030); MEM Non-essential Amino Acids (Gibco Cat# 11140)).
- lymph nodes from the nine injected donor mice were harvested and ground with the plunger of a 10 mL syringe.
- the cells were washed with CIO, collected and spun at 260 ⁇ g for 5 min. After discarding the supernatant, the cells were resuspended in lOmL sterile TAC, spun at 260 x g for 5 minutes. After discarding the supernatant, the cells were resuspended in 2mL of sterile filtered PBS with 5% BSA.
- the lymph node cells were treated with TAT-MYC to generate TAT-MYC lymphocytes or treated with a control TAT-Fusion protein.
- the cells were split into 2, 15mL conical tubes (lmL each), treated with lmL of 25ug/ml of a control TAT -fusion protein (TAT-CRE) or lmL of 25ug/ml of TAT- MYC lot CI 8. After one hour of room temp incubation, each tube was washed with sterile PBS three times, transferred to 5mL sterile tubes and placed on ice.
- TAT-CRE control TAT -fusion protein
- mice 125,000 lymph cells were then injected in 250uL PBS into the tail vein of each recipient mouse (equivalent to 5 x 10 6 cells/kg) to create 3 cohorts of 6 mice each: one cohort of no treatment control, one cohort treated with lymphoid cells derived from tumor-bearing mice and treated with control TAT-fusion protein, and one cohort treated with lymphoid cells derived from tumor-bearing mice and treated with TAT-MYC fusion protein (TAT-MYC lymphocytes).
- TAT-MYC lymphocytes TAT-MYC lymphocytes
- TAT-MYC- treated lymphocytes were administered to the melanoma-bearing mice via tail vein injection according to the following dosing groups (5 tumor bearing mice per group): 5. Ox 10 3 cells/kg, 5. Ox 10 4 cells/kg, 5.0x 10 s cells/kg, 5.0 ⁇ 10 6 cells/kg, 5.0 ⁇ 10 7 cells/kg, and 5.0 ⁇ 10 8 cells/kg, cells/kg.
- mice were administered no cells (NT) (8 mice), or 5.0 ⁇ 10 7 cells/kg was administered to non-tumor bearing mice (5 mice).
- NT no cells
- mice 5.0 ⁇ 10 7 cells/kg was administered to non-tumor bearing mice (5 mice).
- the results from this experiment are shown in Figure 6.
- treating melanoma-bearing mice with increasing amounts of TAT-MYC lymphocytes (TBX-3400) led to a significantly improved overall survival rate.
- 75% of the animals died by Day 19 and the remaining untreated mice died by day 41 post tumor transplant. All of the mice receiving 5xl0 3 cells/kg died by Day 19.
- mice that received 5xl0 7 cells/kg survived throughout the study. All the mice that received 5xl0 8 cells/kg presented with thinning of their fur. 40% of the mice receiving 5xl0 8 cells/kg died by day 41. The remaining 60% of mice that received 5xl0 8 cells/kg survived throughout the study.
- Example 5 Immune cells treated with TAT-MYC to generate TAT-MYC-treated lymphocytes for immunotherapy of solid tumors
- a PTD-MYC fusion polypeptide comprising the protein transduction domain of HIV- 1 transactivation protein (TAT) and MYC to modulate an immune response against additional tumor cell types in vivo.
- TAT HIV- 1 transactivation protein
- lymphoid cells derived from tumor-bearing mice and treated with TAT-MYC
- the object of these studies is to determine whether immune cells derived from tumor bearing mice and treated with TAT-MYC to generate TAT-MYC lymphocytes is an effective treatment for solid tumors upon transplantation into tumor bearing mice.
- Lung Non-small A-427, A549, H1299, H1975, H226, H23, H292, H460, H520, H522, H647, cell
- Lymphoma Daudi DoHH-2, Granta 519, JEKO-1, KARPAS-299, MOLT-4, Raji B,
- Solid tumor cells for implantation are cultured in D10 media (DMEM, 10% FBS, Pen/Strep (10,000 units per/ml) (Gibco Cat# 15140); L-glutamine (200mM) (Gibco Cat# 25030); MEM Non-essential Amino Acids (Gibco Cat# 1 1 140)).
- DMEM 10% FBS, Pen/Strep (10,000 units per/ml)
- Pen/Strep 10,000 units per/ml
- L-glutamine 200mM
- MEM Non-essential Amino Acids Gibco Cat# 1 1 140
- mice (Jackson Laboratory #003548) are implanted with 1 ⁇ 10 4 tumor cells in 250 iL PBS via tail vein injection. Prior to injection, each test mouse was placed under a 250W heat lamp for 1-2 minutes and then injected intravenously with the tumor cells. At 14 days post-transplant, lymph nodes from the injected mice are harvested and ground with the plunger of a 10 mL syringe.
- lymph nodes are harvested from 5 mice.
- lymph nodes were harvested from 10 mice.
- the cells are washed with CIO, collected and spun at 260 ⁇ g for 5 min. After discarding the supernatant, the cells are resuspended in lOmL sterile TAC, spun at 260 x g for 5 minutes. After discarding the supernatant, the cells are resuspended in 2mL of sterile filtered PBS with 5% BSA.
- lymph node cells are treated with TAT-MYC to generate TAT-MYC
- lymphocytes or treated with a control TAT -Fusion protein are split into 2, 15mL conical tubes (lmL each), treated with lmL of 25ug/ml of a control protein (TAT-CRE for experiment 1, TAT-GFP for experiment 2) or lmL of 25ug/ml of TAT-MYC lot CI 8. After one hour of room temp incubation, each tube is washed with sterile PBS three times, transferred to 5mL sterile tubes and placed on ice.
- test mice are prepared by injecting 1 x 10 4 tumor cells in 250uL PBS into the tail vein for each cohort of 5 C57BL/6j mice. After injection, the mice are observed once daily. Changes in body weight, food consumption, activity, and mortality are monitored. At 7 days post-transplant, TAT-MYC lymphocytes or control lymphoid cells are then transplanted into tumor cell injected mice.
- mice are euthanized when severe symptoms presented and deaths are recorded. Mice are either found dead or euthanized if found with severe symptoms such as heavy breathing, hunched back and immobility. Day of death is recorded with day of treatment as Day 0.
- TAT-MYC lymphocytes TAT-MYC lymphocytes (TBX- 3400) generated by contacting mouse lymphoid cells derived from tumor bearing mice with TAT-MYC, will significantly improve the overall survival of the mice compared to transplanting lymphoid cells treated with control TAT-Fusion protein.
- TAT-MYC- treated lymphocytes for immunotherapy of solid tumors are examined.
- This experiment is performed as described above, except that several different doses of the TAT-MYC-treated lymphocytes are injected and compared.
- Two experiments are performed.
- TAT-MYC lymphocytes are administered to the tumor-bearing mice via tail vein injection according to the following dosing groups: 3. Ox 10 6 cells/kg, 6. Ox 10 6 cells/kg, 14. Ox 10 6 cells/kg, and 70. Ox 10 6 cells/kg.
- the mice are administered 70.
- TAT-MYC lymphocytes are administered to the tumor-bearing mice via tail vein injection according to the following dosing groups: 4.0 ⁇ 10 3 cells/kg, 4.0 ⁇ 10 4 cells/kg, 4.0 ⁇ 10 5 cells/kg, 4.0 ⁇ 10 6 cells/kg and 4.0 ⁇ 10 7 cells/kg.
- the mice are administered 4.0 ⁇ 10 6 TAT-Cre treated or no cells (NT).
- NT no cells
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Cell Biology (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Biophysics (AREA)
- Oncology (AREA)
- Virology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Marine Sciences & Fisheries (AREA)
- Developmental Biology & Embryology (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020207004465A KR20200036874A (ko) | 2017-08-03 | 2018-08-01 | 암 치료를 위한 방법 및 조성물 |
| SG11202000724XA SG11202000724XA (en) | 2017-08-03 | 2018-08-01 | Methods and compositions for the treatment of cancer |
| CN201880057363.5A CN111094328A (zh) | 2017-08-03 | 2018-08-01 | 用于治疗癌症的方法和组合物 |
| AU2018308982A AU2018308982A1 (en) | 2017-08-03 | 2018-08-01 | Methods and compositions for the treatment of cancer |
| US16/635,383 US20200155600A1 (en) | 2017-08-03 | 2018-08-01 | Methods and compositions for the treatment of cancer |
| JP2020505464A JP2020529847A (ja) | 2017-08-03 | 2018-08-01 | がんの処置のための方法および組成物 |
| CA3071448A CA3071448A1 (en) | 2017-08-03 | 2018-08-01 | Methods and compositions for the treatment of cancer |
| EP18841366.0A EP3661953A4 (en) | 2017-08-03 | 2018-08-01 | CANCER TREATMENT METHODS AND COMPOSITIONS |
| IL272147A IL272147A (en) | 2017-08-03 | 2020-01-20 | Methods and compositions for the treatment of cancer |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762540901P | 2017-08-03 | 2017-08-03 | |
| US62/540,901 | 2017-08-03 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019028098A1 true WO2019028098A1 (en) | 2019-02-07 |
Family
ID=65234162
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/044740 Ceased WO2019028098A1 (en) | 2017-08-03 | 2018-08-01 | METHODS AND COMPOSITIONS FOR TREATING CANCER |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20200155600A1 (https=) |
| EP (1) | EP3661953A4 (https=) |
| JP (1) | JP2020529847A (https=) |
| KR (1) | KR20200036874A (https=) |
| CN (1) | CN111094328A (https=) |
| AU (1) | AU2018308982A1 (https=) |
| CA (1) | CA3071448A1 (https=) |
| IL (1) | IL272147A (https=) |
| SG (1) | SG11202000724XA (https=) |
| WO (1) | WO2019028098A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114072166A (zh) * | 2019-05-14 | 2022-02-18 | 泰加生物工艺学公司 | 用于治疗t细胞耗竭的组合物和方法 |
| JP2022527117A (ja) * | 2019-04-08 | 2022-05-30 | タイガ バイオテクノロジーズ,インク. | 免疫細胞の凍結保存のための組成物および方法 |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6358739B1 (en) * | 1999-04-12 | 2002-03-19 | Modex Therapeutiques, S.A. | Transiently immortalized cells |
| US20060222657A1 (en) * | 2003-06-20 | 2006-10-05 | Dowdy Steven F | Polypeptide transduction and fusogenic peptides |
| US20120027792A1 (en) * | 2000-11-01 | 2012-02-02 | The Gov of the USA as represented by the Secretary of the Dept. of Health & Human Services N.I.H. | Expression vectors able to elicit improved immune response and methods of using same |
| US20120251563A1 (en) * | 2002-02-13 | 2012-10-04 | Duke University | Modulation of immune response by non-peptide binding stress response polypeptides |
| US20140356392A1 (en) * | 2008-08-28 | 2014-12-04 | Taiga Biotechnologies, Inc. | Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc |
| US20150164950A1 (en) * | 2012-07-20 | 2015-06-18 | Taiga Biotechnologies, Inc. | Enhanced reconstitution and autoreconstitution of the hematopoietic compartment |
| US20180036396A1 (en) * | 2017-08-03 | 2018-02-08 | Taiga Biotechnologies, Inc. | Methods and compositions for the treatment of melanoma |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL296832A (en) * | 2005-10-18 | 2022-11-01 | Nat Jewish Health | Process of preparing red blood cells using conditionally immortalized long-term hematopoietic stem cells and erythropoietin |
| US9365825B2 (en) * | 2013-03-11 | 2016-06-14 | Taiga Biotechnologies, Inc. | Expansion of adult stem cells in vitro |
| DK2986311T3 (en) * | 2013-04-18 | 2019-02-25 | Tilt Biotherapeutics Oy | IMPROVED ADOPTIVE CELL THERAPY |
| ES2905757T3 (es) * | 2017-08-03 | 2022-04-12 | Taiga Biotechnologies Inc | Métodos y composiciones para el tratamiento del melanoma |
-
2018
- 2018-08-01 KR KR1020207004465A patent/KR20200036874A/ko not_active Ceased
- 2018-08-01 WO PCT/US2018/044740 patent/WO2019028098A1/en not_active Ceased
- 2018-08-01 SG SG11202000724XA patent/SG11202000724XA/en unknown
- 2018-08-01 CA CA3071448A patent/CA3071448A1/en active Pending
- 2018-08-01 US US16/635,383 patent/US20200155600A1/en not_active Abandoned
- 2018-08-01 AU AU2018308982A patent/AU2018308982A1/en not_active Abandoned
- 2018-08-01 EP EP18841366.0A patent/EP3661953A4/en not_active Withdrawn
- 2018-08-01 CN CN201880057363.5A patent/CN111094328A/zh active Pending
- 2018-08-01 JP JP2020505464A patent/JP2020529847A/ja active Pending
-
2020
- 2020-01-20 IL IL272147A patent/IL272147A/en unknown
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6358739B1 (en) * | 1999-04-12 | 2002-03-19 | Modex Therapeutiques, S.A. | Transiently immortalized cells |
| US20120027792A1 (en) * | 2000-11-01 | 2012-02-02 | The Gov of the USA as represented by the Secretary of the Dept. of Health & Human Services N.I.H. | Expression vectors able to elicit improved immune response and methods of using same |
| US20120251563A1 (en) * | 2002-02-13 | 2012-10-04 | Duke University | Modulation of immune response by non-peptide binding stress response polypeptides |
| US20060222657A1 (en) * | 2003-06-20 | 2006-10-05 | Dowdy Steven F | Polypeptide transduction and fusogenic peptides |
| US20140356392A1 (en) * | 2008-08-28 | 2014-12-04 | Taiga Biotechnologies, Inc. | Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc |
| US20150164950A1 (en) * | 2012-07-20 | 2015-06-18 | Taiga Biotechnologies, Inc. | Enhanced reconstitution and autoreconstitution of the hematopoietic compartment |
| US20180036396A1 (en) * | 2017-08-03 | 2018-02-08 | Taiga Biotechnologies, Inc. | Methods and compositions for the treatment of melanoma |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP3661953A4 * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2022527117A (ja) * | 2019-04-08 | 2022-05-30 | タイガ バイオテクノロジーズ,インク. | 免疫細胞の凍結保存のための組成物および方法 |
| EP3952909A4 (en) * | 2019-04-08 | 2023-06-07 | Taiga Biotechnologies, Inc. | COMPOSITIONS AND METHODS FOR CRYOPRESERVING IMMUNE CELLS |
| CN114072166A (zh) * | 2019-05-14 | 2022-02-18 | 泰加生物工艺学公司 | 用于治疗t细胞耗竭的组合物和方法 |
| EP3969041A4 (en) * | 2019-05-14 | 2023-05-10 | Taiga Biotechnologies, Inc. | COMPOSITIONS AND METHODS FOR TREATMENT OF T-CELL DEPLETION |
| US12370217B2 (en) | 2019-05-14 | 2025-07-29 | Htyr Acquisition Llc | Compositions and methods for treating T cell exhaustion |
Also Published As
| Publication number | Publication date |
|---|---|
| IL272147A (en) | 2020-03-31 |
| AU2018308982A1 (en) | 2020-02-13 |
| CN111094328A (zh) | 2020-05-01 |
| CA3071448A1 (en) | 2019-02-07 |
| SG11202000724XA (en) | 2020-02-27 |
| JP2020529847A (ja) | 2020-10-15 |
| US20200155600A1 (en) | 2020-05-21 |
| EP3661953A4 (en) | 2021-04-14 |
| EP3661953A1 (en) | 2020-06-10 |
| KR20200036874A (ko) | 2020-04-07 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10864259B2 (en) | Methods and compositions for the treatment of melanoma | |
| JP2020054387A (ja) | 免疫療法のための組成物および方法 | |
| CN112458057A (zh) | 用于免疫疗法的组合物和方法 | |
| WO2021244486A1 (zh) | 信号转换受体及其用途 | |
| WO2020009868A1 (en) | Anti-slamf7 chimeric antigen receptors | |
| KR20250024838A (ko) | Kras g12v 돌연변이 폴리펩티드를 표적화하는 t 세포 수용체 및 이의 용도 | |
| CN114072166A (zh) | 用于治疗t细胞耗竭的组合物和方法 | |
| EP3490584B1 (en) | Methods and compositions for the treatment of melanoma | |
| US20200155600A1 (en) | Methods and compositions for the treatment of cancer | |
| JP7197538B2 (ja) | メラノーマの処置のための方法および組成物 | |
| HK40068518A (en) | Methods and compositions for the treatment of melanoma | |
| CN116836301B (zh) | 基于TGF-beta抗体的陷阱受体 | |
| US20230295568A1 (en) | Chimeric antigen receptor gene-modified lymphocyte having cytocidal effect | |
| HK40007510B (en) | Methods and compositions for the treatment of melanoma | |
| HK40007510A (en) | Methods and compositions for the treatment of melanoma | |
| CN119894923A (zh) | 包含tmigd2共刺激结构域的嵌合抗原受体及其相关使用方法 | |
| CN116813796A (zh) | 基于il8抗体的信号转换受体 | |
| CN117126294A (zh) | 基于TGFbeta抗体的信号转换受体 | |
| CN116789857A (zh) | 基于cxcr的信号转换受体 | |
| HK40060306A (en) | Compositions and methods for treating t cell exhaustion | |
| HK40021640A (en) | Compositions and methods for immunotherapy | |
| HK1208631B (en) | Compositions and methods for immunotherapy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18841366 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3071448 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020505464 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018308982 Country of ref document: AU Date of ref document: 20180801 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20207004465 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018841366 Country of ref document: EP Effective date: 20200303 |