WO2019027754A1 - ANTI-CD137 ANTIBODIES - Google Patents
ANTI-CD137 ANTIBODIES Download PDFInfo
- Publication number
- WO2019027754A1 WO2019027754A1 PCT/US2018/043632 US2018043632W WO2019027754A1 WO 2019027754 A1 WO2019027754 A1 WO 2019027754A1 US 2018043632 W US2018043632 W US 2018043632W WO 2019027754 A1 WO2019027754 A1 WO 2019027754A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- antibody
- seq
- amino acid
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L7/00—Arrangements for synchronising receiver with transmitter
- H04L7/04—Speed or phase control by synchronisation signals
- H04L7/10—Arrangements for initial synchronisation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04B—TRANSMISSION
- H04B10/00—Transmission systems employing electromagnetic waves other than radio-waves, e.g. infrared, visible or ultraviolet light, or employing corpuscular radiation, e.g. quantum communication
- H04B10/25—Arrangements specific to fibre transmission
- H04B10/2575—Radio-over-fibre, e.g. radio frequency signal modulated onto an optical carrier
- H04B10/25752—Optical arrangements for wireless networks
- H04B10/25753—Distribution optical network, e.g. between a base station and a plurality of remote units
Definitions
- the present invention is in the field of medicine. Particularly, the present invention relates to agonistic antibodies directed to human CD137, compositions comprising such agonistic anti-human CD137 antibodies, and methods of using such agonistic anti-human CD 137 antibodies for the treatment of solid and hematological tumors alone or in combination with chemotherapy and other cancer therapeutics.
- CD137 also known as 4-1BB
- 4-1BB belongs to the TNF receptor family and plays a role in the activation of T cell immune responses such as by driving T cell proliferation and effector functions, promoting immunological memory, and inhibiting activation-induced cell death.
- Agonistic antibodies targeting CD137 have shown promise in murine tumor models as a monotherapy (Melero. I. et al., Nat. Med. 3(6):682-685 (1997)), however, agonist antibodies targeting human CD137 have not yet demonstrated sufficient responses as a monotherapy or combination therapy in human patients.
- the anti-human CD137 agonistic antibodies described herein are fully human, Fcy-receptor-mediated effector null antibodies that bind human CD137 and cynomolgus monkey CD 137, stimulate T cell activation in vitro, promote human CD 137 cell surface expression, enhance NF-kappa B activity, inhibit tumor growth in murine tumor models of non-small cell lung cancer as a monotherapy, inhibit T-regulatory cell mediated suppression in vitro, activate immune gene signatures, increase the frequency of intratumoral CD3 + T cells, compete with human CD137-Ligand for binding to human CD137, and bind to unique amino acid residues on human CD137.
- the present disclosure provides an anti-human CD137 (SEQ ID NO: l) antibody comprising HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7.
- the present disclosure provides an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9.
- the present disclosure provides an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12.
- the present disclosure provides an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11.
- the present disclosure provides an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13.
- the present disclosure provides a mammalian cell capable of expressing an antibody comprising HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDRl having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO:7.
- the present disclosure provides a mammalian cell capable of expressing an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11 or the amino acid sequence of SEQ ID NO: 13.
- the present disclosure provides a process for producing an antibody comprising cultivating a mammalian cell capable of expressing the antibody and recovering the antibody; wherein the antibody comprises HCDRl having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDRl having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7.
- the present disclosure provides an antibody produced by a process comprising cultivating a mammalian cell capable of expressing the antibody and recovering the antibody; wherein the antibody comprises HCDRl having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDRl having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7.
- the present disclosure provides an antibody produced by a process comprising cultivating a mammalian cell capable of expressing the antibody and recovering the antibody; wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11 or the amino acid sequence of SEQ ID NO:
- the present disclosure provides a DNA molecule comprising a polynucleotide having the sequence of SEQ ID NO: 14 and one of SEQ ID NO: 15, SEQ ID NO: 16, or SEQ ID NO: 17.
- the present disclosure provides a DNA molecule comprising a polynucleotide having the sequence of SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, or SEQ ID NO: 17.
- the present disclosure provides a pharmaceutical composition comprising an antibody disclosed herein and an acceptable carrier, diluent, or excipient.
- the present disclosure provides a pharmaceutical composition comprising an antibody and an acceptable carrier, diluent, or excipient; wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO:6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7.
- the present disclosure provides a pharmaceutical composition comprising an antibody and an acceptable carrier, diluent, or excipient; wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9.
- the present disclosure provides a pharmaceutical composition comprising an antibody and an acceptable carrier, diluent, or excipient; wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12.
- the present disclosure provides a pharmaceutical composition comprising an antibody and an acceptable carrier, diluent, or excipient; wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11.
- the present disclosure provides a pharmaceutical composition comprising an antibody and an acceptable carrier, diluent, or excipient; wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an anti-human CD137 (SEQ ID NO: l) antibody comprising HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO:6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7.
- SEQ ID NO: l anti-human CD137
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an anti-human CD137 (SEQ ID NO: l) antibody comprising HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO:6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- an anti-human CD137 (SEQ ID NO: l) antibody comprising HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HC
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an anti-human CD137 (SEQ ID NO: l) antibody comprising HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO:6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- an anti-human CD137 (SEQ ID NO: l) antibody comprising HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an anti-human CD137 (SEQ ID NO: l) antibody comprising HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO:6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- SEQ ID NO: l anti-human CD137
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an anti-human CD137 (SEQ ID NO: l) antibody comprising HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO:6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- SEQ ID NO: l anti-human CD137
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof, an effective amount of an antibody comprising a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is bladder cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is breast cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is biliary tract cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is colon cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is endometrial cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is esophageal cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is gastric cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is head and neck cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is non-small cell lung cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is prostate cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is rectal cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is thyroid cancer.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is head and neck squamous cell carcinoma.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is renal cell carcinoma.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is cholangiocarcinoma.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is lung adenocarcinoma.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is lung squamous cell carcinoma.
- the present disclosure provides an antibody disclosed herein for use in the treatment of cancer; wherein the cancer is clear cell renal carcinoma.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is bladder cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is breast cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is biliary tract cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is colon cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is endometrial cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is esophageal cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is gastric cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is head and neck cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is non-small cell lung cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is prostate cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is rectal cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is thyroid cancer.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is head and neck squamous cell carcinoma.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is renal cell carcinoma.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is cholangiocarcinoma.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is lung adenocarcinoma.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is lung squamous cell carcinoma.
- the present disclosure provides the use of an antibody disclosed herein for the manufacture of a medicament for the treatment of cancer; wherein the cancer is clear cell renal carcinoma.
- the present disclosure provides an anti-human CD137 (SEQ ID NO: l) antibody disclosed herein for use in therapy.
- the present disclosure provides an anti-human CD137 (SEQ ID NO: l) antibody disclosed herein for use in therapy; wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7.
- the present disclosure provides an anti-human CD137 (SEQ ID NO: l) antibody disclosed herein for use in therapy; wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11.
- the present disclosure provides an anti-human CD137 (SEQ ID NO: l) antibody disclosed herein for use in therapy; wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13.
- the present disclosure provides an anti-human CD137 (SEQ ID NO: l) antibody for use in the treatment of cancer, wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO:6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13.
- the present disclosure provides an anti-human CD137 (SEQ ID NO: l) antibody for use in the treatment of cancer, wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDRl having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides an anti-human CD137 (SEQ ID NO: l) antibody for use in the treatment of cancer, wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDRl having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides an anti-human CD137 (SEQ ID NO: l) antibody for use in the treatment of cancer, wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDRl having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDRl having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the antibody is administered in
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides an anti-human CD137 (SEQ ID NO: l) antibody for use in the treatment of cancer, wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDRl having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDRl having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides an antibody for use in the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides the use of an anti-human CD137 (SEQ ID NO: l) antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDRl having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13.
- the present disclosure provides the use of an anti-human CD137 (SEQ ID NO: l) antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer .
- the present disclosure provides the use of an anti-human CD137 (SEQ ID NO: l) antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the cancer is cholangiocarcinoma, head and neck squamous cell carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal carcinoma, or head and neck squamous cell carcinoma.
- the present disclosure provides the use of an anti-human CD137 (SEQ ID NO: l) antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- SEQ ID NO: l anti-human CD137
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the antibody is administered in simultaneous, separate, or sequential combination with ionizing radiation.
- the present disclosure provides the use of an anti-human CD137 (SEQ ID NO: l) antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises HCDR1 having the amino acid sequence of SEQ ID: 2, HCDR2 having the amino acid sequence of SEQ ID NO: 3, HCDR3 having the amino acid sequence of SEQ ID NO: 4, LCDR1 having the amino acid sequence of SEQ ID NO: 5, LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having the amino acid sequence of SEQ ID NO: 7; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- SEQ ID NO: l anti-human CD137
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 9; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain variable region having the amino acid sequence of SEQ ID NO: 8 and a light chain variable region having the amino acid sequence of SEQ ID NO: 12; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 11; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides the use of an antibody for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 10 and a light chain having the amino acid sequence of SEQ ID NO: 13; wherein the antibody is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents.
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1) or a pharmaceutical composition comprising the antibody, wherein the antibody contacts human CD137 on at least one of the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive); optionally, wherein the antibody contacts at least two of the residues, preferably at least three of the resides, more preferably at least four of the residues; more preferably at least five of the residues; more preferably at least six of the residues; more preferably at least seven of the residues; more preferably at least eight of the residues; more preferably at least nine of the residues; more preferably at least ten of the residues; more preferably at least eleven of the residues; more preferably at least twelve of the residues; more preferably at least thirteen of the residues; more preferably at least fourteen of the residues; more preferably at least fifteen of the residues; or more preferably all of the residues.
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1) or a pharmaceutical composition comprising the antibody, wherein the antibody contacts human CD 137 on at least one of the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive); optionally, wherein the antibody contacts at least two of the residues, preferably at least three of the resides, more preferably at least four of the residues; more preferably at least five of the residues; more preferably at least six of the residues; more preferably at least seven of the residues; more preferably at least eight of the residues; more preferably at least nine of the residues; more preferably at least ten of the residues; more preferably at least eleven of the residues; more preferably at least twelve of the residues; more preferably at least thirteen of the residues; more preferably at least fourteen of the residues; more preferably at least fifteen of the residues; or more preferably all of the residues; wherein contact is determined by X-ray crystall
- the present disclosure provides the use of an antibody that agonizes human CD 137 (SEQ ID NO: 1) for the treatment of cancer or for the manufacture of a medicament for the treatment of cancer, wherein the antibody contacts human CD 137 on at least one of the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive); optionally, wherein the antibody contacts at least two of the residues, preferably at least three of the resides, more preferably at least four of the residues; more preferably at least five of the residues; more preferably at least six of the residues; more preferably at least seven of the residues; more preferably at least eight of the residues; more preferably at least nine of the residues; more preferably at least ten of the residues; more preferably at least eleven of the residues; more preferably at least twelve of the residues; more preferably at least thirteen of the residues; more preferably at least fourteen of the residues; more preferably at least fifteen of the residues; or more preferably all of the residues
- the present disclosure provides the use of an antibody that agonizes human CD 137 (SEQ ID NO: 1) for the treatment of cancer or for the manufacture of a medicament for the treatment of cancer, wherein the antibody contacts human CD 137 on at least one of the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive); optionally, wherein the antibody contacts at least two of the residues, preferably at least three of the resides, more preferably at least four of the residues; more preferably at least five of the residues; more preferably at least six of the residues; more preferably at least seven of the residues; more preferably at least eight of the residues; more preferably at least nine of the residues; more preferably at least ten of the residues; more preferably at least eleven of the residues; more preferably at least twelve of the residues; more preferably at least thirteen of the residues; more preferably at least fourteen of the residues; more preferably at least fifteen of the residues; or more preferably all of the residues
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1) or a pharmaceutical composition comprising the antibody, wherein the antibody contacts human CD137 at the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive).
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1) or a pharmaceutical composition comprising the antibody, wherein the antibody contacts human CD 137 at the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); wherein contact is determined by X-ray crystallography and wherein the residues in contact are within six (6) angstroms or less of the antibody.
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1) or a pharmaceutical composition comprising the antibody, wherein the antibody contacts human CD137 at the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer .
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1) or a pharmaceutical composition comprising the antibody, wherein the antibody contacts human CD137 at the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); wherein contact is determined by X-ray crystallography and wherein the residues in contact are within six (6) angstroms or less of the antibody; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer .
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1) for use in the treatment of cancer or for the manufacture of a medicament for the treatment of cancer, wherein the antibody contacts human CD 137 at the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive).
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1) for use in the treatment of cancer or for the manufacture of a medicament for the treatment of cancer, wherein the antibody contacts human CD 137 at the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); wherein contact is determined by X-ray crystallography and wherein the residues in contact are within six (6) angstroms or less of the antibody.
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1
- the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides an antibody that agonizes human CD 137 (SEQ ID NO: 1) for use in the treatment of cancer or the use of an antibody that agonizes human CD 137 (SEQ ID NO: 1) for the manufacture of a medicament for the treatment of cancer, wherein the antibody contacts human CD 137 at the following amino acid residues: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); wherein contact is determined by X-ray crystallography and wherein the residues in contact are within six (6) angstroms or less of the antibody; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer .
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1) or a pharmaceutical composition comprising the antibody, wherein the antibody does not bind human FcyRI, human FcyRIIa, human FcyRIIb, human FcyRIIIa(F), human FcyRIIIaCV), or human Clq.
- the present disclosure provides an antibody that agonizes human CD 137 (SEQ ID NO: 1) for use in the treatment of cancer or for the manufacture of a medicament for the treatment of cancer, wherein the antibody does not bind human FcyRI, human FcyRIIa, human FcyRIIb, human FcYRIIIa(F), human FcyRIIIaCV), or human Clq.
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1
- the antibody does not bind human FcyRI, human FcyRIIa, human FcyRIIb, human FcyRIIIa(F), human FcyRIIIaCV), or human Clq; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer .
- the present disclosure provides an antibody that agonizes human CD137 (SEQ ID NO: 1) for use in the treatment of cancer or for the manufacture of a medicament for the treatment of cancer, wherein the antibody does not bind human FcyRI, human FcyRIIa, human FcyRIIb, human FcyRIIIa(F), human FcyRIIIaCV), or human Clq; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer .
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l), wherein the antibody comprises a heavy chain and a light chain; wherein the heavy chain contacts at least one amino acid residue of the following on human CD137: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); wherein the light chain contacts at least one amino acid residue of the following on human CD 137: 96-98 (inclusive), 100, and 114-116 (inclusive).
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: 1]
- the antibody comprises a heavy chain and a light chain; wherein the heavy chain contacts the following amino acid residues on human CD137: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); wherein the light chain contacts the following amino acid residues on human CD137: 96-98 (inclusive), 100, and 114-116 (inclusive).
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l), wherein the antibody comprises a heavy chain and a light chain; wherein the heavy chain contacts the following amino acid residues on human CD137: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); wherein the light chain contacts the following amino acid residues on human CD137: 96-98 (inclusive), 100, and 114-116 (inclusive); wherein the residues in contact are within six (6) angstroms or less of the antibody, as determined by X-ray crystallography.
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l), wherein the antibody comprises a heavy chain and a light chain; wherein the heavy chain contacts the following amino acid residues on human CD137: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); optionally, wherein the light chain contacts the following amino acid residues on human CD 137: 96-98 (inclusive), 100, and 114-116 (inclusive).
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l), wherein the antibody comprises a heavy chain and a light chain; wherein the heavy chain contacts the following amino acid residues on human CD137: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); optionally, wherein the light chain contacts the following amino acid residues on human CD 137: 96-98 (inclusive), 100, and 114-116 (inclusive); wherein the residues in contact are within six (6) angstroms or less of the antibody, as determined by X-ray crystallography.
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l) for use in the treatment of cancer, wherein the antibody comprises a heavy chain and a light chain; wherein the heavy chain contacts the following amino acid residues on human CD137: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); optionally, wherein the light chain contacts the following amino acid residues on human CD137: 96-98 (inclusive), 100, and 114-116 (inclusive); wherein the residues in contact are within six (6) angstroms or less of the antibody, as determined by X-ray crystallography.
- the present disclosure provides the use of an antibody that is an agonist of human CD 137 (SEQ ID NO: 1) for the manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain and a light chain; wherein the heavy chain contacts the following amino acid residues on human CD137: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); optionally, wherein the light chain contacts the following amino acid residues on human CD137: 96-98 (inclusive), 100, and 114-116 (inclusive); wherein the residues in contact are within six (6) angstroms or less of the antibody, as determined by X-ray crystallography.
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l) for use in the treatment of cancer, wherein the antibody comprises a heavy chain and a light chain; wherein the heavy chain contacts the following amino acid residues on human CD137: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); optionally, wherein the light chain contacts the following amino acid residues on human CD137: 96-98 (inclusive), 100, and 114-116 (inclusive); wherein the residues in contact are within six (6) angstroms or less of the antibody, as determined by X-ray crystallography; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- the present disclosure provides the use of an antibody that is an agonist of human CD137 (SEQ ID NO: l) for manufacture of a medicament for the treatment of cancer, wherein the antibody comprises a heavy chain and a light chain; wherein the heavy chain contacts the following amino acid residues on human CD137: 55, 59, 63, 66, 72, 93-103 (inclusive), and 112-116 (inclusive); optionally, wherein the light chain contacts the following amino acid residues on human CD137: 96-98 (inclusive), 100, and 114-116 (inclusive); wherein the residues in contact are within six (6) angstroms or less of the antibody, as determined by X-ray crystallography; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer .
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: 1), wherein the antibody binds at least one of the following amino acid residues on human CD137: 97 and 115.
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l), wherein the antibody binds at least two of the amino acid residues on human CD137: 97, 114, and 115.
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l), wherein the antibody binds to the following amino acid residues on human CD137: 97, 114, and 115.
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: 1), wherein the antibody binds at least one of the following amino acid residues on human CD 137: 97 and 115; wherein binding is determined using a mutant human CD 137 protein having a mutation at one or more of the following amino acid residues: 97, 114, and 115.
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l), wherein the antibody binds at least two of the following amino acid residues on human CD137: 97, 114, and 115; wherein binding is determined using a mutant human CD 137 protein having a mutation at one or more of the following amino acid residues: 97, 114, and 115.
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l) for use in the treatment of cancer, wherein the antibody binds to the following amino acid residues on human CD137: 97, 114, and 115; wherein binding is determined using a mutant human CD 137 protein having a mutation at one or more of the following amino acid residues: 97, 114, and 115.
- the present disclosure provides the use of an antibody that is an agonist of human CD 137 (SEQ ID NO: l) for the manufacture of a medicament for the treatment of cancer, wherein the antibody binds to the following amino acid residues on human CD 137: 97, 114, and 115; wherein binding is determined using a mutant human CD137 protein having a mutation at one or more of the following amino acid residues: 97, 114, and 115.
- the present disclosure provides an antibody that is an agonist of human CD137 (SEQ ID NO: l) for use in the treatment of cancer, wherein the antibody binds to the following amino acid residues on human CD137: 97, 114, and 115; wherein binding is determined using a mutant human CD 137 protein having a mutation at one or more of the following amino acid residues: 97, 114, and 115; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer .
- the present disclosure provides the use of an antibody that is an agonist of human CD 137 (SEQ ID NO: 1) for the manufacture of a medicament for the treatment of cancer, wherein the antibody binds to the following amino acid residues on human CD 137: 97, 114, and 115; wherein binding is determined using a mutant human CD137 protein having a mutation at one or more of the following amino acid residues: 97, 114, and 115; wherein the cancer is bladder cancer, breast cancer, biliary tract cancer, colon cancer, endometrial cancer, esophageal cancer, gastric cancer, head and neck cancer, non-small cell lung cancer, prostate cancer, rectal cancer, or thyroid cancer.
- Non-limiting examples of useful chemotherapeutic agents include 5-fluorouracil, hydroxyurea, gemcitabine, methotrexate, doxorubicin, etoposide, carboplatin, cisplatin, cyclophosphamide, melphalan, dacarbazine, taxol, camptothecin, FOLFIRI, FOLFOX, docetaxel, daunorubicin, paclitaxel, oxaliplatin, and combinations thereof.
- antibody refers to a polypeptide complex having two heavy chains (HC) and two light chains (LC) such that the heavy chains and lights chains are interconnected by disulfide bonds; wherein the antibody is an IgG subclass antibody.
- An antibody of the present invention is an engineered, non-naturally occurring polypeptide complex.
- a DNA molecule of the present invention is a DNA molecule that comprises a non-naturally occurring polynucleotide sequence encoding a polypeptide having the amino acid sequence of at least one of the polypeptides in an antibody of the present invention.
- the antibody of the present invention is an IgG type antibody and has "heavy" chains and "light” chains that are cross-linked via intra- and inter-chain disulfide bonds.
- Each heavy chain is comprised of an N-terminal HCVR and a heavy chain constant region ("HCCR").
- Each light chain is comprised of a LCVR and a light chain constant region ("LCCR").
- antibodies having native human Fc sequences When expressed in certain biological systems, antibodies having native human Fc sequences are glycosylated in the Fc region. Typically, glycosylation occurs in the Fc region of the antibody at a highly conserved N-glycosylation site. N- glycans typically attach to asparagine. Antibodies may be glycosylated at other positions as well.
- the anti -human CD 137 antibodies described herein contain an Fc portion that is derived from human IgGl .
- IgGl is well known to bind to the proteins of the Fc-gamma receptor family (FcyR) as well as Clq. Interaction with these receptors can induce antibody-dependent cell cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). Therefore, optionally, the anti -human CD 137 antibodies described herein are a fully human monoclonal antibody lacking Fc effector function (IgGl, Fc- null). To achieve an Fc-null IgGl antibody, selective mutagenesis of residues is necessary within the CH2 region of its IgGl Fc region.
- Amino acid substitutions L234A, L235E, and G237A are introduced into IgGl Fc to reduce binding to FcyRI, FcyRIIa, and FcyRIII, and substitutions A330S and P331 S are introduced to reduce C lq-mediated complement fixation.
- certain amino acids may require back-mutations to match antibody germline sequences.
- the HCVR and LCVR regions can be further subdivided into regions of hyper- variability, termed complementarity determining regions ("CDRs"), interspersed with regions that are more conserved, termed framework regions ("FR").
- CDRs complementarity determining regions
- FR framework regions
- Each HCVR and LCVR is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- HCDRl, HCDR2, and HCDR3 the three CDRs of the light chain are referred to as "LCDR1, LCDR2 and LCDR3".
- the CDRs contain most of the residues which form specific interactions with the antigen.
- the North CDR definitions are used.
- the North CDR definition (North et al, "A New Clustering of Antibody CDR Loop Conformations", Journal of Molecular Biology, 406, 228-256 (2011)) is based on affinity propagation clustering with a large number of crystal structures.
- An isolated DNA encoding a HCVR region can be converted to a full-length heavy chain gene by operably linking the HCVR-encoding DNA to another DNA molecule encoding heavy chain constant regions.
- the sequences of human, as well as other mammalian, heavy chain constant region genes are known in the art. DNA fragments encompassing these regions can be obtained e.g., by standard PCR amplification.
- An isolated DNA encoding a LCVR region may be converted to a full-length light chain gene by operably linking the LCVR-encoding DNA to another DNA molecule encoding a light chain constant region.
- the sequences of human, as well as other mammalian, light chain constant region genes are known in the art. DNA fragments encompassing these regions can be obtained by standard PCR amplification.
- the light chain constant region can be a kappa or lambda constant region.
- the light chain constant region is a kappa constant region.
- the polynucleotides of the present invention will be expressed in a host cell after the sequences have been operably linked to an expression control sequence.
- the expression vectors are typically replicable in the host organisms either as episomes or as an integral part of the host chromosomal DNA. Commonly, expression vectors will contain selection markers, e.g., tetracycline, neomycin, and dihydrofolate reductase, to permit detection of those cells transformed with the desired DNA sequences.
- the antibody of the present invention may readily be produced in mammalian cells, non-limiting examples of which includes CHO, NS0, HEK293 or COS cells.
- the host cells are cultured using techniques well known in the art.
- the antibody, or the nucleic acids encoding the same is provided in isolated form.
- isolated refers to a protein, peptide, or nucleic acid which is free or substantially free from any other macromolecular species found in a cellular environment.
- substantially free as used herein means the protein, peptide, or nucleic acid of interest comprises more than 80% (on a molar basis) of the macromolecular species present, preferably more than 90%, and more preferably more than 95%.
- the antibody of the present invention may be administered by parenteral routes, a non-limiting example of which is intravenous administration.
- An antibody of the present invention may be administered to a patient alone with pharmaceutically acceptable carriers, diluents, or excipients in single or multiple doses.
- Pharmaceutical compositions of the present invention can be prepared by methods well known in the art (e.g., Remington: The Science and Practice of Pharmacy, 22 nd ed. (2012), A. Loyd et al., Pharmaceutical Press) and comprise an antibody, as disclosed herein, and one or more pharmaceutically acceptable carriers, diluents, or excipients.
- Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic effect). Treatment dosages may be titrated to optimize safety and efficacy.
- Dosing schedules, for intravenous (i.v.) or non-intravenous administration, localized or systemic, or combinations thereof, will typically range from a single bolus dosage or continuous infusion to multiple administrations per day (e.g., every 4-6 hours), or as indicated by the treating physician and the patient's condition. Dosing amounts and frequencies may be determined by the physicians treating the patient.
- treating refers to slowing, interrupting, arresting, alleviating, stopping, reducing, or reversing the progression or severity of an existing symptom, disorder, condition, or disease.
- Effective amount means the amount of an antibody of the present invention or pharmaceutical composition comprising an antibody of the present invention that will elicit the biological or medical response of or desired therapeutic effect on a tissue, system, animal, mammal or human that is being sought by the researcher, medical doctor, or other clinician.
- An effective amount of the antibody may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody to elicit a desired response in the individual.
- An effective amount is also one in which any toxic or detrimental effect of the antibody is outweighed by the therapeutically beneficial effects.
- Antibody production using the heavy chain polynucleotide sequence shown in SEQ ID NO: 14, and the light chain polynucleotide sequence shown in SEQ ID NO: 17 in mammalian cells results in the production of two antibody product-related species: (a) a full length antibody (hereafter referred to as "Antibody Al”) having the heavy chain amino acid sequence shown in SEQ ID NO: 10 and the light chain amino acid sequence of SEQ ID NO: 11; and (b) a single amino acid truncated form of the antibody (hereafter referred to as "Antibody A2”) resulting from the clipping of the n-terminal alanine of the light chain, the Antibody A2 having the heavy chain amino acid sequence shown in SEQ ID NO: 10 and the light chain amino acid sequence shown in SEQ ID NO: 13.
- Antibody Al full length antibody
- Antibody A2 a single amino acid truncated form of the antibody
- Antibody Al/2 refers to the antibody product that results from the use of the light chain polynucleotide sequence shown in SEQ ID NO: 17 and includes a combination of Antibody Al (-6%) and Antibody A2 (-94%).
- Antibody Al can be synthesized without significant quantities of Antibody A2 using the heavy chain polynucleotide sequence shown in SEQ ID NO: 14 and the light chain polynucleotide sequence shown in SEQ ID NO: 15.
- Antibody A2 can be synthesized without significant quantities of Antibody Al using the heavy chain polynucleotide sequence shown in SEQ ID NO: 14 and the light chain polynucleotide sequence shown in SEQ ID NO: 16.
- the antibodies of the present invention may be generated by using known methods, including but not limited to, phage display. Additionally, the antibodies derived as described above may be further screened using the assays described herein.
- polypeptides of the variable regions of the heavy chain and light chain and the complete heavy chain and light chain amino acid sequences of Antibodies Al and A2, and the nucleotide sequences encoding the same are listed in the section entitled "Amino Acid and Nucleotide Sequences.”
- SEQ ID NOs for the light chain, heavy chain, light chain variable region, and heavy chain variable region of Antibodies Al, A2, and Al/2 are shown in Tables 1 & 2.
- the antibodies of the present invention including, but not limited to, Antibodies Al, A2, and Al/2 can be made and purified essentially as follows.
- An appropriate host cell such as HEK 293 or CHO, can be either transiently or stably transfected with an expression system for secreting antibodies using an optimal predetermined HC:LC vector ratio or a single vector system encoding both HC and LC.
- Clarified media, into which the antibody has been secreted may be purified using any of many commonly-used techniques.
- the medium may be conveniently applied to a MabSelect column (GE Healthcare), or KappaSelect column (GE Healthcare), that has been equilibrated with a compatible buffer, such as phosphate buffered saline (pH 7.4).
- the column may be washed to remove nonspecific binding components.
- the bound antibody may be eluted, for example, by pH gradient (such as 20 mM Tris buffer pH 7 to 10 mM sodium citrate buffer pH 3.0, or phosphate buffered saline pH 7.4 to 100 mM glycine buffer pH 3.0).
- Antibody fractions may be detected, such as by UV absorbance or SDS- PAGE, and then may be pooled. Further purification is optional, depending on the intended use.
- the antibody may be concentrated and/or sterile filtered using common techniques. Soluble aggregate and multimers may be effectively removed by common techniques, including size exclusion, hydrophobic interaction, ion exchange, multimodal, or hydroxyapatite chromatography.
- the product may be immediately frozen at -70 °C or may be lyophilized.
- Antibody Al/2 binds to human CD137
- the ability of the antibodies disclosed herein to bind human CD137 can be measured by ELISA.
- a 96-well plate (Nunc) is coated with human CD137-Fc (R&D Systems) overnight at 4°C. Wells are blocked for 2 h with blocking buffer (PBS containing 0.2% bovine serum albumin and 0.05% Tween- 20). Wells are washed three times with PBS containing 0.05% Tween-20.
- Antibody Al/2 or control IgG 100 microliters is then added at different concentrations and incubated at room temperature for 1 h.
- the plate After washing, the plate is incubated with 100 microliters of goat anti-human IgG F(ab')2-HRP conjugate (Jackson Immuno Research Laboratories) at room temperature for 45 minutes. The plates are washed and then incubated with 100 microliters of 3,3', 5,5'-tetra-methylbenzidine. The absorbance at 650 nm is read on a SpectraMax® microplate reader. The half maximal effective concentration (EC50) is calculated using GraphPad Prism 7 software.
- Antibody Al/2 binds human CD 137 with an EC50 of 0.027 nM.
- Antibody Al/2 binds to cynomolgus monkey CD 137
- Cynomolgus monkey CD137 expressing stable cells are generated by transfecting Cyno-CD137 receptor plasmid DNA into human 293 cells (ATCC) using LipofectamineTM 2000 reagent (InvitrogenTM) per manufacturer's protocol. Stable cells are selected using 0.5 micrograms/mL puromycin in Dulbecoo's Modified Eagle's Medium containing 10% fetal bovine serum and 1% GlutaMAXTM.
- confluent adherent cells are detached using Gibco® Cell Dissociation Buffer (Life Technologies), blocked in FACS buffer (phosphate buffered saline containing 3% fetal bovine serum) for 1 h at 4°C, and then transferred into a 96-well round-bottom plate at a density of 1 x 10 5 cells/well.
- Antibody Al/2, BMS20H4.9, PF83, or control human IgGl (diluted in FACS buffer 1 :4 starting at 0.5 micrograms/mL) are added (100 microliters) and cells are stained for 1 h at 4°C.
- Antibody Al/2 at a concentration of 0.5 micrograms/mL displays a higher MFI ratio of 153 as compared to BMS20H4.9 (MFI ratio of 0.94) and PF83 (MFI ratio of 37).
- Antibody Al/2 binding on human cells increases CD137 expression
- Human CD137 expressing stable cells are generated by transfecting human CD137 plasmid DNA into human 293 cells (ATCC) using LipofectamineTM 2000 reagent (InvitrogenTM) per manufacturer's protocol. Stable cells are selected using 0.5 micrograms/mL of puromycin in Dulbecoo's Modified Eagle's Medium containing 10% fetal bovine serum and 1% GlutaMAXTM. CD137 antibodies starting at 300 nanomolar in media are incubated with the cells at 37°C for 24 hr.
- MFI Median Fluorescence Intensity
- EMF equivalent soluble fluorochrome
- Double stable NF-kappaB luciferase reporter/human CD 137-293 cells are generated by transfecting pGL4.32[luc2P/NF-kappaB-RE/Hygro] plasmid DNA (Promega) into human CD137-expressing 293 cells using LipofectamineTM 2000 Reagent (Life Technologies) per manufacturer's protocol. Stable cells are selected using 100 micrograms/mL hygromycin and 0.5 micrograms/mL puromycin in Dulbecoo's Modified Eagle's Medium containing 10% fetal bovine serum and 1% GlutaMAXTM.
- Cells are plated in a 384 well plate at a density of 5 x 10 3 cells/well using the Thermo MultiDrop Combi Reagent Dispenser (Thermo Fisher Scientific) and cultured overnight at 37°C.
- Antibody Al/2, BMS20H4.9, PF83, or control human IgGl are diluted in phosphate buffered saline (PBS) using Hamilton STARTM (Hamilton Company) at 10 -point 2-fold dilutions within the plate starting at 9 micromolar or 1.33 micromolar and transferred to cells.
- PBS phosphate buffered saline
- Hamilton STARTM Hamilton STARTM
- Antibody Al/2 displays a max activity of 78% that is higher than PF83 (max activity of 12%) and lower than BMS20H4.9 (max activity of 115%).
- Antibody Al/2 Promotes T Cell-Derived Interferon-Gamma Production
- T cell-derived interferon-gamma T cell-derived interferon- gamma (IFN-gamma) production
- PBMCs Human peripheral blood mononuclear cells
- RPMI Roswell Park Memorial Institute medium
- Anti-human CD3 antibody clone HIT3a (BD Biosciences) in PBS is coated onto a 96-well plate (typical range: 2 to 15 nanograms/well) and incubated overnight at 4°C.
- PBMCs are transferred onto a 96-well plate at a density of 1.5 x 10 5 cells/well.
- Antibody Al/2, BMS20H4.9, PF83, or control human IgGl are prepared by diluting 1 :4 in RPMI containing 10% fetal bovine serum at a starting concentration of 80 micrograms/mL.
- Anti-human CD28 antibody clone CD28.2 (BioLegend) is added to the plate (typical range 0.2 to 2 micrograms/mL) followed by the test antibody and incubated for 96 h at 37°C in a humidified 5% CO2 incubator.
- IFN-gamma capture antibody is coated onto plate (4 micrograms/mL) overnight at room temperature. After aspirating and washing, the plate is blocked for lh at room temperature. Sample supernatants and IFN-gamma standard are added and incubated for 2h at room temperature. After washing, 100 microliters of IFN-gamma detection antibody is added, incubated for 2hr at room temperature, and washed. Streptavidin-HRP (100 microliters of 1 :40 dilution) is added for 20 minutes at room temperature.
- Antibody Al/2 enhances the sub-optimal activation of human PBMCs by CD3/CD28 co-stimulation as measured by IFN-gamma cytokine production.
- treatment with Antibody Al/2 at 5 micrograms/ml results in a 3.8-fold increase in the production of IFN-gamma that was higher than PF83 (1.6-fold increase) and lower than BMS20H4.9 (9.4-fold increase).
- Antibody Al/2 Solid-Phase Binding Assay
- Antibody Al/2 to human Clq can be measured using an ELISA assay.
- Antibody Al/2 and control antibodies (negative control IgGl) are serially diluted in PBS and coated onto an ELISA plate overnight at 4°C.
- Human Clq in casein buffer is added at a concentration of 10 milligrams/mL and incubated for 2 hrs.
- Human Clq is detected by incubating the plates with anti-human Clq-HRP (AbD Serotec Inc., 1 :200 dilution) for 1 h and the plate is developed using TMB (KPL, Inc.). Absorbance is measured at 450 nm with Synergy Neo2 hybrid multi-mode reader (BioTek®).
- the binding of Antibody Al/2 to FcyRI, FcyRIIa(H), FcyRIIb, FcYRIIIa(F), and FcyRIIIaCV) is determined using an MSD assay (Meso Scale Diagnostics). Briefly, Fey receptors are coated onto a Meso Scale plate overnight and serially diluted test antibodies are added to the plate and incubated for 2 h. Antibody Al/2 is detected using an anti- human secondary antibody (Meso Scale Diagnostics, D20TF-6) and the plate is developed with Read Buffer T (Meso Scale Diagnostics, R92TC-1). Luminescence is measured on a SECTOR Imager 2400 (Meso Scale Diagnostics) and data is analyzed using GraphPad Prism 7.0 software.
- MSD assay Meso Scale Diagnostics
- Antibody Al/2 did not bind to FcyRI, FcyRIIa, FcyRIIb, FcyRIIIa, FcyRIIIa, or Clq (as shown in Table 3 above). In other experiments, Antibody Al/2 exhibited no detectable effector function in cell-based antibody-dependent cellular cytotoxicity and complement-dependent cytotoxicity assays.
- the HCC827 human non-small cell lung cancer (ATCC) tumor cell line is maintained in its respective media and harvested for implantation.
- Tumor cells (1 x 10 7 cells per mouse) are injected subcutaneously into the right flank of female NOD/SCID Gamma (NSG) mice at 7 weeks of age (Jackson Laboratories). When tumors reach approximately 350 mm 3 to 450 mm 3 in size, mice are randomized into groups of 5 to 8.
- Human expanded T cells are generated by stimulating naive human PBMCs with Dynabeads® Human T-expander CD3/CD28 beads (Thermo Fisher Scientific) for 9 to 10 days and banked.
- Human PBMCs (NY Blood Center) are prepared by centrifugation over Ficoll® Paque PLUS in SepMate tubes (STEMCELL Technologies) and banked. Expanded T cells are thawed and 1 x 10 6 cells are injected into the mice. As a control, tumor cells alone are implanted with no T cells or PBMCs in some mice. Treatment starts at either Day 0 or Day 1. Treatment groups include control IgG, BMS20H4.9, PF83, and Antibody Al/2. Animals are dosed via intraperitoneal injection at 10 mg/kg of antibody once weekly for 4 weeks.
- Body weight (BW) is recorded twice a week and the percent change in BW is calculated using the formula: (BW on observation day - BW on initial day) / BW initial day x 100%.
- the %T/C is calculated using the formula 100 x ⁇ / AC if ⁇ > 0 of the geometric mean values.
- ⁇ mean tumor volume of the drug-treated group on the observation day of the study - mean tumor volume of the drug-treated group on initial day of dosing
- AC mean tumor volume of the control group on the observation day of the study - mean tumor volume of the control group on initial day of dosing.
- a Biacore T200 instrument can be used to measure the kinetics of immobilized human CD137-Fc binding to Antibody Al, Antibody A2, and Antibody Al/2.
- Recombinant human extracellular CD137-Fc protein (R&D Systems) is covalently immobilized to a CM5 sensor chip via amine coupling (GE Healthcare).
- CD 137 antibody testing is performed at a flow rate of 30 microliters/min in HBS-EP+ buffer. Samples are injected at various concentrations and measurements obtained at 25°C. The surface is regenerated after each sample injection with 10 millimolar Glycine-HCl pH2.0 at flow rate of 30 microliters/min for 24 seconds and then stabilized with buffer for 10 seconds.
- the ability of the antibodies disclosed herein to activate NF-kappaB can be measured as previously described herein with the modification that the antibody dilutions are prepared in PBS and 10-point 2-fold dilutions are made within the plate starting at 9 micromolar.
- Antibody Al and Antibody A2 Promote T Cell-Derived Interferon-Gamma Production
- T cell-derived interferon-gamma IFN-gamma
- Antibody Al, Antibody A2, and Antibody Al/2 enhance the sub-optimal activation of human PBMCs by CD3/CD28 co- stimulation as measured by IFN-gamma cytokine production.
- treatment with Antibody Al/2 at 5 micrograms/mL results in a 3.1 -fold increase in the production of IFN-gamma that was comparable to Antibody Al (3.5-fold increase) and Antibody A2 (3.5-fold increase).
- mice The ability of the antibodies disclosed herein to inhibit tumor growth in mice can be measured as previously described herein.
- Antibody Al, Antibody A2, and Antibody Al/2 inhibit tumor growth in the HCC827 established tumor model.
- Antibody Al-Fab is purified from a 293HEK cell supernatant using a 12 mL CaptureSelect IgG-CHl Affinity Matrix. SDS-PAGE and analytical size exclusion chromatography (SEC) are utilized to address the purity and quality of the purified Antibody Al-Fab. The eluted material of this matrix is buffer exchanged with IX Tris- buffered saline (TBS). The hCD137* (*(human CD137 amino acids 22-161, AC121 S)- AAA-6His) is purified from a 293FIEK supernatant in three steps that utilize Ni Sepharose® Excel columns, Ni-NTA columns, and SEC columns.
- SEC analytical size exclusion chromatography
- the Antibody Al-Fab:CD137* complexes are combined at a 1 : 1 molar ratio and then subjected to a gel filtration column, pre-equilibrated in 20 millimolarTris pH 8.0, 100 millimolar sodium chloride. The resulting complex is concentrated to 12.5 milligrams/mL. After filtration, the Antibody Al-Fab:CD137 complex is set to a 1 : 1 ratio with sparse matrix crystal screening conditions in sitting drop plates using a Phoenix liquid handler, at both 21 °C and 8°C. Large, prism-like crystals grow in a single condition within 4 days in 1 molar Tri Sodium Citrate pH 6.5 at 21 °C.
- Crystals are harvested and cryo-protected in 20% glycerol and reservoir conditions, mounted and flash-frozen in liquid nitrogen, then using an Advanced Photo Source, Argonne National Laboratory, samples are X-ray screened and the data is collected.
- the Antibody Al- Fab/hCD137* data is processed to 2.4 A using the CCP4 suite of programs (Winn, M.D. et al. Acta. Cryst. 2011 : D67, 235-242).
- the structure is determined by Molecular Replacement with the program Phaser (McCoy, A.J. et al. J.
- Antibody Al - Fab:hCD137* complex is resolved and the epitope/paratope is illustrated in Table 5 below.
- Table 5 lists the residues on Antibody Al-Fab that are within 6A of the listed residues on hCD137*.
- the heavy chain of the Antibody Al-Fab has 57 contacts (cutoff 6 A) with hCD137* while the light chain has 18 contacts (cutoff 6 A).
- CD137L human CD137 amino acids 22-164, AC121 S
- hCD137L* human CD137 amino acids 22-164, AC121 S
- Antibody Al/2 BMS20H4.9 and PF83.
- the wells of a 96 well Immulon® 4HBX ELISA plate are coated overnight with 50 nanograms of hCD137** in 100 microliters of PBS, pH 7.2 with mild agitation at 4°C.
- hCD137L* His-tagged recombinant human CD137L
- R&D Systems a five-fold dilution series (392 nanomlar- 0.005 nanomolar) of His-tagged recombinant human CD137L (hereafter referred to as hCD137L*) (R&D Systems), (53-0.00068 nanomolar) of BMS20H4.9, (107-0.0014 nanomolar) of PF83, or (53-0.00068 nanomolar) of Antibody Al/2 are added with each dilution conducted in duplicate and incubated with mild agitation for 1 h at room temperature.
- the wells treated with the anti-CD137 antibodies are then washed and a 1 : 10000 dilution of HRP -conjugated goat anti-Fab antibody (Jackson ImmunoResearch Laboratories) is added and incubated at room temperature following standard protocol.
- the wells treated with hCD137L* are then washed and a 1 :5000 dilution of HRP- conjugated mouse anti-His antibody (Sigma-Aldrich®) is added and the plates are incubated at room temperature following standard protocol.
- TMB peroxidase chromogenic substrate and stop solution are used according to manufacturer's instruction for visualization and detection of signals. Absorbance readings are plotted in GraphPad Prism Software Version 6.
- EC50 values are calculated by nonlinear regression curve fit analysis of the software's One Site - Specific Binding function. In experiments performed as described, the binding affinities (EC50) to hCD137** are determined as 0.6 nanomolar for hCD137L, 1.4 nanomolar for Antibody 1/2, 0.43 nanomolar for BMS20H4.9, and greater than 10 nanomolar for PF83.
- hCD137L* The ability of hCD137L* to compete with BMS20H4.9, PF83, and Antibody Al/2 for binding to hCD137** can be determined as follows.
- a 96-well Immulon 4FIBX ELISA plate is coated overnight with 50 nanograms of hCD137** in 100 microliters of PBS, pH 7.2 with mild agitation at 4°C. After blocking (with 5% BSA in PBST) and washing, a five-fold dilution (196 to 0.0025 nanomolar) of hCD137L* is mixed with saturating amounts of the designated antibody: Antibody Al/2 (200 nanograms/well), BMS20H4.9 (3 nanograms/well), or PF83 (1000 nanograms/well).
- hCD137L* also blocks the binding of PF83 to hCD137** with an IC50 of 1.037 nanomolar (30% binding signal remains on the surface). There is no measurable effect of hCD137L* on the binding of BMS20H4.9 to hCD137**.
- Human CD 137 point mutations are introduced to determine the amino acids residues where Antibody Al/2, BMS20H4.9, and PF83 bind to human CD137.
- the CD137-Fc mutants are generated using the standard protocol of a commercially-available site directed mutagenesis kit (Quickchange II kit, Qiagen).
- the wild-type and mutant CD137-Fc proteins are expressed and purified. All the mutants reported here have a size exclusion profile similar to that of the wild-type CD137-Fc (i.e. the mutations introduced do not compromise the structural integrity of the protein).
- a point ELISA assay against CD137-Fc wild type and mutants is utilized.
- the wells of a 96-well Immulon 4HBX ELISA plate are coated overnight with 50 nanograms of human CD137-ECD-C121 S-Fc or its mutants in 100 microliters of PBS, pH 7.2 with mild agitation at 4°C. After blocking (with 5% BSA in PBST) and washing, a five-fold dilution eight-point series (100 - 0.00128 nanomolar) of the designated antibody is added and incubated with mild agitation at room temperature for 1 h.
- HRP -conjugated secondary antibody (1 : 10000 dilution of HRP -conjugated goat anti-Fab antibody (Jackson ImmunoResearch Laboratories) is added and incubated at room temperature following standard protocol. TMB peroxidase chromogenic substrate and stop solution are used according to manufacturer's instruction for visualization and detection of signals. Absorbance readings for each concentration point is normalized by the absorbance of the wild-type interaction. For each mutant, the mean of the normalized ratio for the eight concentrations is determined.
- CD 137 gene expression profile in human tumor immune infiltrates can be analyzed using The Cancer Genome Atlas (TCGA) database and computational methodologies. Briefly, expression ratios of CD137/CD3e are generated from Omicsoft curated TCGA RNASeq results. To compare the expression ratios of CD137/CD3e in tumor samples and adjacent normals of same tissue, a t-test is performed and Cohen's d is calculated for each tumor type. Tumor types that have a P value ⁇ 0.05 in the t-test of expression ratio of tumor versus normal and a large effect size of Cohen's d > 0.8 are statistically significant. The difference in expression ratio of CD137/CD3e in tumor versus normal tissue is calculated as the log fold change (logFC).
- logFC log fold change
- Antibody Al/2 Increases CD3 + T cell Tumor Infiltration In Vivo
- L55 human non-small cell lung cancer cells L55-CBG-2A-GFP, University of Pennsylvania
- human PBMCs 8 x 10 6 cells
- antibodies are dosed at 10 milligrams/kg once weekly for 4 weeks.
- tumors are collected in formalin, processed into paraffin, sectioned, and stained with an anti-CD3 antibody (Cell Signaling Technology). Images are acquired at 200X magnification using an Aperio XT ScanScope® and semi -quantitatively analyzed.
- the percentage of CD3 positive cells to total tumor cells is calculated using Aperio ImageScope software. Results are compared by One Way ANOVA, followed by Holm-Sidak method for multiple comparisons (Sigma Plot 12.5, Systat Software). In experiments performed as described above, Antibody Al/2 induces CD3 + T cell tumor infiltration in L55 established tumors. The percentage of CD3 + T cells in response to Antibody Al/2 (60%) is higher as compared to BMS20H4.9 (18%) or human IgG (27%) treatments.
- SEQ ID NO : 9 (LC VR of Antibody A 1 ) AIRMTQSPPSLSASVGDRVTITCQASQDIGNSLGWYQQKPGKAPKLVIFDASDLET GVPSRFSGSGSGTDFSLTISSLQPEDFATYYCQQGNSFPLTFGQGTRLEIK
- SEQ ID NO: 15 (DNA of LC of Antibody Al)
- SEQ ID NO : 16 (DNA of LC of Antibody A2)
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Endocrinology (AREA)
- Signal Processing (AREA)
- Computer Networks & Wireless Communication (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (27)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EA202090204A EA202090204A1 (ru) | 2017-08-01 | 2018-07-25 | Анти-cd137 антитела |
| MX2020001351A MX2020001351A (es) | 2017-08-01 | 2018-07-25 | Anticuerpos anti-cd137. |
| EP18752950.8A EP3661544B1 (en) | 2017-08-01 | 2018-07-25 | Anti-cd137 antibodies |
| UAA202000367A UA128388C2 (uk) | 2017-08-01 | 2018-07-25 | Антитіло до cd137 |
| EP22159268.6A EP4070811A1 (en) | 2017-08-01 | 2018-07-25 | Anti-cd137 antibodies |
| BR112020001441-9A BR112020001441A2 (pt) | 2017-08-01 | 2018-07-25 | anticorpos anti-cd137 |
| US16/497,493 US10906983B2 (en) | 2017-08-01 | 2018-07-25 | Anti-CD137 antibodies |
| PE2020000155A PE20200839A1 (es) | 2017-08-01 | 2018-07-25 | Anticuerpos anti-cd137 |
| SG11202000747VA SG11202000747VA (en) | 2017-08-01 | 2018-07-25 | Anti-cd137 antibodies |
| KR1020207002814A KR102344620B1 (ko) | 2017-08-01 | 2018-07-25 | 항-cd137 항체 |
| KR1020217041897A KR20210158420A (ko) | 2017-08-01 | 2018-07-25 | 항-cd137 항체 |
| JP2020505392A JP6743320B1 (ja) | 2017-08-01 | 2018-07-25 | 抗cd137抗体 |
| ES18752950T ES2912651T3 (es) | 2017-08-01 | 2018-07-25 | Anticuerpos anti-CD137 |
| IL272349A IL272349B2 (en) | 2017-08-01 | 2018-07-25 | ANTI-CD137 antibodies |
| CA3071383A CA3071383C (en) | 2017-08-01 | 2018-07-25 | Anti-cd137 antibodies |
| NZ761548A NZ761548B2 (en) | 2018-07-25 | Anti-cd137 antibodies | |
| JOP/2020/0016A JOP20200016B1 (ar) | 2017-08-01 | 2018-07-25 | أجسام مضادة لـ cd137 |
| AU2018311804A AU2018311804B2 (en) | 2017-08-01 | 2018-07-25 | Anti-CD137 antibodies |
| CR20200042A CR20200042A (es) | 2017-08-01 | 2018-07-25 | Anticuerpos anti-cd137 |
| CN201880064332.2A CN111182919B (zh) | 2017-08-01 | 2018-07-25 | 抗cd137抗体 |
| US16/750,842 US11512134B2 (en) | 2017-08-01 | 2020-01-23 | Anti-CD137 antibodies |
| SA520411186A SA520411186B1 (ar) | 2017-08-01 | 2020-01-29 | أجسام مضادة لعنقود التمايز 137 |
| CONC2020/0001050A CO2020001050A2 (es) | 2017-08-01 | 2020-01-29 | Anticuerpos anti-cd137 |
| PH12020500225A PH12020500225A1 (en) | 2017-08-01 | 2020-01-30 | Anti- cd137 antibodies |
| DO2020000020A DOP2020000020A (es) | 2017-08-01 | 2020-01-31 | Anticuerpos anti-cd137 |
| AU2021277707A AU2021277707A1 (en) | 2017-08-01 | 2021-12-02 | Anti-cd137 antibodies |
| US18/051,761 US12453771B2 (en) | 2017-08-01 | 2022-11-01 | Methods of treating cancer using anti-CD137 antibodies |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762539687P | 2017-08-01 | 2017-08-01 | |
| US62/539,687 | 2017-08-01 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/497,493 A-371-Of-International US10906983B2 (en) | 2017-08-01 | 2018-07-25 | Anti-CD137 antibodies |
| US16/750,842 Continuation US11512134B2 (en) | 2017-08-01 | 2020-01-23 | Anti-CD137 antibodies |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019027754A1 true WO2019027754A1 (en) | 2019-02-07 |
Family
ID=63165504
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/043632 Ceased WO2019027754A1 (en) | 2017-08-01 | 2018-07-25 | ANTI-CD137 ANTIBODIES |
Country Status (25)
| Country | Link |
|---|---|
| US (2) | US10906983B2 (enExample) |
| EP (2) | EP4070811A1 (enExample) |
| JP (2) | JP6743320B1 (enExample) |
| KR (2) | KR102344620B1 (enExample) |
| CN (1) | CN111182919B (enExample) |
| AU (2) | AU2018311804B2 (enExample) |
| BR (1) | BR112020001441A2 (enExample) |
| CA (2) | CA3071383C (enExample) |
| CL (1) | CL2020000233A1 (enExample) |
| CO (1) | CO2020001050A2 (enExample) |
| CR (1) | CR20200042A (enExample) |
| DO (1) | DOP2020000020A (enExample) |
| EA (1) | EA202090204A1 (enExample) |
| EC (1) | ECSP20007663A (enExample) |
| ES (1) | ES2912651T3 (enExample) |
| IL (1) | IL272349B2 (enExample) |
| JO (1) | JOP20200016B1 (enExample) |
| MA (1) | MA49749A (enExample) |
| MX (1) | MX2020001351A (enExample) |
| PE (1) | PE20200839A1 (enExample) |
| PH (1) | PH12020500225A1 (enExample) |
| SA (1) | SA520411186B1 (enExample) |
| SG (1) | SG11202000747VA (enExample) |
| UA (1) | UA128388C2 (enExample) |
| WO (1) | WO2019027754A1 (enExample) |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019182878A1 (en) * | 2018-03-23 | 2019-09-26 | Eli Lilly And Company | Anti-cd137 antibodies for combination with anti-pd-l1 antibodies |
| WO2019182879A1 (en) * | 2018-03-23 | 2019-09-26 | Eli Lilly And Company | Anti-cd137 antibodies for combination with anti-pd-1 antibodies |
| WO2020216947A1 (en) | 2019-04-24 | 2020-10-29 | Heidelberg Pharma Research Gmbh | Amatoxin antibody-drug conjugates and uses thereof |
| WO2020263879A1 (en) * | 2019-06-26 | 2020-12-30 | Ap Biosciences, Inc. | Antibodies for t-cell activation |
| US20210292416A1 (en) * | 2018-07-19 | 2021-09-23 | Eli Lilly And Company | Bispecific antibodies targeting immune checkpoints |
| US11718679B2 (en) | 2017-10-31 | 2023-08-08 | Compass Therapeutics Llc | CD137 antibodies and PD-1 antagonists and uses thereof |
| US11752207B2 (en) | 2017-07-11 | 2023-09-12 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
| US11851497B2 (en) | 2017-11-20 | 2023-12-26 | Compass Therapeutics Llc | CD137 antibodies and tumor antigen-targeting antibodies and uses thereof |
| EP4104857A4 (en) * | 2020-02-12 | 2024-04-17 | Chugai Seiyaku Kabushiki Kaisha | ANTI-CD137 ANTIGEN BINDING MOLECULE FOR USE IN CANCER TREATMENT |
| US12304960B2 (en) | 2018-08-10 | 2025-05-20 | Chugai Seiyaku Kabushiki Kaisha | Anti-CD137 antigen-binding molecule and utilization thereof |
| US12403185B2 (en) | 2018-07-23 | 2025-09-02 | Heidelberg Pharma Research Gmbh | Use of anti-CD137 antibody drug conjugate (ADC) in allogeneic cell therapy |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JOP20200016B1 (ar) * | 2017-08-01 | 2022-10-30 | Lilly Co Eli | أجسام مضادة لـ cd137 |
| US11512134B2 (en) | 2017-08-01 | 2022-11-29 | Eli Lilly And Company | Anti-CD137 antibodies |
| WO2022111571A1 (zh) | 2020-11-25 | 2022-06-02 | 上海君赛生物科技有限公司 | 肿瘤浸润淋巴细胞培养基及其应用 |
| CN120769904A (zh) | 2023-02-27 | 2025-10-10 | 上海君赛生物科技有限公司 | 表达膜结合细胞因子的肿瘤浸润淋巴细胞 |
| KR20250104669A (ko) | 2023-12-29 | 2025-07-08 | 쿠팡 주식회사 | 옵션 선택 가이드 정보 제공 방법 및 그 장치 |
| KR20250104655A (ko) | 2023-12-29 | 2025-07-08 | 쿠팡 주식회사 | 옵션 피커 화면 제공 방법 및 그 장치 |
| KR20250132789A (ko) | 2024-02-29 | 2025-09-05 | 쿠팡 주식회사 | 옵션 피커 화면 제공 방법 및 그 장치 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003049755A1 (en) * | 2001-10-09 | 2003-06-19 | Mayo Foundation For Medical Education And Research | Enhancement of immune responses by 4-1bb-binding agents |
| US7288638B2 (en) | 2003-10-10 | 2007-10-30 | Bristol-Myers Squibb Company | Fully human antibodies against human 4-1BB |
| US8337850B2 (en) | 2010-09-09 | 2012-12-25 | Pfizer Inc. | 4-1BB binding molecules |
| US20160244528A1 (en) * | 2015-02-22 | 2016-08-25 | Sorrento Therapeutics, Inc. | Antibody therapeutics that bind cd137 |
Family Cites Families (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6362325B1 (en) | 1988-11-07 | 2002-03-26 | Advanced Research And Technology Institute, Inc. | Murine 4-1BB gene |
| US6303121B1 (en) | 1992-07-30 | 2001-10-16 | Advanced Research And Technology | Method of using human receptor protein 4-1BB |
| US7211259B1 (en) | 1993-05-07 | 2007-05-01 | Immunex Corporation | 4-1BB polypeptides and DNA encoding 4-1BB polypeptides |
| IL129138A0 (en) | 1996-10-11 | 2000-02-17 | Bristol Myers Squibb Co | Methods and compositions for immunomodulation |
| WO2010042433A1 (en) | 2008-10-06 | 2010-04-15 | Bristol-Myers Squibb Company | Combination of cd137 antibody and ctla-4 antibody for the treatment of proliferative diseases |
| JOP20200094A1 (ar) | 2014-01-24 | 2017-06-16 | Dana Farber Cancer Inst Inc | جزيئات جسم مضاد لـ pd-1 واستخداماتها |
| EP3686219A1 (en) | 2014-02-04 | 2020-07-29 | Pfizer Inc | Combination of a pd-1 antagonist and a 4-1bb agonist for treating cancer |
| WO2016029073A2 (en) | 2014-08-22 | 2016-02-25 | Bristol-Myers Squibb Company | Treatment of cancer using a combination of an anti-pd-1 antibody and an anti-cd137 antibody |
| WO2017024465A1 (en) | 2015-08-10 | 2017-02-16 | Innovent Biologics (Suzhou) Co., Ltd. | Pd-1 antibodies |
| AR105654A1 (es) | 2015-08-24 | 2017-10-25 | Lilly Co Eli | Anticuerpos pd-l1 (ligando 1 de muerte celular programada) |
| GB201619648D0 (en) * | 2016-11-21 | 2017-01-04 | Alligator Bioscience Ab | Novel antibodies and uses thereof |
| JOP20200016B1 (ar) * | 2017-08-01 | 2022-10-30 | Lilly Co Eli | أجسام مضادة لـ cd137 |
-
2018
- 2018-07-25 JO JOP/2020/0016A patent/JOP20200016B1/ar active
- 2018-07-25 ES ES18752950T patent/ES2912651T3/es active Active
- 2018-07-25 CN CN201880064332.2A patent/CN111182919B/zh active Active
- 2018-07-25 SG SG11202000747VA patent/SG11202000747VA/en unknown
- 2018-07-25 MX MX2020001351A patent/MX2020001351A/es unknown
- 2018-07-25 JP JP2020505392A patent/JP6743320B1/ja active Active
- 2018-07-25 CA CA3071383A patent/CA3071383C/en active Active
- 2018-07-25 AU AU2018311804A patent/AU2018311804B2/en active Active
- 2018-07-25 PE PE2020000155A patent/PE20200839A1/es unknown
- 2018-07-25 EP EP22159268.6A patent/EP4070811A1/en not_active Withdrawn
- 2018-07-25 EP EP18752950.8A patent/EP3661544B1/en active Active
- 2018-07-25 KR KR1020207002814A patent/KR102344620B1/ko active Active
- 2018-07-25 BR BR112020001441-9A patent/BR112020001441A2/pt unknown
- 2018-07-25 IL IL272349A patent/IL272349B2/en unknown
- 2018-07-25 EA EA202090204A patent/EA202090204A1/ru unknown
- 2018-07-25 CR CR20200042A patent/CR20200042A/es unknown
- 2018-07-25 UA UAA202000367A patent/UA128388C2/uk unknown
- 2018-07-25 WO PCT/US2018/043632 patent/WO2019027754A1/en not_active Ceased
- 2018-07-25 CA CA3146758A patent/CA3146758A1/en active Pending
- 2018-07-25 MA MA049749A patent/MA49749A/fr unknown
- 2018-07-25 US US16/497,493 patent/US10906983B2/en active Active
- 2018-07-25 KR KR1020217041897A patent/KR20210158420A/ko not_active Ceased
-
2020
- 2020-01-29 CO CONC2020/0001050A patent/CO2020001050A2/es unknown
- 2020-01-29 CL CL2020000233A patent/CL2020000233A1/es unknown
- 2020-01-29 SA SA520411186A patent/SA520411186B1/ar unknown
- 2020-01-30 PH PH12020500225A patent/PH12020500225A1/en unknown
- 2020-01-31 DO DO2020000020A patent/DOP2020000020A/es unknown
- 2020-01-31 EC ECSENADI20207663A patent/ECSP20007663A/es unknown
- 2020-07-29 JP JP2020128427A patent/JP7257364B2/ja active Active
-
2021
- 2021-12-02 AU AU2021277707A patent/AU2021277707A1/en not_active Abandoned
-
2022
- 2022-11-01 US US18/051,761 patent/US12453771B2/en active Active
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003049755A1 (en) * | 2001-10-09 | 2003-06-19 | Mayo Foundation For Medical Education And Research | Enhancement of immune responses by 4-1bb-binding agents |
| US7288638B2 (en) | 2003-10-10 | 2007-10-30 | Bristol-Myers Squibb Company | Fully human antibodies against human 4-1BB |
| US8337850B2 (en) | 2010-09-09 | 2012-12-25 | Pfizer Inc. | 4-1BB binding molecules |
| US20160244528A1 (en) * | 2015-02-22 | 2016-08-25 | Sorrento Therapeutics, Inc. | Antibody therapeutics that bind cd137 |
Non-Patent Citations (13)
| Title |
|---|
| A. LOYD ET AL.: "Remington: The Science and Practice of Pharmacy", 2012, PHARMACEUTICAL PRESS |
| DEUTSCHER, METHODS IN ENZYMOLOGY, vol. 182, 1990, pages 83 - 89 |
| EMSLEY, P., ACTA CRYST., vol. D66, 2010, pages 486 - 501 |
| FISHER, T.M. ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 61, 2012, pages 1721 - 1733 |
| MCCOY, A.J. ET AL., J. APPL. CRYST., vol. 40, 2007, pages 658 - 674 |
| MELERO. I. ET AL., NAT. MED., vol. 3, no. 6, 1997, pages 682 - 685 |
| MURSHUDOV, G.N., ACT. CRYST., vol. D67, 2011, pages 355 - 367 |
| NORTH ET AL.: "A New Clustering of Antibody CDR Loop Conformations", JOURNAL OF MOLECULAR BIOLOGY, vol. 406, 2011, pages 228 - 256, XP028129711, DOI: doi:10.1016/j.jmb.2010.10.030 |
| SCOPES: "Protein Purification: Principles and Practice", 1994, SPRINGER |
| SEGAL, N.H., CLIN. CANCER RES., vol. 23, no. 8, 2017, pages 1929 - 1936 |
| TIMOTHY S. FISHER ET AL: "Targeting of 4-1BB by monoclonal antibody PF-05082566 enhances T-cell function and promotes anti-tumor activity", CANCER IMMUNOLOGY, IMMUNOTHERAPY, vol. 61, no. 10, 11 March 2012 (2012-03-11), Berlin/Heidelberg, pages 1721 - 1733, XP055391951, ISSN: 0340-7004, DOI: 10.1007/s00262-012-1237-1 * |
| WINN, M.D. ET AL., ACTA. CRYST., vol. D67, 2011, pages 235 - 242 |
| ZHIQIANG GUO ET AL: "Combined TIM-3 blockade and CD137 activation affords the long-term protection in a murine model of ovarian cancer", JOURNAL OF TRANSLATIONAL MEDICINE, BIOMED CENTRAL, vol. 11, no. 1, 17 September 2013 (2013-09-17), pages 215, XP021164386, ISSN: 1479-5876, DOI: 10.1186/1479-5876-11-215 * |
Cited By (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11752207B2 (en) | 2017-07-11 | 2023-09-12 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
| US12286483B2 (en) | 2017-10-31 | 2025-04-29 | Compass Therapeutics Llc | Method of treating cancer using CD137 antibodies and PD-1 antagonists |
| US11718679B2 (en) | 2017-10-31 | 2023-08-08 | Compass Therapeutics Llc | CD137 antibodies and PD-1 antagonists and uses thereof |
| US11851497B2 (en) | 2017-11-20 | 2023-12-26 | Compass Therapeutics Llc | CD137 antibodies and tumor antigen-targeting antibodies and uses thereof |
| WO2019182879A1 (en) * | 2018-03-23 | 2019-09-26 | Eli Lilly And Company | Anti-cd137 antibodies for combination with anti-pd-1 antibodies |
| US12037406B2 (en) | 2018-03-23 | 2024-07-16 | Eli Lilly And Company | Anti-CD137 antibodies for combination with anti-PD-L1 antibodies |
| WO2019182878A1 (en) * | 2018-03-23 | 2019-09-26 | Eli Lilly And Company | Anti-cd137 antibodies for combination with anti-pd-l1 antibodies |
| AU2019239194B2 (en) * | 2018-03-23 | 2023-09-14 | Eli Lilly And Company | Anti-CD137 antibodies for combination with anti-PD-L1 antibodies |
| US20210292416A1 (en) * | 2018-07-19 | 2021-09-23 | Eli Lilly And Company | Bispecific antibodies targeting immune checkpoints |
| US11939381B2 (en) | 2018-07-19 | 2024-03-26 | Eli Lilly And Company | Bispecific antibodies targeting immune checkpoints |
| US12403185B2 (en) | 2018-07-23 | 2025-09-02 | Heidelberg Pharma Research Gmbh | Use of anti-CD137 antibody drug conjugate (ADC) in allogeneic cell therapy |
| US12304960B2 (en) | 2018-08-10 | 2025-05-20 | Chugai Seiyaku Kabushiki Kaisha | Anti-CD137 antigen-binding molecule and utilization thereof |
| WO2020216947A1 (en) | 2019-04-24 | 2020-10-29 | Heidelberg Pharma Research Gmbh | Amatoxin antibody-drug conjugates and uses thereof |
| US11725058B2 (en) | 2019-06-26 | 2023-08-15 | Ap Biosciences, Inc. | CD137 antibodies for T-cell activation |
| CN114514244A (zh) * | 2019-06-26 | 2022-05-17 | 圆祥生技股份有限公司 | T细胞活化抗体 |
| WO2020263879A1 (en) * | 2019-06-26 | 2020-12-30 | Ap Biosciences, Inc. | Antibodies for t-cell activation |
| US12312409B2 (en) | 2019-06-26 | 2025-05-27 | Ap Biosciences, Inc. | Bispecific CD137-binding antibodies for T-cell activation |
| EP4104857A4 (en) * | 2020-02-12 | 2024-04-17 | Chugai Seiyaku Kabushiki Kaisha | ANTI-CD137 ANTIGEN BINDING MOLECULE FOR USE IN CANCER TREATMENT |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12453771B2 (en) | Methods of treating cancer using anti-CD137 antibodies | |
| US20250333525A1 (en) | Anti-cd137 antibodies for combination with anti-pd-1 antibodies | |
| CA3094763C (en) | Anti-cd137 antibodies for combination with anti-pd-l1 antibodies | |
| US11512134B2 (en) | Anti-CD137 antibodies | |
| HK40081907A (en) | Anti-cd137 antibodies | |
| HK40019208B (en) | Anti-cd137 antibodies | |
| HK40045294A (en) | Anti-cd137 antibodies for combination with anti-pd-l1 antibodies | |
| HK40045294B (en) | Anti-cd137 antibodies for combination with anti-pd-l1 antibodies | |
| EA043217B1 (ru) | Анти-cd137 антитела |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18752950 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3071383 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 20207002814 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2020/0001050 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2020000084 Country of ref document: DZ |
|
| ENP | Entry into the national phase |
Ref document number: 2020505392 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020001441 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2018311804 Country of ref document: AU Date of ref document: 20180725 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2020/0001050 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2018752950 Country of ref document: EP Effective date: 20200302 |
|
| ENP | Entry into the national phase |
Ref document number: 112020001441 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200123 |
|
| WWG | Wipo information: grant in national office |
Ref document number: NC2020/0001050 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 520411186 Country of ref document: SA |