WO2018217988A1 - MODIFIED IgG1 Fc DOMAINS AND ANTI-CD40 DOMAIN ANTIBODY FUSIONS THEREWITH - Google Patents

MODIFIED IgG1 Fc DOMAINS AND ANTI-CD40 DOMAIN ANTIBODY FUSIONS THEREWITH Download PDF

Info

Publication number
WO2018217988A1
WO2018217988A1 PCT/US2018/034330 US2018034330W WO2018217988A1 WO 2018217988 A1 WO2018217988 A1 WO 2018217988A1 US 2018034330 W US2018034330 W US 2018034330W WO 2018217988 A1 WO2018217988 A1 WO 2018217988A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
domain
amino acid
antibody
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/034330
Other languages
English (en)
French (fr)
Other versions
WO2018217988A9 (en
Inventor
Aaron YAMNIUK
Mary STRUTHERS
Suzanne J. Suchard
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bristol Myers Squibb Co
Original Assignee
Bristol Myers Squibb Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020197037759A priority Critical patent/KR20200012907A/ko
Priority to CN201880032964.0A priority patent/CN110637035A/zh
Priority to KR1020247019564A priority patent/KR102847736B1/ko
Priority to EP18731284.8A priority patent/EP3630832A1/en
Priority to US16/495,994 priority patent/US20200148779A1/en
Priority to JP2019564951A priority patent/JP2020521458A/ja
Application filed by Bristol Myers Squibb Co filed Critical Bristol Myers Squibb Co
Publication of WO2018217988A1 publication Critical patent/WO2018217988A1/en
Publication of WO2018217988A9 publication Critical patent/WO2018217988A9/en
Anticipated expiration legal-status Critical
Priority to JP2023077286A priority patent/JP2023113636A/ja
Priority to US19/313,261 priority patent/US20260042858A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/72Increased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • Modified IgGl Fc domains having reduced binding to Fc-gamma-receptors are provided.
  • Antibody polypeptides comprising an anti-CD40 single variable domain and a modified Fc domain are provided.
  • the antibody polypeptides bind CD40, do not exhibit CD40 agonist activity, do not activate immature dendritic cells, and have improved biophysical properties suitable for development as a therapeutic agent.
  • Compositions comprising same, methods of use for treatment of diseases involving CD40 activity, and uses in the preparation of a medicament for treatment of disease involving CD40 activity are provided.
  • CD40 is a co-stimulatory molecule belonging to the tumor necrosis factor (TNF) receptor superfamily that is present on antigen presenting cells (APC), including dendritic cells, B cells, and macrophages. APCs are activated when CD40 binds its ligand, CD 154 (CD40L), on TH cells. CD40-mediated APC activation is involved in a variety of immune responses, including cytokine production, up-regulation of co-stimulatory molecules (such as CD86), and enhanced antigen presentation and B cell proliferation. CD40 can also be expressed by endothelial cells, smooth muscle cells, fibroblasts, and epithelial cells.
  • TNF tumor necrosis factor
  • APCs antigen presenting cells
  • CD40L CD 154
  • CD40-mediated APC activation is involved in a variety of immune responses, including cytokine production, up-regulation of co-stimulatory molecules (such as CD86), and enhanced antigen presentation and B cell proliferation.
  • CD40 can also be
  • CD40 activation is also involved in a variety of undesired T cell responses related to autoimmunity, transplant rejection, or allergic responses, for example.
  • One strategy for controlling undesirable T cell responses is to target CD40 with an antagonistic antibody.
  • monoclonal antibody HCD122 (Lucatumumab), formerly known as Chiron 1212, is currently in clinical trials for the treatment of certain CD40-mediated inflammatory diseases.
  • a human IgGl Fc domain polypeptide comprising a mutation at Kabat position 238 that reduces binding to FC-gamma-receptors, wherein proline 238 (P238) is mutated to one of the residues selected from lysine, serine, alanine, arginine and tryptophan.
  • the IgGl Fc can comprise an amino acid sequence of SEQ ID NO: 65.
  • a human IgGl Fc domain polypeptide comprising a lysine substituted at Kabat position 238.
  • Exemplary amino acids sequences for the human IgGl Fc domain ol e tide are:
  • fusion polypeptide comprising: (A) a heterologous polypeptide; and (B) an Fc domain as described above.
  • an antibody polypeptide comprising: (1) a single variable domain, said single variable domain comprising: (a) a CDR1 region comprising the amino acid sequence of SEQ ID NO: 1 or differing from the CDR1 region of SEQ ID NO: 1 by up to two amino acids, (b) a CDR2 region comprising the amino acid sequence of SEQ ID NO: 2 or differing from the CDR2 region of SEQ ID NO: 2 by up to three amino acids, and (c) a CDR3 region comprising the amino acid sequence of SEQ ID NO: 3 or differing from the CDR3 region of SEQ ID NO: 3 by up to six amino acids, and wherein said single variable domain binds CD40; and (2) an Fc domain that is a human IgGl Fc domain polypeptide comprising a mutation at Kabat position 238 that reduces binding to FC-gamma-receptors, wherein proline 238 (P238) is mutated to one of the residues selected from lysine, serine, alan
  • the single variable domain of the antibody polypeptide described herein antagonizes at least one activity of CD40.
  • the antibody polypeptide as described herein has increased stability, relative to a reference polypeptide that has the same single variable domain sequence and is fused to a wild-type IgGl Fc domain.
  • an antibody polypeptide comprising: (1) a single variable domain as described above, wherein the human IgGl Fc domain has a lysine substituted at Kabat position 238.
  • amino acids sequences for the human IgGl Fc domain polypeptide are:
  • CDR1 region consists of a sequence X 1 -Tyr-Glu-Y 1 -Trp (SEQ ID NO: 4), wherein X 1 is Asp or Gly, and Y 1 is Met or Leu;
  • the CDR2 region consists of a sequence Ala-Ile-Asn- Pro-X 2 -Gly-Y 2 -Z 2 -Thr-Tyr-Tyr-Ala-Asp-Ser-Val-A 2 -Gly (SEQ ID NO: 5), wherein X 2 is Gin, Tyr, His, Trp, or Ala, Y 2 is Thr, Asn, Gly, Ser, or Gin, Z 2 is Arg, Leu, Tyr, His, or Phe, and A?
  • the CDR3 region consists of a sequence X3-Pro-Y 3 -Z 3 - A3-B3-C3 (SEQ ID NO: 6), wherein X 3 is Leu, Pro, or Glu, Y 3 is Phe, Gin, Thr, Met, or Tyr, Z3 is Arg, Tyr, Pro, Leu, Thr, He, Phe, Met, or Ser, A3 is Phe or Tyr, B 3 is Ser, Gin, His, Asp, Lys, Glu, or Gly, and C 3 is Asp, Tyr, Glu, or Ser.
  • an antibody polypeptide as described above wherein: (a) the CDR1 region consists of the amino acid sequence of SEQ ID NO: 1 (CDR1 of 3h-56-269), (b) the CDR2 region consists of the amino acid sequence of SEQ ID NO: 2 (CDR2 of 3h- 56-269), and (c) the CDR3 region consists of the amino acid sequence of SEQ ID NO: 3 (CDR3 of 3h-56-269).
  • an antibody polypeptide comprising or consisting of the amino acid sequence:
  • nucleic acid encoding any of the human IgGl Fc domain polypeptides, the fusion polypeptides, or the antibody polypeptides of the disclosure.
  • An expression vector comprising the nucleic acid molecule is also provided.
  • a cell transformed with the expression vector is provided.
  • a pharmaceutical composition comprising the antibody polypeptide described above, and a pharmaceutically acceptable carrier is provided.
  • a method of treating or preventing an immune disease in a subject comprising administering to the subject the antibody polypeptide described above is provided.
  • the immune disease can be selected from the group consisting of Addison's disease, allergies, anaphylaxis, ankylosing spondylitis, asthma, atherosclerosis, atopic allergy, autoimmune diseases of the ear, autoimmune diseases of the eye, autoimmune hepatitis, autoimmune parotitis, bronchial asthma, coronary heart disease, Crohn's disease, diabetes, epididymitis, glomerulonephritis, Graves' disease, Guillain-Barre syndrome, Hashimoto's disease, hemolytic anemia, idiopathic thrombocytopenic purpura, inflammatory bowel disease, immune response to recombinant drug products (e.g., Factor VII in hemophiliacs), systemic lupus erythematosus, multiple sclerosis, myasthenia gravis, pemphigus
  • FIG. 1 depicts amino acid sequences of representative antibody polypeptides useful of the disclosure.
  • FIG. 1 A depicts the amino acid sequence (SEQ ID NO: 70) of an antibody polypeptide fusion of a single variable domain antibody BMS3h-56-269 (SEQ ID NO: 41) and an Fc domain (IgGla-P238 ; SEQ ID NO: 66).
  • the amino acid sequence of the Fc domain (SEQ ID NO: 66) is italicized; the underlined italicized residue 23 (corresponds to Kabat position 238) is a proline-to-lysine mutation.
  • FIG. 1 A depicts the amino acid sequence (SEQ ID NO: 70) of an antibody polypeptide fusion of a single variable domain antibody BMS3h-56-269 (SEQ ID NO: 41) and an Fc domain (IgGla-P238 ; SEQ ID NO: 66).
  • the amino acid sequence of the Fc domain (SEQ ID NO: 66) is italicized;
  • I B depicts the amino acid sequence (SEQ ID NO: 71) of an antibody polypeptide fusion of a single variable domain antibody BMS3h-56-269 (SEQ ID NO: 41) and another Fc domain (IgGl f-P238K; SEQ ID NO:67).
  • the amino acid sequence of the Fc domain (SEQ ID NO: 67) is italicized.
  • CDR1 SEQ ID NO: 1
  • CDR2 SEQ ID NO: 2
  • CDR3 SEQ ID NO: 3
  • FR1 SEQ ID NO: 42
  • FR2 SEQ ID NO: 44
  • FR3 SEQ ID NO: 47
  • FR4 SEQ ID NO: 54
  • FIG. 2 comprising FIGS. 2A-2E, depicts iDC activation data at various concentrations of dAb-Fc fusions for up to 9 iDC donors.
  • FIGS. 2A-2D Dose response of BMS-986090 (anti-CD40 dAb fused with IgG4 Fc), CD40L (a soluble CD40L trimer (via isoleucine zipper trimerization motif) and mAb 134-2141 (agonistic anti-CD40 antibody), on CD86 expression (FIG. 2A), ICAM-1 expression (FIG. 2B), IL-6 release (FIG. 2C) and TNF-alpha release (FIG. 2D).
  • ChiL6-IgG4 Control-L6: negative control.
  • FIG. 2E depicts comparison of BMS-986090 with 3h-59-269-aba (dAb-IgGl fusion) at 100 ⁇ g/ml treated iDC from up to 9 donors.
  • FIG. 3 comprising FIGS. 3A-3D, depicting that iDC activation is increased by
  • iDC treated with the indicated concentrations (in ⁇ g/ml) in solution or with cross-linking ('x-link') is indicated; cross-linking refers to the addition of CD32-expressing CHO cells.
  • ChiL6-IgG4 serves as a negative control.
  • FIG. 4 depicts data from an iDC activation assay with anti-CD40 dAb with IgG4, IgGl . l f, IgG1.3f, and CT Fc tails.
  • L6-IgG4 (ChiL6-IgG4) serves as a negative control; agonistic anti-CD40 mAb 1234-2141 is a positive control.
  • iDC treated with the indicated concentrations ⁇ g/ml ). Addition of CD32 expressing CHO cells to the iDC cultures (right panels) leads to a large increase in cytokine release and activation marker upregulation for all fusion proteins except for 3h-59-269-CT.
  • FIG. 5, comprising FIGS. 5A-5E, depicts DSC thermogram data for dAb-Fc molecules.
  • FIG. 5A 3h56-269-IgG4.1.
  • FIG. 5B 3h56-269-CT.
  • FIG. 5C 3h56-269-IgGl - D265A.
  • FIG. 5D 3h56-269-IgGl . lf.
  • FIG. 5E 3h56-269-IgG1.3f.
  • the thick line show the thermogram data and the thinner lines represent the simplest best fit.
  • FIG. 6, comprising FIGS. 6A-6F, depicts icIEF data for dAb-Fc molecules.
  • FIG. 6A 3h56-269-IgG4.1.
  • FIG. 6B 3h56-269-CT.
  • FIG. 6C 3h56-269-CT (produced from UCOE-CHO cells).
  • FIG. 6D 3h56-269-IgGl -D265A.
  • FIG. 6E 3h56-269-IgGl . lf.
  • FIG. 6F 3h56-269-IgG 1.3f.
  • the pi markers are indicated in panel A at pi 5.85 and pi 10.10.
  • FIG. 7 depicts SPR sensorgram data for the capture of 7 ⁇ g/ml hCD64-His with binding of four 1F4 antibodies atl ⁇ .
  • FIG. 8 depicts icIEF data for thirteen 1 F4 monoclonal antibodies having different
  • FIG. 9 depicts iDC activation data for 3h-59-269-IgGl -P238K and 3h-59-269- IgGl -N297A.
  • L6-IgG4 (ChiL6-IgG4) serves as a negative control; BMS-986090 (3h-59- 269-IgG4) is a positive control.
  • FIG. 10 depicts iDC activation for anti-CD40 domain antibody-Fc fusion proteins with different Fc tails.
  • L6-IgG4 (ChiL6-IgG4) serves as a negative control; agonistic mAbl 234-2141 and BMS-986090 (3h-59-269-IgG4) are positive controls.
  • iDCs are treated with the indicated concentrations ⁇ g/ml ) of antibody.
  • Activation of iDCs is observed with all fusion proteins and is increased with the addition of CD32 expressing CHO (shown on the left of each graph indicated by "+CD32 CHO"), except for fusions containing a P238K or N297A mutation.
  • FIG. 11, comprising FIGS. 1 lA-1 ID, depict DSC thermogram data for dAb-Fc molecules.
  • FIG.11A 3h56-269-IgGla-C220S,C226A,C229A,P238S.
  • FIG. 1 IB 3h56- 269-IgG la-C220S,C226A,C229A,P238K.
  • FIG.11C 3h56-269-IgGla-C220S,P238K.
  • FIG. 1 I D 3h56-269-IgG l f-C220S,N297A. DETAILED DESCRIPTION
  • CD54 also referred to as ICAM-1
  • FcgR Fc-gamma receptor (interchangeable with FcyR)
  • VH variable heavy chain Further abbreviations and definitions are provided herein.
  • the carboxy-terminal "half of a heavy chain defines a constant region (Fc) primarily responsible for effector function.
  • Fc domain refers to the constant region antibody sequences comprising CH2 and CH3 constant domains as delimited according to abat et al., Sequences of Immunological Interest, 5 th ed., U.S. Dept. Health & Human Services, Washington, D.C. (1991).
  • the Fc domain disclosed herein is derived from a human IgG, and more specifically a human IgGl Fc region.
  • the human IgGl Fc domain comprises a mutation at Kabat position 238.
  • the mutation substitutes proline 238 (P238) with an amino acid selected from lysine (K), serine (S), alanine (A), arginine (R) and tryptophan (W); or selected from lysine and serine; or selected from lysine.
  • Exemplary IgG Fc domain sequences are in Table 1. The mutated residue is underlined. SEQ ID NOS: 134 and 135 are additional exemplary IgG Fc domain sequences.
  • IgG heavy chain genes encode a C-terminal lysine
  • the lysine is often absent from endogenous antibodies as a result of cleavage in blood circulation.
  • Antibodies having IgG heavy chains including a C-terminal lysine when expressed in mammalian cell cultures, may also have variable levels of C-terminal lysine present (Cai et al, 2011,
  • the C-terminal lysine of any IgG heavy chain Fc domain disclosed herein may be omitted. See, for instance, SEQ ID NOs: 66 and 134, and SEQ ID NOS: 67 and 135. Similarly, the lysine at the C-terminal of SEQ ID NO: 68 and SEQ ID NO: 69 may optionally be absent.
  • the mutated IgGl Fc domain exhibits reduced binding to Fc gamma receptors.
  • the reduced binding to Fc gamma receptors reduces or precludes iDC activation as measured by at least one of: 1 ) release of cytokine IL-6 and/or TNF-alpha; and 2) upregulation of cell surface expression of CD86 and/or CD54.
  • the reduced binding to Fc gamma receptors is also believed to reduce or preclude clustering/crosslinking of FcgRs on immature dendritic cells.
  • the mutated IgGl Fc domain can contribute to thermal stability and homogeneity of antibody polypeptides comprising the mutated IgGl Fc domain.
  • Antibody polypeptides comprising mutated IgGl Fc domain
  • the present disclosure includes a fusion polypeptide comprising a mutated IgGl Fc domain.
  • a fusion polypeptide comprising a mutated IgGl Fc domain.
  • the present disclosure includes a fusion polypeptide of a heterologous polypeptide and a mutated IgGl Fc domain of the disclosure.
  • the heterologous polypeptide can comprise or consist of a heavy chain variable domain.
  • the carboxyl terminus of the heavy chain variable domain may be linked or fused to the amino terminus of the Fc domain.
  • the carboxyl terminus of the heavy chain variable domain may be linked or fused to the amino terminus of a linker amino acid sequence, which itself is fused to the amino terminus of the Fc domain.
  • the carboxyl terminus of the heavy chain variable domain may be linked or fused to the amino terminus of a CHI domain, which itself is fused to the Fc domain.
  • the fusion polypeptide may comprise the hinge region between the CHI and CH2 domains in whole or in part.
  • an amino acid linker sequence is present between the heavy chain variable domain and the Fc domain.
  • the present disclosure further includes a single variable domain (a domain antibody) is fused to an Fc domain.
  • a “domain antibody” (dAb) comprises a single variable domain (VL or VH) domain that is capable of specifically and monovalently binding an antigen, such as CD40.
  • the carboxyl terminus of the single variable domain may be linked or fused to the amino terminus of the Fc CH2 domain.
  • the carboxyl terminus of the single variable domain may be linked or fused to the amino terminus of a linker amino acid sequence, which itself is fused to the amino terminus of an Fc domain.
  • the carboxyl terminus of the variable domain may be linked or fused to the amino terminus of a CHI domain, which itself is fused to the Fc CH2 domain.
  • the protein may comprise the hinge region between the CHI and CH2 domains in whole or in part.
  • an amino acid linker sequence is present between the single variable domain and the Fc domain.
  • antibody polypeptides that are fusion polypeptides comprising an anti-human CD40 domain antibody and a modified human Fc domain.
  • the antibody polypeptides further comprise an amino acid linker intervening between the domain antibody and the Fc domain. Exemplary antibody polypeptides are depicted in Figure 1.
  • the antibody polypeptides of the disclosure comprise a domain antibody that specifically binds human CD40 and does not exhibit CD40 agonist activity.
  • a "domain antibody” comprises a single variable domain (VL or VH) domain that is capable of specifically and monovalently binding an antigen, such as CD40.
  • the domain antibodies contain a "VH domain” and are human.
  • Bivalent anti-CD40 antibodies are believed to exhibit agonist activity because of their ability to cross-link bound CD40 molecules on the cell surface. While not limited by any particular theory, it is believed that monovalent dAbs do not activate CD40, because the dAbs do not cross-link CD40.
  • CD40 is also known as B-cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CDW40, MGC9013, p50, TNFRSF5, and Tumor necrosis factor receptor superfamily member 5.
  • “Human CD40” refers to the CD40 comprising the following amino acid sequence:
  • variable domain refers to immunoglobulin variable domains defined by Kabat et al., Sequences of Immunological Interest, 5 th ed., U.S. Dept. Health & Human Services, Washington, D.C. ( 1991).
  • the numbering and positioning of CDR amino acid residues within the variable domains is in accordance with the well-known Kabat numbering convention.
  • Kabat numbering for BMS3h-56-269 SEQ ID NO: 41
  • BMS3h-56-269 has insertion residues 52A, 82A, 82B, 82C, and is missing residue 100.
  • human when applied to antibody polypeptides, means that the antibody polypeptide has a sequence, e.g., FR and/or CH domains, derived from a human immunoglobulin.
  • a sequence is "derived from” a human immunoglobulin coding sequence when the sequence is either: (a) isolated from a human individual or from a cell or cell line from a human individual; (b) isolated from a library of cloned human antibody gene sequences or of human antibody variable domain sequences; or (c) diversified by mutation and selection from one or more of the polypeptides above.
  • An "isolated" compound as used herein means that the compound is removed from at least one component with which the compound is naturally associated with in nature.
  • telomere binding refers to the binding of an antigen by an antibody polypeptide with a dissociation constant (Kd) of about 1 ⁇ or lower as measured, for example, by surface plasmon resonance.
  • Kd dissociation constant
  • Suitable assay systems include the BIAcoreTM surface plasmon resonance (SPR) system and BIAcoreTM kinetic evaluation software (e.g., version 2.1).
  • CD40 activities include, but are not limited to, T cell activation (e.g., induction of T cell proliferation or cytokine secretion), macrophage activation (e.g., the induction of reactive oxygen species and nitric oxide in the macrophage), and B cell activation (e.g., B cell proliferation, antibody isotype switching, or differentiation to plasma cells).
  • CD40 activities can be mediated by interaction with other molecules.
  • CD40 activities include the functional interaction between CD40 and the following molecules, which are identified by their Uniprot Accession Number is parentheses:
  • a CD40 "activity” includes an interaction with TRAF2.
  • CD40/TRAF2 interaction activates NF- ⁇ and JNK.
  • This CD40 activity thus can be determined by CD40-dependent cellular NF- ⁇ and JNK activation, relative to a reference.
  • the terms "activate,” “activates,” and “activated” refer to an increase in a given measurable CD40 activity by at least 10% relative to a reference, for example, at least 10%, 25%, 50%, 75%, 80%, 90%, or even 100%, or more.
  • a CD40 activity is "antagonized” if the activity is reduced by at least 10%, and in an exemplary embodiment, at least about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%), 99%, or even 100%) (i.e., no detectable activity), relative to the absence of the antagonist.
  • an antibody polypeptide may antagonize some or all CD40 activity, while not activating CD40. In one embodiment, the antibody polypeptide does not activate B cell proliferation.
  • the antibody polypeptide does not activate cytokine secretion by T cells, where the cytokine is at least one cytokine selected from the group consisting of IL-2, IL-6, IL-10, IL-13, TNF-a, and IFN- ⁇ .
  • Antibody polypeptides of the present disclosure can be administered to human patients while largely avoiding the anti-antibody immune response often provoked by the administration of antibodies from other species, e.g., mouse.
  • murine antibodies can be "humanized” by grafting murine CDRs onto a human variable domain FR, according to procedures well known in the art. Human antibodies as disclosed herein, however, can be produced without the need for genetic manipulation of a murine antibody sequence.
  • the anti-CD40 domain antibodies useful in the present disclosure comprise three complementarity-determining regions (CDRs) and four framework regions (FRs), arranged from amino-terminus to carboxy-terminus in the following order: FR1 , CDRl , FR2, CDR2, FR3, CDR3, FR4.
  • CDRs complementarity-determining regions
  • FRs framework regions
  • the three CDRs contain most of the residues that form specific interactions with the antigen and are primarily responsible for antigen recognition.
  • BMS3h-56-269 is an exemplary single variable domain antibody polypeptide that specifically binds to, but does not agonize, human CD40, as disclosed in U.S. Publication No. 2014/0099317.
  • the CDRs contain most of the residues that form specific interactions with the antigen.
  • the single variable domain of an antibody polypeptide of the present disclosure comprises CDRl, CDR2, and CDR3 regions that have the same amino acid sequence as the CDRl, CDR2, and CDR3 regions of BMS3h-56-269 (SEQ ID NO: 41) or that each differ from the CDRl, CDR2, and CDR3 regions by one, two, three, four, five, or six amino acids.
  • the amino acids of the three complementarity-determining regions are underlined.
  • the amino acid sequence of CDRl is DYEMW (SEQ ID NO: 1).
  • the amino acid sequence of CDR2 is AINPQGTRTYYADSVKG (SEQ ID NO: 2), and the amino acid sequence of CDR3 is LPFRFSD (SEQ ID NO: 3).
  • An exemplary nucleic acid sequence encoding the amino acid sequence of BMS3h-56-269 is:
  • variable domain of an antibody polypeptide provided by the disclosure comprises CDRl , CDR2, and CDR3 regions that have the same amino acid sequence as the CDRl, CDR2, and CDR3 regions of BMS3h-56-269 (SEQ ID NOs: 1-3, respectively) or that each differ from the CDRl, CDR2, and CDR3 regions by one, two, three, four, five, or six amino acids.
  • the CDRl region may vary by up to two amino acids from SEQ ID NO: 1.
  • the CDR2 region may vary by up to three amino acids from SEQ ID NO: 2.
  • the CDR3 region may vary by up to six amino acids from SEQ ID NO: 3.
  • variable domain of an antibody polypeptide can comprise: (a) a CDRl region comprising the amino acid sequence of SEQ ID NO: 1 or differing from the CDRl region of SEQ ID NO: 1 by up to two amino acids, (b) a CDR2 region comprising the amino acid sequence of SEQ ID NO: 2 or differing from the CDR2 region of SEQ ID NO: 2 by up to three amino acids, and (c) a CDR3 region comprising the amino acid sequence of SEQ ID NO: 3 or differing from the CDR3 region of SEQ ID NO: 3 by up to six amino acids, and wherein said single variable domain binds CD40.
  • variable domain of an antibody polypeptide can comprise: (a) a CDRl region consisting of the amino acid sequence of SEQ ID NO: I or differing from the CDRl region of SEQ ID NO: 1 by up to two amino acids, (b) a CDR2 region consisting of the amino acid sequence of SEQ ID NO: 2 or differing from the CDR2 region of SEQ ID NO: 2 by up to three amino acids, and (c) a CDR3 region consisting of the amino acid sequence of SEQ ID NO: 3 or differing from the CDR3 region of SEQ ID NO: 3 by up to six amino acids, and wherein said single variable domain binds CD40.
  • Exemplary antibody polypeptides are described in Section 2.5. Further exemplary antibodies are described here.
  • variable domain of an antibody polypeptide disclosed herein can comprise (a) a CDRl region that consists of a sequence X 1 -Tyr-Glu-Y 1 -Trp (SEQ ID NO: 4), wherein X 1 is Asp or Gly, and Y 1 is Met or Leu; (b) a CDR2 region that consists of a sequence Ala-Ile- Asn-Pro-X 2 -Gly-Y 2 -Z 2 -Thr-Tyr-Tyr-Ala-Asp-Ser-Val-A 2 -Gly (SEQ ID NO: 5), wherein X 2 is Gin, Tyr, His, Trp, or Ala, Y 2 is Thr, Asn, Gly, Ser, or Gin, Z 2 is Arg, Leu, Tyr, His, or Phe, and A2 is Lys or Met; and (c) a CDR3 region that consists of a sequence X3-Pro-Y3-Z 3 - A3-B3-
  • variable domain of an antibody polypeptide disclosed herein can comprise (a) a CDR1 region that consists of a sequence X 1 -Tyr-Glu-Y 1 -Trp (SEQ ID NO: 4), wherein X 1 is Asp, and Y 1 is Met; (b) a CDR2 region that consists of a sequence Ala-Ile-Asn-Pro-X 2 - Gly-Y 2 -Z 2 -Thr-Tyr-Tyr-Ala-Asp-Ser-Val-A2-Gly (SEQ ID NO: 5), wherein X 2 is Gin, Tyr, His, Trp, or Ala, Y 2 is Thr, Asn, Gly, Ser, or Gin, Z 2 is Arg, Leu, Tyr, His, or Phe, and A?
  • X3 is Leu
  • Y 3 is Phe, Gin, Thr, or Met
  • Z 3 is Arg
  • Tyr is Leu, Thr, or Phe
  • A3 is Phe
  • B3 is Ser, Gin, His, Asp, or Glu
  • C 3 is Asp or Glu.
  • variable domain of an antibody polypeptide disclosed herein can comprise (a) a CDRl region that consists of the amino acid sequence of SEQ ID NO: 1 ; (b) a CDR2 region that consists of the amino acid sequence of SEQ ID NO: 2; and (c) a CDR3 region that consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO; 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, and SEQ ID NO: 23.
  • variable domain of an antibody polypeptide disclosed herein can comprise (a) a CDRl region that consists of the amino acid sequence of SEQ ID NO: 1 ; (b) a CDR2 region that consists of the amino acid sequence of SEQ ID NO: 27; and (c) a CDR3 region that consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 24, SEQ ID NO: 25, and SEQ ID NO: 26.
  • variable domain of an antibody polypeptide disclosed herein can comprise (a) a CDRl region that consists of the amino acid sequence of SEQ ID NO: 1 ; (b) a CDR2 region that consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 32, SEQ ID NO: 35, and SEQ ID NO: 37; and (c) a CDR3 region that consists of the amino acid sequence of SEQ ID NO: 7.
  • variable domain of an antibody polypeptide disclosed herein can comprise (a) a CDRl region that consists of the amino acid sequence of SEQ ID NO: 1 ; (b) a CDR2 region that consists of an amino acid sequence selected from the group consisting of: SEQ ID NO:
  • variable domain of an antibody polypeptide disclosed herein can comprise (a) a CDRl region that consists an amino acid sequence selected from the group consisting of: SEQ ID NO: 39 and SEQ ID NO: 40; (b) the CDR2 region consists of the amino acid sequence of SEQ ID NO: 27; and (c) the CDR3 region consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 8 and SEQ ID NO: 24.
  • variable domain of an antibody polypeptide disclosed herein can comprise (a) a CDRl region that consists of the amino acid sequence of SEQ ID NO: 1 ; (b) the CDR2 region consists of the amino acid sequence of SEQ ID NO: 2, and (c) the CDR3 region consists of the amino acid sequence of SEQ ID NO: 3.
  • the variable domain of an antibody polypeptide disclosed herein can comprise or consist of the amino acid sequence of SEQ ID NO: 41 (3h-56-269 sequence).
  • variable domain of an antibody polypeptide disclosed herein can comprise a CDRl region, a CDR2 region, and a CDR3 region, wherein the amino acid sequence of the CDRl region, the amino acid sequence of the CDR2 region, and the amino acid sequence of the CDR3 region are selected from the group consisting of:
  • variable domain in the antibody polypeptide may differ from the variable domain of BMS3h-56-269 by up to 10 amino acids or any integral value between, where the variant variable domain specifically binds CD40.
  • the variant variable domain may have at least 90% sequence identity (e.g., at least 92%, 95%, or 98% sequence identity) relative to the sequence of BMS3h-56-269.
  • Non-identical amino acid residues or amino acids that differ between two sequences may represent amino acid substitutions, additions, or deletions. Residues that differ between two sequences appear as non-identical positions, when the two sequences are aligned by any appropriate amino acid sequence alignment algorithm, such as BLAST.
  • Variable domains may comprise one or more framework regions (FR) with the same amino acid sequence as a corresponding framework region encoded by a human germiine antibody gene segment.
  • a domain antibody may comprise the VH germiine gene segments DP47, DP45, or DP38, the V K germiine gene segment DPK9, the JH segment JH4b, or the J K segment J K 1.
  • RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK amino acids 67-98 of 3h-56-269
  • exemplary framework regions are those of the 3h-56-269 lineage clones disclosed in U.S. Publication No. 2014-0099317.
  • Anti-CD40 antibody polypeptides comprising the mutated IgGl Fc domain have therapeutic value in the treatment or prevention of an immune disease. Bringing a protein therapeutic to market requires the molecule to have suitable physical and chemical properties for development, commonly referred to as Chemistry Manufacturing and Control (CMC).
  • CMC Chemistry Manufacturing and Control
  • the physical and chemical properties of the molecule including stability, solubility, and homogeneity, are also collectively referred to as "developability".
  • anti-CD40 antibody polypeptides comprising the mutated IgGl Fc domain exhibit improved developability, compared to the same anti-CD40 variable domain linked to other IgF l and IgF4 Fc domains.
  • Anti-CD40 antibody polypeptides comprising the mutated IgGl Fc domain exhibit reduced binding to Fc gamma receptors, as measured by SPR, and exhibit reduced or undetectable iDC activation as measured by at least one of: 1) release of cytokine IL-6 and/or TNF-alpha; and 2) upregulation of cell surface expression of CD86 and/or CD54.
  • anti-CD40 antibody polypeptides comprising the mutated IgGl Fc domain have improved thermal stability, as measured by DSC, as well as improved physical stability, as measured under accelerated stress conditions.
  • Anti-CD40 antibody polypeptides comprising the mutated IgGl Fc domain have improved thermal stability, as measured by DSC, as well as improved physical stability, as measured under accelerated stress conditions.
  • Anti-CD40 antibody polypeptides comprising the mutated IgGl Fc domain have improved
  • antibody polypeptides of a fusion antibody polypeptide may be linked by an "amino acid linker" or "linker.”
  • a dAb may be fused to the N- terminus of an amino acid linker, and an Fc domain may be fused to the C-terminus of the linker.
  • amino acid linkers can be any length and consist of any combination of amino acids, the linker length may be relatively short (e.g., five or fewer amino acids) to reduce interactions between the linked domains.
  • the amino acid composition of the linker also may be adjusted to reduce the number of amino acids with bulky side chains or amino acids likely to introduce secondary structure.
  • Suitable amino acid linkers include, but are not limited to, those up to 3, 4, 5, 6, 7, 10, 15, 20, or 25 amino acids in length.
  • the linker AST (SEQ ID NO: 57) can be used in the fusion polypeptides.
  • Other representative amino acid linker sequences include GGGGS (SEQ ID NO: 58), and linker comprising 2, 3, 4, or 5 copies of GGGGS (SEQ ID NOs: 59-62, respectively).
  • Table 4 lists exemplary linker sequences for use in the present disclosure. TABLE 4
  • An exemplary antibody polypeptide comprises: (1) a single variable domain, said single variable domain comprising: (a) a CDR1 region comprising the amino acid sequence of SEQ ID NO: 1 or differing from the CDR1 region of SEQ ID NO: 1 by up to two amino acids, (b) a CDR2 region comprising the amino acid sequence of SEQ ID NO: 2 or differing from the CDR2 region of SEQ ID NO: 2 by up to three amino acids, and (c) a CDR3 region comprising the amino acid sequence of SEQ ID NO: 3 or differing from the CDR3 region of SEQ ID NO: 3 by up to six amino acids, and wherein said single variable domain binds CD40; and (2) an Fc domain that is a human IgGl Fc domain polypeptide comprising a mutation at Kabat position 238 that reduces binding to FC -gamma-receptors, wherein proline 238 (P238) is mutated to one of the residues selected from lysine, serine, alan
  • the single variable domain of the antibody polypeptide described herein antagonizes at least one activity of CD40.
  • the antibody polypeptide as described herein has increased stability, relative to a reference polypeptide that has the same single variable domain sequence that is fused to a wild-type IgGl Fc domain.
  • an antibody polypeptide comprising: (1) a single variable domain as described above, wherein the human IgGl Fc domain has a lysine substituted at Kabat position 238.
  • amino acids sequences for the human IgGl Fc domain polypeptide are:
  • an exemplary antibody polypeptide is as described above, wherein (a) the CDR1 region consists of a sequence X 1 -Tyr-Glu-Y 1 -Trp (SEQ ID NO: 4), wherein X 1 is Asp or Gly, and Y 1 is Met or Leu; (b) the CDR2 region consists of a sequence Ala-Ile-Asn-Pro- X 2 -Gly-Y 2 -Z 2 -Thr-Tyr-Tyr-Ala-Asp-Ser-Val-A 2 -Gly (SEQ ID NO: 5), wherein X 2 is Gin, Tyr, His, Trp, or Ala, Y 2 is Thr, Asn, Gly, Ser, or Gin, Z 2 is Arg, Leu, Tyr, His, or Phe, and A2 is Lys or Met; and (c) the CDR3 region consists of a sequence X3-Pro-Y3-Z 3 -A3-B3-C3 (
  • An exemplary antibody polypeptide comprises or consists of the amino acid sequence:
  • An exemplary antibody polypeptide comprises or consists of the amino acid sequence:
  • An exemplary antibody polypeptide comprises or consists of the amino acid sequence:
  • An exemplary antibody polypeptide comprises or consists of the amino acid sequence:
  • the antibody polypeptides of the disclosure can be produced and purified using only ordinary skill in any suitable mammalian host cell line, such as CHO, HEK293, COS, NSO, and the like, followed by purification using one or a combination of methods, including protein A affinity chromatography, ion exchange, reverse phase techniques, or the like.
  • the disclosure further provides a nucleic acid encoding the antibody polypeptide of disclosure.
  • the nucleic acid may be inserted into a vector, such as a suitable expression vector, e.g., pHEN-1 (Hoogenboom et al. (1991) Nucleic Acids Res. 19:4133-4137).
  • an isolated host cell comprising the vector and/or the nucleic acid encoding the disclosed antibody polypeptides.
  • a pharmaceutical composition comprises a therapeutically-effective amount of one or more antibody polypeptides and optionally a pharmaceutically acceptable carrier.
  • Pharmaceutically acceptable carriers include, for example, water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof.
  • compositions can further comprise minor amounts of auxiliary substances, such as wetting or emulsifying agents, preservatives, or buffers that enhance the shelf-life or effectiveness of the fusion protein.
  • auxiliary substances such as wetting or emulsifying agents, preservatives, or buffers that enhance the shelf-life or effectiveness of the fusion protein.
  • the compositions can be formulated to provide quick, sustained, or delayed release of the active ingredient(s) after administration. Suitable pharmaceutical compositions and processes for preparing them are well known in the art. See, e.g., Remington, THE SCIENCE AND PRACTICE OF PHARMACY, A. Gennaro, et al., eds., 21 st ed., Mack Publishing Co. (2005).
  • the pharmaceutical composition further may comprise an immunosuppressive/immunomodulatory and/or anti-inflammatory agent.
  • Antagonizing CD40-mediated T cell activation could inhibit undesired T cell responses occurring during autoimmunity, transplant rejection, or allergic responses, for example. Inhibiting CD40-mediated T cell activation could moderate the progression and/or severity of these diseases.
  • an antibody polypeptide of the disclosure or a pharmaceutically acceptable salt thereof, in the preparation of a medicament for treatment of an immune disease in a patient in need of such treatment.
  • the medicament can, for example, be administered in combination with an immunosuppressive/immunomodulatory and/or anti-inflammatory agent.
  • a "patient” means an animal, e.g. mammal, including humans.
  • the patient may be diagnosed with an immune disease.
  • “Treatment” or “treat” or “treating” refers to the process involving alleviating the progression or severity of a symptom, disorder, condition, or disease.
  • An “immune disease” refers to any disease associated with the development of an immune reaction in an individual, including a cellular and/or a humoral immune reaction. Examples of immune diseases include, but are not limited to, inflammation, allergy, autoimmune disease, or graft-related disease.
  • An "autoimmune disease” refers to any disease associated with the development of an autoimmune reaction in an individual, including a cellular and/or a humoral immune reaction.
  • An example of an autoimmune disease is inflammatory bowel disease (IBD), including, but not limited to ulcerative colitis and Crohn's disease.
  • IBD inflammatory bowel disease
  • Other autoimmune diseases include systemic lupus erythematosus, multiple sclerosis, rheumatoid arthritis, diabetes, psoriasis, scleroderma, and atherosclerosis.
  • Graft-related diseases include graft versus host disease (GVHD), acute transplantation rejection, and chronic transplantation rejection.
  • Diseases that can be treated by administering the pharmaceutical composition of the disclosure may be selected from the group consisting of Addison's disease, allergies, anaphylaxis, ankylosing spondylitis, asthma, atherosclerosis, atopic allergy, autoimmune diseases of the ear, autoimmune diseases of the eye, autoimmune hepatitis, autoimmune parotitis, bronchial asthma, coronary heart disease, Crohn's disease, diabetes, epididymitis, glomerulonephritis, Graves' disease, Guillain-Barre syndrome, Hashimoto's disease, hemolytic anemia, idiopathic thrombocytopenic purpura, inflammatory bowel disease, immune response to recombinant drug products (e.g., Factor VII in hemophiliacs), systemic lupus erythematosus, multiple sclerosis, myasthenia gravis, pemphigus, psoriasis, rheumatic fever, rheuma
  • the pharmaceutical composition may be administered alone or in combination therapy, (i.e., simultaneously or sequentially) with an immunosuppressive/immunomodulatory and/or anti-inflammatory agent.
  • an immunosuppressive/immunomodulatory and/or anti-inflammatory agent can require use of specific auxiliary compounds useful for treating immune diseases, which can be determined on a patient-to-patient basis.
  • the pharmaceutical composition may be administered in combination with one or more suitable adjuvants, e.g., cytokines (IL-10 and IL-13, for example) or other immune stimulators, e.g., chemokines, tumor-associated antigens, and peptides.
  • suitable adjuvants are known in the art.
  • Any suitable method or route can be used to administer the antibody polypeptide or the pharmaceutical composition.
  • Routes of administration include, for example, oral, intravenous, intraperitoneal, subcutaneous, or intramuscular administration.
  • therapeutically effective dose of administered antibody polypeptide(s) depends on numerous factors, including, for example, the type and severity of the immune disease being treated, the use of combination therapy, the route of administration of the antibody polypeptide(s) or pharmaceutical composition, and the weight of the patient.
  • a non- limiting range for a therapeutically effective amount of a domain antibody is 0.1-20 mg/kg, and in an aspect, 1 - 10 mg/kg, relative to the body weight of the patient.
  • kits useful for treating an immune disease in a human patient comprises (a) a dose of an antibody polypeptide of the present disclosure and (b) instructional material for using the antibody polypeptide in the method of treating an immune disease in a human patient as disclosed herein.
  • the instructional material of the kit may, for example, be affixed to a container that contains the compound and/or composition of the invention or be shipped together with a container which contains the compound and/or composition.
  • the instructional material may be shipped separately from the container with the intention that the recipient uses the instructional material and the compound cooperatively. Delivery of the
  • instructional material may be, for example, by physical delivery of the publication or other medium of expression communicating the usefulness of the kit, or may alternatively be achieved by electronic transmission, for example by means of a computer, such as by electronic mail, or download from a website.
  • Antibodies and dAb-Fc proteins were expressed in either HEK293 (cell line derived from human embryonic kidney cells) or Expi293 cells, and purified by standard protein A affinity chromatography, followed by preparative size exclusion chromatography. A few select samples were also expressed and purified from UCOE-CHO cells (samples indicated with "UCOE-CHO").
  • CD40 Binding Kinetics and Affinity The CD40 binding affinity of dAb-Fc and antibody molecules was measured by SPR on a BiacoreTM T 100 or T200 instrument (GE Healthcare Life Sciences, Marlborough, MA) by capturing a dAb-Fc or an antibody on an immobilized protein A sensor chip surface, and then binding human-CD40-monomer protein (generated in house) using an association time of 180 seconds, dissociation time of 360 seconds at 30 microliter per minute ( ⁇ /min) in PBS-T pH 7.1.
  • human-CD40-Fc (generated in house) was immobilized on a CM5 sensor chip, and dAb-Fc or antibody analytes were tested for binding using 180 second association time and 240 second dissociation time at 30 ⁇ /min.
  • Example 1 Treatment of iDCs with dAb-Fc molecules in the presence or absence of
  • 3h56-269-IgG4.1 is an anti-CD40 dAb-FC (IgG4) fusion protein (SEQ ID NO: 75). No direct agonist activities have been observed for 3h56-269-IgG4.1 in B cells or T-cell- depleted peripheral blood mononuclear cells (PBMCs), as described for instance in WO 2012/145673. To further characterize the biological activity and safety profile of 3h56-269- IgG4.1, the effect of 3h56-269-IgG4. l on immature dendritic cells (iDC) was assayed.
  • IDC immature dendritic cells
  • Peripheral blood was collected from normal, healthy human donors.
  • Peripheral blood mononuclear cells PBMC
  • Monocytes were isolated from PBMC following the Manual EasySep protocol (STEMCELLTM Technologies, Vancouver, Canada).
  • iDCs Immature dendritic cells
  • Immature Dendritic Cell Activation Assay Immature Dendritic Cells (iDCs) were assayed for activation by assessing release of specific cytokines and expression of specific cell surface molecules. Titrations of the various biological agents were made in complete media, and added to duplicate 96-well plates. In the case of cross-linking (via addition of CD32a-expressing CHO cells), antibodies being assayed were added to the iDCs for 30 minutes prior to the addition of CD32a-expressing CHO cells. The ratio of CD32a- expressing CHO cells to iDCs was 1 :6.
  • cytokines To assess cytokines, cells were incubated at 37°C and 5% C0 2 for approximately 18-20 hours; 150 microliter ( ⁇ L) of supernatant was removed from each well, diluted 1 :5 and evaluated for protein concentrations of IL-6, TNF ⁇ and IL-12 using a commercially available ELISA kits (R&D Systems, Minneapolis, MN), according to manufacturer's instructions.
  • ICAM-1 also called CD54
  • CD83 the cells remaining in the plates from the harvested supernatants were combined into 1 sample per duplicate treatment, and transferred to a new 96-well round bottom (RB) plate, and placed at 4° C. Cells were washed with D-PBS, Ca ++ and Mg ++ free, and stained for 30 min on ice for cell viability using the LIVE/DEAD® Fixable Near-IR Dead Cell Stain Kit (Invitrogen, Carlsbad, CA).
  • the iDCs were immuno-stained with: PerCpCy5.5-conjugated ⁇ CD3, ⁇ CD19, ⁇ CD14 (Lin " ), BUV395-conjugated ⁇ CD11c (BD Biosciences, San Diego, CA), APC-conjugated ⁇ CD86 (Biolegend, San Diego, CA), PE-conjugated ⁇ CD83 (eBioscience, San Diego, CA), FITC- conjugated ⁇ CD54 (Biolegend, San Diego, CA), and incubated at 4° C for 45 minutes. Cells were then washed twice in staining buffer and fixed (15 minutes at room temperature (RT), protected from light), by adding 100 ⁇ l of BD Cytofix Fixation Buffer (BD
  • the iDCs were evaluated for CD86, ICAM-1 and CD83 expression using a LSRII-FortessaTM Flow Cytometer (BD Biosciences, San Diego, CA), and FlowJo® analysis software (Tree Star Inc., Ashland, OR).
  • CP-870,893 mAb is a well-known agonistic CD mAb ⁇ see, e.g., Vonderheide et al., 2007, J. Clin. Oncol. 25(7): 876-883).
  • CP-870,893 mAb (referred to herein as mAb 134-2141 ; generated in house), served as a positive control.
  • a second positive control was a soluble CD40L trimer molecule (generated in house) that is trimerized by an isoleucine zipper trimerization motif.
  • CHI-L6 IgG4 (generated in house), a fusion protein between a non-CD40 binding protein and an IgG4.1 Fc tail, served as a negative control.
  • dAb-Fcs The amino acid sequences of the dAb-Fcs studied in this experiment are shown in Table 5. In these sequences, the single variable domain 3h56-269 residues are amino acids 1-118 (underlined). The linker, AST (SEQ ID NO: 57), is double-underlined. The unformatted C-terminal residues are the Fc domain.
  • Immature DC express both FcgR and CD40 and are sensitive to CD40 activation.
  • 3h-56-269-CT (SEQ ID NO: 76) is a fusion of the same anti-CD40 dAb (3h-56-269) to an IgGl Fc tail with reduced FcgR binding referred to herein as "CT” or "aba".
  • CT Fc domain is the Fc domain present in Orencia® (abatacept, Bristol-Myers Squibb Company, New York, NY).
  • Abatacept is a fusion of the extracellular domain of CTLA-4 to an IgGl Fc domain that is modified to reduce Fc domain effector function and eliminate interchain disulfide bonds in the IgGl hinge region. 3h-56-269-CT has reduced FcgR binding.
  • 3h-59-269-CT was tested at 100 ug/ml with iDC from 9 donors.
  • the 9 donor iDCs showed neither cytokine release nor upregulation of CD86 or CD54 when compared to the negative control consisting of CHI-L6 IgG4, a fusion protein between a non-CD40 protein and an IgG4 Fc tail.
  • 3h56-269-IgG4.1 exhibited iDC activation in a subset of 3 of the 9 donors in which at least one measure of iDC activation was observed to be greater than control.
  • the CD40 agonist mAb 134-214 stimulated CD86 and ICAM expression and cytokine release in all donors tested. See Figure FIG. 2E.
  • 3h56-269-IgG4.1 in the absence of cross-linking, caused a modest amount of iDC activation as measured by CD86 and IL-6 production in a few donors when compared to the CHI-L6 IgG4 control.
  • 3h56-269-IgG4.1 at concentrations > 10 ⁇ g/ml resulted in iDC activation similar to that of cross-linking the agonist CD40 antibody, as measured by both cell surface markers and cytokine release ( Figure FIG. 3).
  • FcgR binding affinities were characterized by SPR. Materials and Methods used in this example include the following.
  • FcgR binding can be measured in vitro using purified FcgRs using BiacoreTM surface plasmon resonance (SPR). Two methods were used herein.
  • the Fab fragment from a murine anti-6xHis antibody (generated in house) is immobilized on a CM5 sensor chip using standard ethyl(dimethylaminopropyl) carbodiimide (EDC)/N-hydroxysuccinimide (NHS) chemistry with ethanolamine blocking, to a density of -3000 Resonance Units RU in a running buffer of 10 millimolar (mM) HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.05% surfactant p20 (HBS-EP+).
  • EDC ethyl(dimethylaminopropyl) carbodiimide
  • NHS N-hydroxysuccinimide
  • FcgR proteins tested in these studies include the "high affinity" FcgR hCD64 (hFcgRI), as well as the "low affinity” FcgRs hCD32a-H131 (FcgRIla-H131), hCD32a-R131 (FcgRIIa-R131), hCD32b (FcgRIIb), hCD16a-V158 (FcgRIIIa-V158), hCD16a-F158 (FcgRIIIa-F158), hCD 16b-NAl (FcgRIIIb- NA1), and hCD16b-NA2 (FcgRIIIb-NA2).
  • hCD32a-H131 FcgRIla-H131
  • hCD32a-R131 FcgRIIa-R131
  • hCD32b FcgRIIb
  • hCD16a-V158 FcgRIIIa-V158
  • hCD16a-F158 FcgRIIIa
  • the SPR binding data can be analyzed by calculating the maximum binding response as a percentage of the theoretical maximum binding response (%Rmax) as generally shown in Eq. 1 :
  • the “%Rmax analysis” is particularly useful for evaluating the binding of the "low affinity" FcgRs, e.g., hCD32a-H 131, hCD32a-R 131 , hCD32b, hCD16a-V158, hCD 16a- F 158, hCD16b-NAl, and hCD16b-NA2, which have relatively fast association and dissociation rates and affinities near or below the analyte concentration tested (1 micromolar ( ⁇ )), so saturation of the surface is generally not achieved under these conditions.
  • FcgRs e.g., hCD32a-H 131, hCD32a-R 131 , hCD32b, hCD16a-V158, hCD 16a- F 158, hCD16b-NAl, and hCD16b-NA2
  • the "high affinity" FcgR hCD64 binds with higher affinity and slower dissociation kinetics than the other FcgRs, particularly to IgGl and IgG4, and thus these isotypes do typically saturate the hCD64 surface under micromolar analyte concentrations, and are more difficult to differentiate affinities using %Rmax. For these interactions, differences between antibodies can be easily observed by comparison of the dissociation rates in the sensorgram data.
  • a second SPR assay for testing the interaction between antibodies or dAb-Fc proteins with FcgR proteins is a protein A capture method. These experiments are also performed on either a BiacoreTM T 100 or BiacoreTM T200 instrument (GE Healthcare) at 25° C.
  • protein A is immobilized on flow cells 1-4 of a CM5 sensor chip using standard ethyl (dimethylaminopropyl) carbodiimide (EDC)/N-hydroxysuccinimide (NHS) chemistry, with ethanolamine blocking, in a running buffer of 10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.05% surfactant p20, to a density of -3000 RU.
  • EDC dimethylaminopropyl carbodiimide
  • NHS N-hydroxysuccinimide
  • Antibody or dAb-Fc proteins are captured on the protein A surface, and the binding of FcgR analytes are tested in running buffer consisting of 10 mM NaP04, 130 mM NaCl, 0.05% p20, buffer (PBS-T) at pH 7.1 and at 25° C, using for example, 120 sec association time and 180 sec dissociation time at a flow rate of 30 ⁇ L/min .
  • the protein A capture assay can also be used to analyze unpurified supernatants containing antibody or dAb-Fc molecules.
  • the antibody or dAb-Fc proteins can be captured from either undiluted supernatants or supernatants diluted with running buffer.
  • the SPR binding data can be analyzed by calculating the %Rmax using Eq. 1 above, wherein Analyte is the purified FcgR protein, and Ligand is the captured antibody or dAb-Fc protein.
  • FcgR in a 3: 1 serial dilution can be titrated from 10 ⁇ down to either 0.15 nM (hCD64) or 1.5 nM (all other FcgRs).
  • the dAb-Fcs studied in this example include those shown in Table 5.
  • the amino acid sequences of the additional dAb-Fcs studied in this experiment are shown in Table 6.
  • the single variable domain 3h56-269 residues are amino acids 1-118 (underlined).
  • the linker AST (SEQ ID NO: 57) is double-underlined.
  • the C- terminal residues are the Fc domain. Table 6
  • Control mAb A control monoclonal antibody (1 F4) was also formatted with similar Fc domain mutations. The antibody does not bind to CD40.
  • SEQ ID NO: 80 in Table 7 is the sequence of the control antibody heavy chain variable region (underlined) and CHI, and SEQ ID NO: 81 is the sequence of light chain variable region (underlined) and CL.
  • the varous formatted heavy chains are shown in Table 7 as SEQ ID NOS; 82-87.
  • the IF4 heavy chain variable region and CHI region sequence is underlined in SEQ ID NOS: 82-87.
  • the pair of heavy chain and light chain sequences for each 1F4 mAb variant is shown in Table 8.
  • dAb-Fc molecules were produced with mutations in the Fc domain to reduce FcgR binding.
  • the anti-CD40 domain antibody 3h56-269 was formatted with the following Fc domain variants: IgGl . l f, IgG1.3f, and IgGl-D265A. In each of 3h-56-269-IgGl .
  • amino acids 1-116 are 3h-56-269 dAb
  • amino acids 117-119 are a linker
  • amino acids 120-351 are the Fc domain.
  • the KD values range between 7.3 nM and 11.5 nM for the different Fc variants.
  • Each of the dAb-Fc molecules also bound human CD40 with high avidity, as measured by SPR using hCD40-Fc on the surface of a sensor chip and the dAb-Fc molecules as soluble analytes in solution, where data for 250 nM and 25 nM dAb-Fc analyte injections were fit to a 1 : 1 Langmuir model to estimate avidity-influenced apparent KD values (KD apP arent) for all dAb-Fcs as ⁇ 1 nM. See Table 9.
  • the FcgR binding properties of the dAb-Fc molecules and the various control monoclonal 1 F4 antibodies were characterized by SPR.
  • the first assay involved binding of 1 ⁇ or 10 ⁇ dAb-Fcs or a human-IgG I f antibody control (l F4-IgGl f) to anti-His Fab captured FcgR-His surfaces. These data are shown in Table 10.
  • Table 10 %Rmax data for ⁇ ⁇ or 10 ⁇ dAb-Fcs or l F4-lgG I f antibody control binding to anti-His Fab captured hFcgR-His proteins.
  • FcgR analytes (at 1 ⁇ or 10 ⁇ ) were tested for binding to protein A-captured dAb-Fc surfaces (data shown in Table 1 1) and for binding to antibody surfaces (data shown in Table 12).
  • Table 11 %RMax data for 1 ⁇ or 10 ⁇ FcgRs binding to protein A-captured dAb-Fc
  • the IgG l -D265A variant has stronger binding response for hCD32a-H131 as compared to the IgGl . lf, IgG1.3f or CT variants (Table 11).
  • the IgGl . l f and IgG 1.3f variants have stronger binding responses for hCD32a-R131 as compared to the IgGl-D265A and CT variants (Table 11).
  • the dAb-Fc molecules were tested in the iDC assay (described in Example 1) with and without CD32-over-expressing CHO cell cross-linking. These data are shown in
  • CMC Chemistry Manufacturing and Control
  • DSC differential scanning calorimetry
  • icIEF imaged capillary isoelectric focusing
  • MS mass spectrometry
  • accelerated stability studies include differential scanning calorimetry (DSC), imaged capillary isoelectric focusing (icIEF), mass spectrometry (MS or mass spec), and accelerated stability studies.
  • DSC experiments were performed on a MicroCal VP-Capillary DSC instrument (Malvern Instruments, Malvern, UK) in 10 raM NaP0 4 , 130 mM NaCl pH 7.1. Samples of 1 mg/ml dAb-Fc or antibody were tested using a scan range of 10-110° C and a scan rate of 90° C/hr. Data were analyzed using MicroCal- Origin 7.0 software.
  • Imaged Capillary Isoelectric Focusing icIEF experiments were performed on a ProteinSimple iCE3TM System (ProteinSimple, San Jose, CA). For these studies the dAb-Fc or antibody samples, typically at 2 mg/ml concentration, were mixed with a carrier ampholyte mixture consisting of 2 M urea, 0.35% methylcellulose, 1% Pharmalyte 5-8, 3% Pharmalyte 8-10.5, and pi markers 5.85 and 10.10, to a final protein concentration of 0.20 mg/mL, and analyzed using a pre-focusing time of 1 min at 1.5 kV and a focusing time of 10 min at 3 kV.
  • a carrier ampholyte mixture consisting of 2 M urea, 0.35% methylcellulose, 1% Pharmalyte 5-8, 3% Pharmalyte 8-10.5, and pi markers 5.85 and 10.10
  • Mass Spectrometry For mass spectrometry (mass spec) analysis, samples were reduced using 100 mM DTT, and N-deglycosylation was performed with peptide:N- Glycosidase (FPNGaseF).
  • Liquid chromatography-mass spectrometry (LC/MS) instrumentation used was a Waters Synapt® G2 (Waters Corporation, Milford, MA) with a Waters Acquity® UPLC (ultra-performance liquid chromatography).
  • the UPLC column was a Waters Acquity® BEH (ethylene bridged hybrid particle) C4 (2.1 x 150 mm, 300 A, 1.7 urn particle).
  • the gradient was 10% to 38% (Mobile phase B) in 10 min at 200 ⁇ !7 ⁇ flow rate.
  • Mobile phase A was 0.1% formic acid in water.
  • Mobile phase B was 0.1% formic acid in acetonitrile.
  • Column temperature was 60° C.
  • Data analysis was performed manually with the aid of Waters MassLynxTM software; spectral deconvolution was performed with the MaxEntl algorithm.
  • Accelerated Stability Studies were conducted by first extensively dialyzing dAb-Fc molecules in target formulation buffers at 4° C. Samples were recovered and concentrated using Amicon® Ultra Centrifugal Filter Units (Merck KgaA, Germany) and prepared at different target concentrations in dialysis buffer. These samples were incubated at various temperatures, typically 4° C, 25° C, 32° C, and/or 40° C for several weeks, with aliquots removed and analyzed by analytical size exclusion chromatography.
  • Analytical size exclusion chromatography was conducted on an Agilent 1260 HPLC, using a ShodexTM K403-4F column (Showa Denko America, Inc., New York, NY) in a mobile phase of 100 mM Sodium Phosphate, 150 mM Sodium Chloride, pH 7.3, flow rate of 0.3 ml/min.
  • DSC can be used to measure the thermal stability of a protein.
  • the DSC data for 3h56-269 dAb formatted with different Fc domains is shown in Figure 5.
  • the best fit Tm values are summarized in Table 14.
  • Tm Thermal melting temperature
  • the Fc CH3 domain transition for 3h56-269-IgG4.1 was assigned as the transition with midpoint (Tm) value of 69.6°C; and the Fc CH3 domain of the various IgGl molecules was assigned as the transition with Tm near -82 - 83°C.
  • the denaturation of the dAb domain and CH2 domain for the dAb-Fcs were assigned to the transition(s) below 65°C, which differ between the different constructs, both in the onset of thermal denaturation (T onS et), the shape of the unfolding transition, and the best fit Tm values.
  • the thermal transition for the dAb and CH2 domains of 3h56-269-IgG4.1 appears as a single overlapping or cooperative transition, with Tm value of 62.8° C.
  • the denaturation profile for the dAb and CH2 domains of 3h56-269-IgGl -D265A, 3h56-269-IgGl . l f and 3h56-269-IgG 1.3f are all consistent with a more asymmetrical transition, which was best described by two transitions having Tm values between -56 - 63° C.
  • Imaged capillary isoelectric focusing (iclEF) can be used to characterize sample homogeneity or
  • heterogeneity The ability to generate a homogeneous product is another important developability criterion. Consequently, during the discovery and optimization of a novel protein therapeutic, various analytical methods are utilized to characterize and quantitate sample heterogeneities, and to select for the most homogeneous molecules.
  • the charge profiles for dAb-Fc molecules were characterized by iclEF.
  • the data are shown in Figure 6.
  • the iclEF profiles for 3h56-269-IgG4.1 (Fig. 6A), 3h56-269-lgG 1.1 f (Fig. 6E) and 3h56-269-IgG1.3f (Fig. 6F) are all relatively simple, each consisting of a distinct main peak with area of 69-86%, and between two and four charge variants in lower abundance.
  • This iclEF profile is similar to the typical profile obtained for an antibody.
  • the main peak for 3h56-269-IgG l-D265A (Fig. 6D) is somewhat lower abundance (49%) with a corresponding higher level of acidic variants with at least six detectable species.
  • the profile for 3h56-269-CT (Fig. 6B) is highly heterogeneous, consisting of at least 16 different species and no clear main peak.
  • the iclEF profile for 3h56-269-CT expressed in a different cell line (UCOE-CHO) was equally heterogeneous (Fig. 6C), although the distribution of the charge variants was considerably different from the HEK293-expressed material.
  • Typical glycosylation on the Fc domain of IgG or Fc- containing proteins is a mixture of G0F, GI F and some G2F species.
  • Other glycoforms, such as sialylated or non-fucosylated forms, are generally found in much lower abundance or at undetectable levels.
  • Table 15 Detectable glycoforms in dAb-Fc and antibody molecules as determined by mass spectrometry.
  • Both the dAb-Fc and antibody molecules containing the D265A mutation in the Fc domain also contained a mixture of GOF, GI F, and G2F species, but in addition they had higher levels of sialylated glycoforms. All of these D265A molecules could be
  • Table 16 Detectable glycoforms in 3h56-269-CT molecules as determined by mass spectrometry.
  • 3h56-269-CT was selected for additional studies including additional developability assessment, because 3h56-269-CT was the only dAb-Fc molecule that demonstrated no response in the iDC assay in either the absence or presence of CD32 over-expressing CHO cell cross-linking.
  • stability studies were conducted under accelerated stress conditions of 32°C and 40°C, as well as lower temperatures of 4°C and 25°C.
  • the formulation buffer for these studies (20 mM potassium phosphate, 250 mM sucrose, 50 ⁇ DTPA and 0.05% PS80, pH7.0) was selected based on screening the thermal stability of the molecule using the UNit platform (Unchained Labs, Woburn, MA), to identify conditions which gave favorable thermal stability (Tm) and onset of aggregation (Tagg).
  • the purified 3h56-269-CT protein was exchanged into this formulation buffer by dialysis, then concentrated and prepared at final concentration of either 50 mg/ml or 150 mg/ml, and incubated at various temperatures for 4 weeks.
  • HMW high molecular weight aggregate
  • LMW low molecular weight species
  • Table 18 Percentage of high molecular weight (HMW) species as determined by analytical size exclusion chromatography in samples of 3h56-269-CT incubated at different temperatures for 4 weeks.
  • the aSEC data showed high levels of HMW formation for 3h56-269-CT, particularly at higher protein concentration and higher temperatures.
  • the 3h56-269-CT molecule advantageously was found to have favorably weak FcgR binding, particularly towards the low affinity FcgRs (hCD32a, hCD32b, hCD16a, hCD16b), and also demonstrated a lack of response in the iDC assay including with CD32 over-expressing CHO cell cross-linking.
  • biophysical characterization of 3h56-269-CT showed that the molecule has low thermal stability, high heterogeneity, and poor physical stability.
  • a series of mutant dAb-Fc molecules was designed to attempt to understand the contribution of the individual C220S, C226S, C229S and P238S mutations to the properties of 3h56-269-CT, and to try to decouple the undesirable developability challenges from the desired weak FcgR binding and lack of Fc-mediated signaling.
  • the mutation strategy involved design of several variants at positions 220, 226, 229, and 238 (Kabat numbering). The following variants were designed:
  • LALA LALA in the context of both an IgG la and IgG lf allotype. See SEQ ID NOs: 117-118 in Table 22.
  • dAb-Fc molecules were also generated containing a single N297A mutation in the context of both an IgGla and IgGlf allotype. See SEQ ID NOs: 119- 120 in Table 23.
  • dAb-Fc variants In addition to dAb-Fc variants, a smaller set of related Fc mutants were designed to determine if similar mutations in the context of a full IgG would have similar impact on properties as in the a dAb-Fc format. All IgG variants were produced with the variable domains of the control 1 F4 antibody. The sequences of the heavy chains of these variants are shown in Table 24. The sequence (SEQ ID NO: 80) of the portion of the 1F4 heavy chain including the variable region and CHI region is italicized. For each of these variant 1 F4 monoclonal antibodies, the light chain sequence was SEQ ID NO: 81 (see Table 7). The variants included:
  • Table 26 %Rmax data for 1 ⁇ or 10 ⁇ l F4-IgGl f antibodies binding to anti-His Fab captured hFcgR-His proteins.
  • the P238K and N297A variants (1 F4- IgG la-P238K and 1 F4-N297A, respectively) demonstrate the weakest binding responses towards the low affinity FcgRs, demonstrating essentially no detectable binding signal towards hCD32a-H131, hCD32a-R131 , hCD32b, hCD 16a-V158 or hCD16b-NA2.
  • the lF4-IgGla-P238K variant also demonstrated weaker FcgR binding than the l F4-IgGla-P238S variant, suggesting that Lys at position 238 is more effective at disrupting FcgR binding than Ser at that position.
  • Tm Thermal melting temperature
  • the Fab domain of the 1F4 antibodies have a fit Tm between 71.6 °C and 74.7 °C.
  • the CH3 domains of all molecules melted between 82.1 °C and 83.1 °C, which is typical for a wild type (unmodified) IgG I CH3 domain.
  • the CH2 domains were the least stable domains of the antibody, and the melting temperatures were different for different mutants, suggesting that the mutations in the hinge/CH2 region impact the thermal stability of the CH2.
  • the Tm values for the CH2 domain of l F4-CTf (54.3 °C), and 1F4-CT (55.1 °C) were less than 1°C different, suggesting that the IgGl allotype has minimal impact on the thermal stability of the CH2 domain.
  • Fc mutants with single Cys- ⁇ Ser mutations in the hinge region had modestly lower CH2 domain stability compared to wild-type IgGlf, with CH2 domain Tm values for 1 F4- IgG la-C226S of 70.3 °C, and for l F4-IgGla-C229S of 69.9 °C.
  • Mutation of both the hinge Cys residues to Ser further reduced the CH2 domain Tm to 64.8 °C for lF4-IgGla- C226S,C229S.
  • the single P238S mutation also reduced the CH2 domain stability (62.4 °C) compared to wild-type lF4-IgGl f.
  • the single Cys->AIa mutants in the hinge l F4-IgGla-C226A and lF4-IgGla- C229A have nearly identical CH2 domain Tm values as the Cys->Ser mutants at these positions, and the double mutant 1 F4-C226A,C229A has a CH2 domain Tm that is modestly (1.2 °C) more stable than that of the double Cys->Ser mutant 1F4-C226S,C229S.
  • the lF4-IgG molecules were characterized by icIEF, as described in Example 3.
  • the icIEF profile for the lF4-IgGl f protein was typical for a monoclonal IgGl antibody, with a main peak of 79.7% abundance, and -2-4 acidic or basic variants in much lower abundance. See Figure 8.
  • the icIEF profile for the 1F4-CT molecules were heterogeneous, consisting of at least 8 distinct charge variants and no obvious dominant species. This heterogeneity is likely related to the glycan heterogeneity observed by mass spectrometry (Table 17), as discussed above.
  • the icIEF data for the double Cys ⁇ Ser variant lF4-IgGla-C226S,C229S was similar to that of the 1F4-CT molecule, showing the presence of numerous different charge variants with no distinct main peak, whereas the data for the single mutants C226S, C229S and P238S were all of similar complexity to lF4-IgGl f.
  • the SPR, DSC, icIEF, and mass spec data for the l F4-IgG molecules provides insight into the role of the C226, C229 and P238 mutations on the FcgR binding, thermal stability, and heterogeneity of the CT Fc domain.
  • the single hinge C226S and C229S mutants only modestly reduced thermal stability, had similar heterogeneity, and similar FcgR binding as l F4-IgGl f, whereas the double C226S,C229S hinge mutant had significantly lower thermal stability, increased heterogeneity, and reduced FcgR binding compared to l F4-IgGl f.
  • the single P238S mutation had similar impact on reducing thermal stability and FcgR binding as the double C226S,C229S mutant, but did not increase heterogeneity.
  • C226S,C229S hinge mutations together with P238S to yield the full 1 F4-CT molecule had similar heterogeneity as C226S,C229S alone, but further reduced thermal stability and FcgR binding.
  • C226S,C229S mutations plus P238S each contribute to the reduced thermal stability and reduced FcgR binding compared to wild-type Fc, and that the primary sites for O-linked glycosylation are on the mutated hinge S226 and Ser229 residues.
  • the single and double Cys- ⁇ Ala mutations at positions 226 and 229 in the hinge region have similar thermal stability and FcR binding as Cys->Ser mutants at those sites.
  • the C226A,C229A mutant lacks the O-linked glycosylation sites on Ser residues and does not have the high heterogeneity observed with the C226S,C229S mutant. This suggests that the O-linked glycosylation in the hinge region does not have a significant impact on FcgR binding.
  • the l F4-IgGla-P238K mutant demonstrated weaker FcgR binding than lF4-IgGla-
  • the 1F4-N297A molecule demonstrated lower CH2 domain thermal stability and weaker FcgR binding compared to l F4-[gGlf, which are properties consistent with literature reports for other IgGl antibodies containing N297A mutation.
  • the homogeneity for 1 F4-N297A was similar to that of l F4-IgG lf.
  • the l F4-IgG molecules demonstrating the weakest FcgR binding were 1 F4- IgG 1 a-P238K, 1 F4-N297A and the 1 F4-CT molecules.
  • 1 F4-IgG 1 a-P238K and 1 F4-N297A had superior thermal stability and homogeneity compared to 1F4-CT, with l F4-IgGla-P238K having superior thermal stability over 1 F4-N297A. Consequently, the P238K and N297A isotypes were selected as leads for further characterization.
  • the FcgR binding SPR, DSC, icIEF, and MS data for the 1 F4-IgG molecules provided considerable insight into the regions and mutations in the CT isotype which contribute to FcgR binding, stability and heterogeneity, as discussed in Example 5.
  • the P238K and N297A single mutants in the 1F4 antibodies provided favorably weak FcgR binding properties, while maintaining superior thermal stability and homogeneity over the CT isotype molecules. Therefore, 3h56-269-IgGla-C220S,P238K and 3h56-269-IgGl f-C220S,N297A molecules were included in the dAb-Fc analysis.
  • the superior homogeneity but similar thermal stability and FcgR binding properties of the C226A,C229A double mutant compared to the C226S,C229S double mutant raises the possibility that a C226A,C229A double mutant combined with P238S or P238K may possess the desired weak FcgR binding, but without the high heterogeneity and O-linked glycan that is a consequence of mutating C226,C229 each to Ser.
  • variants were selected (i.e., 3h56-269-IgGl a-C220S,C226A,C229A,P238S and 3h56-269- IgG la-C220S,C226A,C229A,P238K variants) to further investigate.
  • the double L234A,L235A (LALA) mutant was generated in the context of both IgG 1 a and IgG 1 f allotypes.
  • methods used in this example include the following.
  • Human tonsillar B cells were obtained from pediatric patients during routine tonsillectomy and isolated by mincing and gently mashing the tissue, passing the cells through a screen and isolating mononuclear cells with density gradient separation using human Lympholyte®-H separation media (Cedarlane Labs, Burlington, ON). Mononuclear cells were collected from the interface, washed, and rosetted with sheep red blood cells (SRBC, Colorado Serum Company;
  • Results- SPR The selected dAb-Fc variants were expressed as small scale supernatants, captured on immobilized protein A BiacoreTM SPR sensor chip surface, and tested for binding to purified FcgR analytes ( ⁇ ), as described in Example 2. The data are shown in Table 28.
  • Table 28 %Rmax data for ⁇ ⁇ FcgRs binding to protein A captured dAb-Fc molecules.
  • the FcgR binding SPR data for the other dAb-Fc molecules agreed well with the data for the 1 F4-IgG variants.
  • all of the variants containing P238K or N297A demonstrated weaker binding to hCD64 as compared to wild type, and essentially undetectable binding to all of the other FcgRs.
  • the P238K and N297A variants also demonstrated weaker hCD64 binding than 3h56-269-CT, similar to what was observed for the analogous l F4-IgG variants.
  • the single P238S mutation or double C226S/C229S mutation reduced FcgR binding, but less so than the combination of these three mutations (3h56-269-CT).
  • the mutant with both hinge Cys mutated to Ala demonstrated similar FcgR binding as the double Cys to Ser hinge variant (3h56-269-IgGla-C220S,C226S,C229S).
  • the LALA variants that were tested had significantly reduced FcgR binding compared to wild type, in particular, and demonstrated the weakest hCD64 binding of any of the variants tested. However, they demonstrated stronger hCD16a-V158 binding than 3h56-269-CT, or any of the P238K or N297A molecules.
  • the dAb-Fc variants with the weakest binding to the low affinity FcgRs were selected for purification and further characterization. These variants include: 3h56-269-IgGla-C220S,C226A,C229A,P238S, 3h56-269-IgGla-C220S,C226A,C229A,P238K, 3h56-269-IgGla-C220S,P238K, 3h56-269- IgG 1 f-C220S,N297A. All four molecules were shown to bind with high affinity to the CD40 target using SPR. The data are shown in Table 29.
  • Table 29 SPR data for binding of dAb-Fc molecules to human CD40.
  • Table 30 %Rmax data for ⁇ ⁇ or 10 ⁇ dAb-Fc molecules or lF4-IgG l f antibodies binding to anti-His Fab captured hFcgR-His proteins.
  • 3h56-269-IgGla-C220S,P238K, 3h56-269-IgGla- C220S,C226A,C229A,P238K, and 3h56-269-IgGlf-C220S,N297A all demonstrated even weaker FcgR binding responses than the 3h56-269-CT.
  • Results- iDC Activation The 3h56-269-IgGla-C220S,P238K and 3h56-269- IgGl f-N297A molecules were tested for the ability to activate iDC alone or with CD32- mediated clustering/cross-linking, as described in Example 1. The data shows that these mutations in the IgGl Fc tail could eliminate any iDC activation, rendering the anti-CD40 dAb-Fc molecules inert in these assays of iDC activation. See Figure 9.
  • results- Inhibition of CD40L induced human B cell proliferation Despite the differential activity of the fusion proteins with different Fc tails, these changes do not influence the ability to inhibit CD40L mediated activation of immune cells, such as B cells. This is exemplified by the activity of 3h-59-269-IgGla-P238K and 3h-59-269-IgGl f- N297A fusions. B cell proliferation stimulated by both soluble CD40L trimer and by CD40L expressing CHO cells is potently and similarly inhibited by 3h-59-269-IgGl- P238K, or 3h-59-269-IgGl-N297A (Table 31).
  • ResuIts-DSC The thermal stability of four purified dAb-Fcs which demonstrated low FcgR binding were characterized by DSC, as described in Example 3. Like the previously characterized IgGl -type dAb-Fc molecules, all four new molecules demonstrate a transition near 83°C, which is characteristic of the CH3 domain of a human IgGl Fc domain, with a lower temperature transitions assigned to the dAb and CH2 domains. These data are in Table 32. See also Figure 11.
  • Tm Thermal melting temperature
  • C220S,C226A,C229A,P238S and 3h56-269-IgGl a-C220S,C226A,C229A,P238K variants had a low T onS et near ⁇ 40°C, and broad unfolding transition with Tml value of 55.7-55.8°C, similar to the previous data observed for 3h56-269-CT.
  • HMW high molecular weight
  • HMW high molecular weight
  • Additional control dAb-Fc molecules were generated with altered and enhanced FcgR binding properties, including those with a wild type IgG lf Fc domain (3h56-269- IgGlf), or with additional point mutations to enhance binding to hCD32a-R13 1 and hCD32b (3h56-269-IgG l -S267E) or enhance specificity for hCD32b (3h56-269-IgGlf- G237D,P238D,H268D,P271G,A330R, also called 3h56-269-IgGl-Vl 1). See Sequences 13 1- 133 in Table 35.
  • Table 36 %Rmax data for 1 ⁇ dAb-Fcs binding to anti-His Fab captured hFcgR-His proteins.
  • the iDC activation data for 3h-59-269-IgGl-Vl 1, 3h-59-269-S267E show robust iDC activation at all concentrations tested in both the absence and presence of CD32- expressing CHO cells. See Figure 10.
  • the ability to tune immune cell activation is demonstrated by the activity of the 3h56-269-IgG I f fusion, which shows only modest activation in the absence of CD32 mediated cross-linking, which is then increased with CD32-overexpressing CHO cells. See Figure 10.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/US2018/034330 2017-05-25 2018-05-24 MODIFIED IgG1 Fc DOMAINS AND ANTI-CD40 DOMAIN ANTIBODY FUSIONS THEREWITH Ceased WO2018217988A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CN201880032964.0A CN110637035A (zh) 2017-05-25 2018-05-24 经修饰的IgG1 Fc结构域与抗-CD40域抗体的融合
KR1020247019564A KR102847736B1 (ko) 2017-05-25 2018-05-24 변형된 IgG1 Fc 도메인 및 그와의 항-CD40 도메인 항체 융합체
EP18731284.8A EP3630832A1 (en) 2017-05-25 2018-05-24 MODIFIED IgG1 Fc DOMAINS AND ANTI-CD40 DOMAIN ANTIBODY FUSIONS THEREWITH
US16/495,994 US20200148779A1 (en) 2017-05-25 2018-05-24 MODIFIED IgG1 Fc DOMAINS AND ANTI-CD40 DOMAIN ANTIBODY FUSIONS THEREWITH
JP2019564951A JP2020521458A (ja) 2017-05-25 2018-05-24 改変IgG1 Fcドメインおよび該ドメインと抗CD40ドメイン抗体の融合物
KR1020197037759A KR20200012907A (ko) 2017-05-25 2018-05-24 변형된 IgG1 Fc 도메인 및 그와의 항-CD40 도메인 항체 융합체
JP2023077286A JP2023113636A (ja) 2017-05-25 2023-05-09 改変IgG1 Fcドメインおよび該ドメインと抗CD40ドメイン抗体の融合物
US19/313,261 US20260042858A1 (en) 2017-05-25 2025-08-28 Modified IgG1 Fc Domains and Anti-CD40 Domain Antibody Fusions Therewith

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762511245P 2017-05-25 2017-05-25
US62/511,245 2017-05-25

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/495,994 A-371-Of-International US20200148779A1 (en) 2017-05-25 2018-05-24 MODIFIED IgG1 Fc DOMAINS AND ANTI-CD40 DOMAIN ANTIBODY FUSIONS THEREWITH
US19/313,261 Continuation US20260042858A1 (en) 2017-05-25 2025-08-28 Modified IgG1 Fc Domains and Anti-CD40 Domain Antibody Fusions Therewith

Publications (2)

Publication Number Publication Date
WO2018217988A1 true WO2018217988A1 (en) 2018-11-29
WO2018217988A9 WO2018217988A9 (en) 2019-05-02

Family

ID=62599725

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/034330 Ceased WO2018217988A1 (en) 2017-05-25 2018-05-24 MODIFIED IgG1 Fc DOMAINS AND ANTI-CD40 DOMAIN ANTIBODY FUSIONS THEREWITH

Country Status (6)

Country Link
US (2) US20200148779A1 (https=)
EP (1) EP3630832A1 (https=)
JP (2) JP2020521458A (https=)
KR (2) KR20200012907A (https=)
CN (1) CN110637035A (https=)
WO (1) WO2018217988A1 (https=)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021183428A1 (en) * 2020-03-09 2021-09-16 Bristol-Myers Squibb Company Antibodies to cd40 with enhanced agonist activity
US11155618B2 (en) 2018-04-02 2021-10-26 Bristol-Myers Squibb Company Anti-TREM-1 antibodies and uses thereof
WO2021236546A1 (en) 2020-05-18 2021-11-25 Bristol-Myers Squibb Company Antibody variants with improved pharmacokinetic properties
US11220550B2 (en) 2017-05-25 2022-01-11 Bristol-Myers Squibb Company Antagonistic anti-CD40 antibodies and methods of antagonizing CD40 activity
US11254750B2 (en) 2018-11-19 2022-02-22 Bristol-Myers Squibb Company Antagonistic CD40 monoclonal antibodies and uses in treating immune responses
US11352440B2 (en) 2014-11-21 2022-06-07 Bristol-Myers Squibb Company Antibodies against CD73 and uses thereof
US11365256B2 (en) 2016-06-08 2022-06-21 Xencor, Inc. Methods and compositions for inhibiting CD32B expressing cells in IGG4-related diseases
JP2023523927A (ja) * 2020-04-23 2023-06-08 イーライ リリー アンド カンパニー 抗体の皮下吸収及びバイオアベイラビリティ
EP4017529A4 (en) * 2019-08-22 2024-03-13 Cidara Therapeutics, Inc. FIELDS FC VARIANTS AND THEIR USES

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TWI869528B (zh) 2020-01-13 2025-01-11 美商威特拉公司 C5ar1抗體分子及其用途
CN112552389B (zh) * 2020-08-07 2023-06-06 中爱瑞祥(杭州)生物科技有限公司 一种活性肽融合蛋白及其制备方法
KR20230097061A (ko) * 2020-11-02 2023-06-30 아트라러스, 인크. Sap fc 융합 단백질 및 사용 방법
AU2022207985A1 (en) 2021-01-13 2023-07-06 Visterra, Inc. Humanized complement 5a receptor 1 antibodies and methods of use thereof

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012065950A1 (en) * 2010-11-15 2012-05-24 Novartis Ag Silent fc variants of anti-cd40 antibodies
WO2012145673A1 (en) 2011-04-21 2012-10-26 Bristol-Myers Squibb Company Antibody polypeptides that antagonize cd40
US20130209445A1 (en) * 2004-03-26 2013-08-15 Xencor, Inc. Optimized Fc Variants
WO2015134988A1 (en) * 2014-03-07 2015-09-11 Bristol-Myers Squibb Company Method of using antibody polypeptides that antagonize cd40 to treat ibd
WO2016028810A1 (en) * 2014-08-18 2016-02-25 Biogen Ma Inc. Anti-cd40 antibodies and uses thereof

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040132101A1 (en) * 2002-09-27 2004-07-08 Xencor Optimized Fc variants and methods for their generation
CN103172731A (zh) * 2004-07-15 2013-06-26 赞科股份有限公司 优化的Fc变体
KR20080073293A (ko) * 2005-10-14 2008-08-08 메디뮨 엘엘씨 항체 라이브러리의 세포 디스플레이
US10053513B2 (en) * 2009-11-30 2018-08-21 Janssen Biotech, Inc. Antibody Fc mutants with ablated effector functions
US20140294812A1 (en) * 2013-03-15 2014-10-02 Xencor, Inc. Fc variants that improve fcrn binding and/or increase antibody half-life
CR20180177A (es) * 2015-09-30 2018-06-22 Janssen Biotech Inc Anticuerpos agonistas que se unen específicamente a cd40 humana y método de uso
WO2018217976A1 (en) * 2017-05-25 2018-11-29 Bristol-Myers Squibb Company Antagonistic cd40 monoclonal antibodies and uses thereof

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130209445A1 (en) * 2004-03-26 2013-08-15 Xencor, Inc. Optimized Fc Variants
WO2012065950A1 (en) * 2010-11-15 2012-05-24 Novartis Ag Silent fc variants of anti-cd40 antibodies
WO2012145673A1 (en) 2011-04-21 2012-10-26 Bristol-Myers Squibb Company Antibody polypeptides that antagonize cd40
US20140099317A1 (en) 2011-04-21 2014-04-10 Domantis Limited Antibody polypeptides that antagonize cd40
WO2015134988A1 (en) * 2014-03-07 2015-09-11 Bristol-Myers Squibb Company Method of using antibody polypeptides that antagonize cd40 to treat ibd
WO2016028810A1 (en) * 2014-08-18 2016-02-25 Biogen Ma Inc. Anti-cd40 antibodies and uses thereof

Non-Patent Citations (8)

* Cited by examiner, † Cited by third party
Title
ADAMS ET AL.: "Development of a chimeric anti-CD40 monoclonal antibody that synergizes with LEA29Y to prolong islet allograft survival", J. IMMUNOL., vol. 174, 2005, pages 542 - 50, XP002393472
CAI ET AL., BIOTECHNOL BIOENG., vol. 108, no. 2, 2011, pages 404 - 12
DAVIES ET AL., MOL. CELL BIOL., vol. 25, 2005, pages 9806 - 19
GESTUR VIDARSSON ET AL: "IgG Subclasses and Allotypes: From Structure to Effector Functions", FRONTIERS IN IMMUNOLOGY, vol. 5, 20 October 2014 (2014-10-20), XP055429512, DOI: 10.3389/fimmu.2014.00520 *
HOOGENBOOM ET AL., NUCLEIC ACIDS RES., vol. 19, 1991, pages 4133 - 4137
KABAT ET AL.: "Sequences of Immunological Interest", 1991, U.S. DEPT. HEALTH & HUMAN SERVICES
REMINGTON ET AL.: "THE SCIENCE AND PRACTICE OF PHARMACY", 2005, MACK PUBLISHING CO.
VONDERHEIDE ET AL., J. CLIN. ONCOL., vol. 25, no. 7, 2007, pages 876 - 883

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11352440B2 (en) 2014-11-21 2022-06-07 Bristol-Myers Squibb Company Antibodies against CD73 and uses thereof
US12509518B2 (en) 2016-06-08 2025-12-30 Xencor, Inc. Methods and compositions for inhibiting CD32B expressing cells in IgG4-related diseases
US11365256B2 (en) 2016-06-08 2022-06-21 Xencor, Inc. Methods and compositions for inhibiting CD32B expressing cells in IGG4-related diseases
US11220550B2 (en) 2017-05-25 2022-01-11 Bristol-Myers Squibb Company Antagonistic anti-CD40 antibodies and methods of antagonizing CD40 activity
US11613585B2 (en) 2017-05-25 2023-03-28 Bristol-Myers Squibb Company Nucleic acids encoding antagonistic CD40 monoclonal antibodies
US11155618B2 (en) 2018-04-02 2021-10-26 Bristol-Myers Squibb Company Anti-TREM-1 antibodies and uses thereof
US11254750B2 (en) 2018-11-19 2022-02-22 Bristol-Myers Squibb Company Antagonistic CD40 monoclonal antibodies and uses in treating immune responses
US11261258B2 (en) 2018-11-19 2022-03-01 Bristol-Myers Squibb Company Antagonistic CD40 monoclonal antibodies and uses thereof
US11773178B2 (en) 2018-11-19 2023-10-03 Bristol-Myers Squibb Company Antagonistic CD40 monoclonal antibodies and uses thereof
US11795231B2 (en) 2018-11-19 2023-10-24 Bristol-Myers Squibb Company Antagonistic CD40 monoclonal antibodies and uses thereof
US11926673B2 (en) 2018-11-19 2024-03-12 Bristol-Myers Squibb Company Antagonistic CD40 monoclonal antibodies and uses thereof
EP4017529A4 (en) * 2019-08-22 2024-03-13 Cidara Therapeutics, Inc. FIELDS FC VARIANTS AND THEIR USES
WO2021183428A1 (en) * 2020-03-09 2021-09-16 Bristol-Myers Squibb Company Antibodies to cd40 with enhanced agonist activity
JP2023523927A (ja) * 2020-04-23 2023-06-08 イーライ リリー アンド カンパニー 抗体の皮下吸収及びバイオアベイラビリティ
WO2021236546A1 (en) 2020-05-18 2021-11-25 Bristol-Myers Squibb Company Antibody variants with improved pharmacokinetic properties

Also Published As

Publication number Publication date
CN110637035A (zh) 2019-12-31
KR102847736B1 (ko) 2025-08-18
EP3630832A1 (en) 2020-04-08
JP2020521458A (ja) 2020-07-27
JP2023113636A (ja) 2023-08-16
WO2018217988A9 (en) 2019-05-02
KR20240095463A (ko) 2024-06-25
KR20200012907A (ko) 2020-02-05
US20200148779A1 (en) 2020-05-14
US20260042858A1 (en) 2026-02-12

Similar Documents

Publication Publication Date Title
KR102847736B1 (ko) 변형된 IgG1 Fc 도메인 및 그와의 항-CD40 도메인 항체 융합체
US11613585B2 (en) Nucleic acids encoding antagonistic CD40 monoclonal antibodies
CA3120358C (en) Antagonistic cd40 monoclonal antibodies and uses thereof
EP3464367B1 (en) Bispecific binding proteins binding an immunomodulatory protein and a tumor antigen
JP2023182757A (ja) 調整可能な親和性を有する免疫調節タンパク質
EP3988577A1 (en) Anti-cd137 antibodies
CN113195523A (zh) IL-12异源二聚体Fc融合蛋白
CN113423734A (zh) 靶向PD-1的IL-15/IL-15RαFC融合蛋白及其在联合疗法中的应用
WO2017083525A1 (en) Composition and methods for anti-tnfr2 antibodies
US12435131B2 (en) Agents that interfere with thymic stromal lymphopoietin (TSLP)-receptor signaling
EP3969474A1 (en) Binding molecules
US20260049141A1 (en) Multifunctional molecule directed against cd28
CN121532432A (zh) 免疫治疗蛋白
HK40073076A (en) Anti-cd137 antibodies
EA048273B1 (ru) Антагонистические моноклональные антитела к cd40 и их применения
HK40050240A (en) Pd-1 targeted il-15/il-15ralpha fc fusion proteins and uses in combination therapies thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18731284

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2019564951

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20197037759

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2018731284

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2018731284

Country of ref document: EP

Effective date: 20200102