WO2018193105A1 - Combination therapy - Google Patents

Combination therapy Download PDF

Info

Publication number
WO2018193105A1
WO2018193105A1 PCT/EP2018/060215 EP2018060215W WO2018193105A1 WO 2018193105 A1 WO2018193105 A1 WO 2018193105A1 EP 2018060215 W EP2018060215 W EP 2018060215W WO 2018193105 A1 WO2018193105 A1 WO 2018193105A1
Authority
WO
WIPO (PCT)
Prior art keywords
agent
individual
treatment
composition
cancer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2018/060215
Other languages
English (en)
French (fr)
Inventor
Jay Marshall Feingold
Patricius Hendrikus Cornelis VAN BERKEL
Jens WUERTHNER
John Hartley
Francesca ZAMMARCHI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
ADC Therapeutics SA
MedImmune Ltd
Original Assignee
ADC Therapeutics SA
MedImmune Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from GBGB1706261.3A external-priority patent/GB201706261D0/en
Priority claimed from GBGB1706256.3A external-priority patent/GB201706256D0/en
Priority claimed from GBGB1706253.0A external-priority patent/GB201706253D0/en
Priority claimed from GBGB1706254.8A external-priority patent/GB201706254D0/en
Priority claimed from GBGB1706259.7A external-priority patent/GB201706259D0/en
Priority claimed from GBGB1706260.5A external-priority patent/GB201706260D0/en
Priority claimed from GBGB1706257.1A external-priority patent/GB201706257D0/en
Priority claimed from GBGB1706258.9A external-priority patent/GB201706258D0/en
Priority claimed from GBGB1802947.0A external-priority patent/GB201802947D0/en
Priority claimed from GBGB1805660.6A external-priority patent/GB201805660D0/en
Priority to CA3057749A priority Critical patent/CA3057749A1/en
Application filed by ADC Therapeutics SA, MedImmune Ltd filed Critical ADC Therapeutics SA
Priority to EA202092513A priority patent/EA202092513A1/ru
Priority to MX2019012462A priority patent/MX2019012462A/es
Priority to US16/605,701 priority patent/US20200405879A1/en
Priority to CN201880038974.5A priority patent/CN110869765A/zh
Priority to EP18721976.1A priority patent/EP3612839A1/en
Priority to KR1020197033821A priority patent/KR20190137151A/ko
Priority to JP2019556889A priority patent/JP2020517640A/ja
Priority to AU2018253951A priority patent/AU2018253951A1/en
Priority to BR112019021822-0A priority patent/BR112019021822A2/pt
Publication of WO2018193105A1 publication Critical patent/WO2018193105A1/en
Anticipated expiration legal-status Critical
Priority to US17/819,185 priority patent/US20230149556A1/en
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5082Supracellular entities, e.g. tissue, organisms
    • G01N33/5088Supracellular entities, e.g. tissue, organisms of vertebrates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/13Amines
    • A61K31/135Amines having aromatic rings, e.g. ketamine, nortriptyline
    • A61K31/138Aryloxyalkylamines, e.g. propranolol, tamoxifen, phenoxybenzamine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/551Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
    • A61K31/55131,4-Benzodiazepines, e.g. diazepam or clozapine
    • A61K31/55171,4-Benzodiazepines, e.g. diazepam or clozapine condensed with five-membered rings having nitrogen as a ring hetero atom, e.g. imidazobenzodiazepines, triazolam
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7068Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7076Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68035Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6807Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/52Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/70Mechanisms involved in disease identification
    • G01N2800/7023(Hyper)proliferation
    • G01N2800/7028Cancer

Definitions

  • the present disclosure relates to combination therapies for the treatment of pathological conditions, such as cancer.
  • the present disclosure relates to combination therapies comprising treatment with an Antibody Drug Conjugate (ADC), a secondary agent, and optionally an anti-CD20 agent.
  • ADC Antibody Drug Conjugate
  • ADC antibody-drug conjugates
  • cytotoxic or cytostatic agents i.e. drugs to kill or inhibit tumour cells in the treatment of cancer
  • CD19 is a 95 kDa membrane receptor that is expressed early in B cell differentiation and continues to be expressed until the B cells are triggered to terminally differentiate (Pezzutto et al.(1987), J. Immunol 138:2793; Tedder et al (1994) Immunol
  • the CD19 extracellular domain contains two C2-type immunoglobulin (IG)-like domains separated by a smaller potentially disulfide-linked domain.
  • the CD19 cytoplasmic domain is structurally unique, but highly conserved between human, mouse, and guinea pig (Fujimoto et al., (1998) Semin Immunol.10:267).
  • CD19 is part of a protein complex found on the cell surface of B-lymphocytes.
  • the protein complex includes CD19, CD21 (complement receptor, type 2), CD81 (TAPA-1 ), and CD225 (Leu-13) (Fujimoto, supra).
  • CD19 is an important regulator of transmembrane signals in B cells.
  • An increase or decrease in the cell surface density of CD19 affects B cell development and function, resulting in diseases such as autoimmunity or hypogammaglobulinemia.
  • the CD19 complex potentiates the response of B cells to antigen in vivo through cross-linking of two separate signal transduction complexes found on B cell membranes.
  • the two signal transduction complexes, associated with membrane IgM and CD19 activate phospholipase C (PLC) by different mechanisms.
  • CD19 and B cell receptor cross-linking reduces the number of IgM molecules required to activate PLC.
  • CD19 also functions as a specialized adapter protein for the amplification of Arc family kinases (Hasegawa et ah, (2001 ) J Immunol 167:3190).
  • CD19 binding has been shown to both enhance and inhibit B-cell activation and proliferation, depending on the amount of cross-linking that occurs (Tedder, 1994, Immunol. Today 15:437). CD19 is expressed on greater than 90% of B-cell lymphomas and has been predicted to affect growth of lymphomas in vitro and in vivo.
  • an Antibody Drug Conjugate comprising an anti-CD19 antibody (an anti-CD19-ADC) in the treatment of, for example, cancer has been established - see, for example, WO2014/0571 17 and WO2016/166298.
  • CD22 is a 135-kDa type I transmembrane sialoglycoprotein of the immunoglobulin (Ig) superfamily. CD22 expression is specific to B cells and is developmental ⁇ regulated so that expression is limited in pro-B and pre-B cells (Dorner & Goldenberg, 2007, Ther Clin Risk Manag 3:954-59). As B-cells mature, expression increases and localization of CD22 shifts to the cell surface (Dorner & Goldenberg, 2007). CD22 is strongly expressed on follicular, mantle and marginal-zone B cells, but is weakly present in germinal B cells (Dorner & Goldenberg, 2007).
  • Ig immunoglobulin
  • CD22 is an inhibitory co-receptor that down modulates B- cell receptor (BCR) signalling by setting a signalling threshold that prevents overstimulation of B cells (Nitschke, 2005, Curr Opin Immunol 17:290-97).
  • Antibodies against CD22 such as epratuzumab (hLL2), have been used for treatment of a variety of cancers and autoimmune diseases, including but not limited to acute lymphoblastic leukemia (Hoelzer et al., 2013, Curr Opin Oncol 25:701-6), chronic lymphocytic leukemia (Macromatis & Cheson, 2004, Blood Rev 18:137-48), non-Hodgkin's lymphoma (Leonard et al., 2004, Clin Cancer Res 10:5327-34; Dorner & Goldenberg, 2007), follicular lymphoma (lllidge & Morchhauser, 201 1 , Best Pract Res Clin Haematol 24:279-93), diffuse large B-
  • an Antibody Drug Conjugate comprising an anti-CD22 antibody (an anti-CD22-ADC) in the treatment of, for example, cancer has been established - see, for example, WO2014/057122 and WO2016/166307, or as described in Kantarjian et al., (2016. New Eng J Med).
  • the present authors have further determined that administration of a combination of an ADC and a secondary agent to an individual that has either been treated with, or is being treated with, and anti-CD20 agent leads to a synergistic increase in treatment efficacy.
  • an ADC is administered in combination with anti-CD20 agent as a secondary agent. That is, it is envisaged that a combination of [ADC + anti-CD20 agent] is administered to the individual in combination.
  • an ADC is administered in combination with the anti-CD20 agent as a tertiary agent, in further combination with a secondary agent as described herein (such as a Bruton's Tyrosine Kinase inhibitor (BTKi), a PD1 antagonist, a PD-L1 antagonist, a GITR agonist, an OX40 agonist, a CTLA-4 antagonist, Fludarabine or Cytarabine, a hypomethylating agent, or an agent that upregulates HER2 expression).
  • a combination of [ADC + secondary agent + anti-CD20 agent] is administered to the individual in combination.
  • the present disclosure provides a method of selecting an individual as suitable for treatment with a combination of an ADC and a secondary agent, wherein the individual is selected for treatment with the combination of an ADC and a secondary agent if the individual has been treated, or is being treated, with an anti-CD20 agent.
  • the individual may be selected for treatment if the individual is refractory to treatment, or further treatment, with the anti-CD20 agent.
  • the present disclosure provides a method for treating a disorder in an individual, the method comprising selecting an individual as suitable for treatment by a method of the first aspect, and then administering to the individual an effective amount of a combination of an ADC and a secondary agent.
  • the method of treatment may further comprise administering an anti-CD20 agent in combination with the combination of an ADC and a secondary agent.
  • the present authors have determined that the administration of a combination of an ADC, a secondary agent, and optionally an anti-CD20 agent to an individual leads to unexpected clinical advantages.
  • the disclosure provides a method for treating a disorder in an individual, the method comprising administering to the individual an effective amount of an ADC, a secondary agent, and optionally an anti-CD20 agent.
  • the individual may be selected for treatment according to a method according of the first aspect.
  • the disorder may be a proliferative disease, for example a cancer such as non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome-positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • a cancer such as non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphom
  • the ADC may be anti-CD19-ADC, such as ADCX19 described herein.
  • the ADC may be anti-CD22-ADC, such as ADCX22 described herein.
  • the secondary agent may be a Bruton's Tyrosine Kinase inhibitor (BTKi), a PD1 antagonist, a PD-L1 antagonist, a GITR agonist, an OX40 agonist, a CTLA-4 antagonist, Fludarabine or Cytarabine, a hypomethylating agent, an agent that upregulates HER2 expression, or an anti-CD20 agent.
  • BTKi Bruton's Tyrosine Kinase inhibitor
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD19+ve and CD19-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD22+ve and C22-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD 19- ve neoplastic cells, optionally wherein the CD19-ve neoplastic cells are associated with CD19+ve neoplastic or non-neoplastic cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD22-ve neoplastic cells, optionally wherein the CD22-ve neoplastic cells are associated with CD22+ve neoplastic or non-neoplastic cells.
  • the individual may be human.
  • the individual may have cancer, or may have been determined to have cancer.
  • the individual may have, or have been determined to have, a CD19+ cancer or CD19+ tumour-associated non-tumour cells, such as CD19+ infiltrating B-cells.
  • the individual may have, or have been determined to have, a CD22+ cancer or CD22+ tumour-associated non-tumour cells, such as CD22+ infiltrating B-cells.
  • the target cancer or cancer cells may be all or part of a solid tumour.
  • Solid tumor herein will be understood to include solid haematological cancers such as lymphomas (Hodgkin's lymphoma or non-Hodgkin's lymphoma) which are discussed in more detail herein.
  • lymphomas Hodgkin's lymphoma or non-Hodgkin's lymphoma
  • the solid tumour may be a tumour with high levels of infiltrating T-cells, such as infiltrating regulatory T-cells (Treg; Menetrier-Caux, C, et al., Targ Oncol (2012) 7:15- 28; Arce Vargas et al., 2017, Immunity 46, 1-10; Tanaka, A., et al., Cell Res. 2017 Jan;27(1 ):109-1 18).
  • the solid tumour may be pancreatic cancer, breast cancer, colorectal cancer, gastric and oesophageal cancer, leukemia and lymphoma, melanoma, non-small cell lung cancer, ovarian cancer, hepatocellular carcinoma, renal cell carcinoma, and head and neck cancer.
  • the ADC may be administered before the secondary agent, simultaneous with the secondary agent, or after the secondary agent.
  • the ADC and secondary agent may be administered before the anti-CD20 agent, simultaneous with the anti-CD20 agent, or after the anti-CD20 agent.
  • the disclosed methods may comprise administering a further chemotherapeutic agent to the individual.
  • the present disclosure provides an anti-CD20 agent, or a composition comprising an anti-CD20 agent, for use in a method of treatment as described herein.
  • the present disclosure provides for the use of an anti-CD20 agent in the manufacture of a medicament for treating a disorder in an individual, wherein the treatment comprises a method of treatment as described herein.
  • the disclosure provides a first composition comprising an ADC for use in a method of treating a disorder in an individual, wherein the treatment comprises administration of the first composition in combination with a second composition comprising a secondary agent and, optionally, in combination with a third composition comprising an anti-CD20 agent.
  • a first composition comprising a secondary agent for use in a method of treating a disorder in an individual, wherein the treatment comprises administration of the first composition in combination with a second composition comprising an ADC and, optionally, in combination with a third composition comprising an anti-CD20 agent.
  • the disorder may be a proliferative disease, for example a cancer such as non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome-positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • a cancer such as non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphom
  • the target cancer or cancer cells may be all or part of a solid tumour.
  • Solid tumor herein will be understood to include solid haematological cancers such as lymphomas (Hodgkin's lymphoma or non-Hodgkin's lymphoma) which are discussed in more detail herein.
  • the solid tumour may be a tumour with high levels of infiltrating T-cells, such as infiltrating regulatory T-cells (Treg; Menetrier-Caux, C, et al., Targ Oncol (2012) 7:15- 28; Arce Vargas et al., 2017, Immunity 46, 1-10; Tanaka, A., et al., Cell Res. 2017 Jan;27(1 ):109-1 18).
  • the solid tumour may be pancreatic cancer, breast cancer, colorectal cancer, gastric and oesophageal cancer, leukemia and lymphoma, melanoma, non-small cell lung cancer, ovarian cancer, hepatocellular carcinoma, renal cell carcinoma, and head and neck cancer.
  • the ADC may be anti-CD 19-ADC, such as ADCX19 described herein.
  • the ADC may be anti-CD22-ADC, such as ADCX22 described herein.
  • the secondary agent may be a Bruton's Tyrosine Kinase inhibitor (BTKi), a PD1 antagonist, a PD-L1 antagonist, a GITR agonist, an OX40 agonist, a CTLA-4 antagonist, Fludarabine or Cytarabine, a hypomethylating agent, an agent that upregulates HER2 expression, or an anti-CD20 agent.
  • BTKi Bruton's Tyrosine Kinase inhibitor
  • a PD1 antagonist a PD-L1 antagonist
  • a GITR agonist an OX40 agonist
  • CTLA-4 antagonist a CTLA-4 antagonist
  • Fludarabine or Cytarabine Fludarabine or Cytarabine
  • a hypomethylating agent an agent that upregulates HER2 expression
  • an anti-CD20 agent an anti-CD20 agent.
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD19+ve and CD19-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD22+ve and C22-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD19-ve neoplastic cells, optionally wherein the CD19-ve neoplastic cells are associated with CD19+ve neoplastic or non-neoplastic cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD22-ve neoplastic cells, optionally wherein the CD22-ve neoplastic cells are associated with CD22+ve neoplastic or non-neoplastic cells.
  • the individual may be human.
  • the individual may have cancer, or may have been determined to have cancer.
  • the individual may have, or have been determined to have, a CD19+ cancer or CD19+ tumour-associated non-tumour cells, such as CD19+ infiltrating B-cells.
  • the individual may have, or have been determined to have, a CD22+ cancer or CD22+ tumour-associated non-tumour cells, such as CD22+ infiltrating B-cells.
  • the first composition may be administered before the second composition, simultaneous with the second composition, or after the second composition.
  • the ADC and secondary agent may be administered before the anti-CD20 agent, simultaneous with the anti-CD20 agent, or after the anti-CD20 agent.
  • the treatment may comprise administering a further chemotherapeutic agent to the individual.
  • the disclosure provides the use of an ADC in the manufacture of a medicament for treating a disorder in an individual, wherein the medicament comprises an ADC, and wherein the treatment comprises administration of the medicament in combination with a composition comprising secondary agent and, optionally, in combination with a third composition comprising an anti-CD20 agent.
  • Also provided by this aspect is the use of secondary agent in the manufacture of a medicament for treating a disorder in an individual, wherein the medicament comprises a secondary agent, and wherein the treatment comprises administration of the medicament in combination with a composition comprising an ADC and, optionally, in combination with a third composition comprising an anti-CD20 agent.
  • the disorder may be a proliferative disease, for example a cancer such as non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome-positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • a cancer such as non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphom
  • the target cancer or cancer cells may be all or part of a solid tumour.
  • Solid tumor herein will be understood to include solid haematological cancers such as lymphomas (Hodgkin's lymphoma or non-Hodgkin's lymphoma) which are discussed in more detail herein.
  • lymphomas Hodgkin's lymphoma or non-Hodgkin's lymphoma
  • the solid tumour may be a tumour with high levels of infiltrating T-cells, such as infiltrating regulatory T-cells (Treg; Menetrier-Caux, C, et al., Targ Oncol (2012) 7:15- 28; Arce Vargas et al., 2017, Immunity 46, 1-10; Tanaka, A., et al., Cell Res. 2017 Jan;27(1 ): 109-1 18).
  • the solid tumour may be pancreatic cancer, breast cancer, colorectal cancer, gastric and oesophageal cancer, leukemia and lymphoma, melanoma, non-small cell lung cancer, ovarian cancer, hepatocellular carcinoma, renal cell carcinoma, and head and neck cancer.
  • the ADC may be anti-CD19-ADC, such as ADCX19 described herein.
  • the ADC may be anti-CD22-ADC, such as ADCX22 described herein.
  • the secondary agent may be a Bruton's Tyrosine Kinase inhibitor (BTKi), a PD1 antagonist, a PD-L1 antagonist, a GITR agonist, an OX40 agonist, a CTLA-4 antagonist, Fludarabine or Cytarabine, a hypomethylating agent, an agent that upreguiates HER2 expression, or an anti-CD20 agent.
  • BTKi Bruton's Tyrosine Kinase inhibitor
  • a PD1 antagonist a PD-L1 antagonist
  • a GITR agonist an OX40 agonist
  • CTLA-4 antagonist a CTLA-4 antagonist
  • Fludarabine or Cytarabine Fludarabine or Cytarabine
  • a hypomethylating agent an agent that upreguiates HER2 expression
  • an anti-CD20 agent an anti-CD20 agent.
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD19+ve and CD19-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD22+ve and C22-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD19-ve neoplastic cells, optionally wherein the CD19-ve neoplastic cells are associated with CD19+ve neoplastic or non-neoplastic cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD22-ve neoplastic cells, optionally wherein the CD22-ve neoplastic cells are associated with CD22+ve neoplastic or non-neoplastic cells.
  • the individual may be human.
  • the individual may have cancer, or may have been determined to have cancer.
  • the individual may have, or have been determined to have, a CD19+ cancer or CD19+ tumour-associated non-tumour cells, such as CD19+ infiltrating B-cells.
  • the individual may have, or have been determined to have, a CD22+ cancer or CD22+ tumour-associated non-tumour cells, such as CD22+ infiltrating B-cells.
  • the medicament may be administered before the composition, simultaneous with the composition, or after the composition.
  • the ADC and secondary agent may be administered before the anti-CD20 agent, simultaneous with the anti-CD20 agent, or after the anti-CD20 agent.
  • the treatment may comprise administering a further chemotherapeutic agent to the individual.
  • kits comprising:
  • a first medicament comprising an ADC
  • a second medicament comprising a secondary agent
  • a package insert comprising instructions for administration of the first medicament to an individual in combination with the second medicament and, optionally, in further combination with the third medicament, if present, for the treatment of a disorder.
  • kits comprising a medicament comprising an ADC and a package insert comprising instructions for administration of the medicament to an individual in combination with a composition comprising a secondary agent and, optionally, in further combination with an anti-CD20 agent, for the treatment of a disorder.
  • a kit comprising a medicament comprising a secondary agent and a package insert comprising instructions for administration of the medicament to an individual in combination with a composition comprising an ADC and, optionally, in further combination with an anti-CD20 agent, for the treatment of a disorder.
  • the disorder may be a proliferative disease, for example a cancer such as non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome-positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • a cancer such as non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphom
  • Solid tumor herein will be understood to include solid haematological cancers such as lymphomas (Hodgkin's lymphoma or non-Hodgkin's lymphoma) which are discussed in more detail herein.
  • the solid tumour may be a tumour with high levels of infiltrating T-cells, such as infiltrating regulatory T-cells (Treg; Menetrier-Caux, C, et al., Targ Oncol (2012) 7:15- 28; Arce Vargas et al., 2017, Immunity 46, 1-10; Tanaka, A., et al., Cell Res. 2017 Jan;27(1 ):109-1 18).
  • the solid tumour may be pancreatic cancer, breast cancer, colorectal cancer, gastric and oesophageal cancer, leukemia and lymphoma, melanoma, non-small cell lung cancer, ovarian cancer, hepatocellular carcinoma, renal cell carcinoma, and head and neck cancer.
  • the ADC may be anti-CD 19-ADC, such as ADCX19 described herein.
  • the ADC may be anti-CD22-ADC, such as ADCX22 described herein.
  • the secondary agent may be a Bruton's Tyrosine Kinase inhibitor (BTKi), a PD1 antagonist, a PD-L1 antagonist, a GITR agonist, an OX40 agonist, a CTLA-4 antagonist, Fludarabine or Cytarabine, a hypomethylating agent, an agent that upregulates HER2 expression, or an anti-CD20 agent.
  • BTKi Bruton's Tyrosine Kinase inhibitor
  • a PD1 antagonist a PD-L1 antagonist
  • a GITR agonist an OX40 agonist
  • CTLA-4 antagonist a CTLA-4 antagonist
  • Fludarabine or Cytarabine Fludarabine or Cytarabine
  • a hypomethylating agent an agent that upregulates HER2 expression
  • an anti-CD20 agent an anti-CD20 agent.
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD19+ve and CD19-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD22+ve and C22-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD19-ve neoplastic cells, optionally wherein the CD19-ve neoplastic cells are associated with CD19+ve neoplastic or non-neoplastic cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD22-ve neoplastic cells, optionally wherein the CD22-ve neoplastic cells are associated with CD22+ve neoplastic or non-neoplastic cells.
  • the individual may be human.
  • the individual may have cancer, or may have been determined to have cancer.
  • the individual may have, or have been determined to have, a CD19+ cancer or CD19+ tumour-associated non-tumour cells, such as CD19+ infiltrating B-cells.
  • the individual may have, or have been determined to have, a CD22+ cancer or CD22+ tumour-associated non-tumour cells, such as CD22+ infiltrating B-cells.
  • the medicament or composition comprising the ADC may be administered before the medicament or composition comprising the secondary agent, simultaneous with the medicament or composition comprising the secondary agent, or after the medicament or composition comprising the secondary agent.
  • the ADC and secondary agent may be administered before the anti-CD20 agent, simultaneous with the anti-CD20 agent, or after the anti-CD20 agent.
  • the treatment may comprise administering a further chemotherapeutic agent to the individual.
  • the disclosure provides a composition comprising an ADC, a secondary agent, and optionally an anti-CD20 agent. Also provided in this aspect of the disclosure is a method of treating a disorder in an individual, the method comprising administering to the individual an effective amount of the composition comprising an ADC, a secondary agent, and optionally an anti-CD20 agent.
  • composition comprising an ADC, a secondary agent, and optionally an anti-CD20 agent, for use in a method of treating a disorder in an individual.
  • compositions comprising an ADC, a secondary agent, and optionally an anti-CD20 agent, in the manufacture of a medicament for treating a disorder in an individual.
  • kits comprising composition comprising an ADC, a secondary agent, and optionally an anti-CD20 agent, and a set of instructions for administration of the medicament to an individual for the treatment of a disorder.
  • the disorder may be a proliferative disease, for example a cancer such as non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome-positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • a cancer such as non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphom
  • the target cancer or cancer cells may be all or part of a solid tumour.
  • Solid tumor herein will be understood to include solid haematological cancers such as lymphomas (Hodgkin's lymphoma or non-Hodgkin's lymphoma) which are discussed in more detail herein.
  • the solid tumour may be a tumour with high levels of infiltrating T-cells, such as infiltrating regulatory T-cells (Treg; Menetrier-Caux, C, et al., Targ Oncol (2012) 7:15- 28; Arce Vargas et al., 2017, Immunity 46, 1-10; Tanaka, A., et al., Cell Res. 2017 Jan;27(1 ):109-1 18).
  • the solid tumour may be pancreatic cancer, breast cancer, colorectal cancer, gastric and oesophageal cancer, leukemia and lymphoma, melanoma, non-small cell lung cancer, ovarian cancer, hepatocellular carcinoma, renal cell carcinoma, and head and neck cancer.
  • the ADC may be anti-CD19-ADC, such as ADCX19 described herein.
  • the ADC may be anti-CD22-ADC, such as ADCX22 described herein.
  • the secondary agent may be a Bruton's Tyrosine Kinase inhibitor (BTKi), a PD1 antagonist, a PD-L1 antagonist, a GITR agonist, an OX40 agonist, a CTLA-4 antagonist, Fludarabine or Cytarabine, a hypomethylating agent, an agent that upregulates HER2 expression, or an anti-CD20 agent.
  • BTKi Bruton's Tyrosine Kinase inhibitor
  • a PD1 antagonist a PD-L1 antagonist
  • a GITR agonist an OX40 agonist
  • CTLA-4 antagonist a CTLA-4 antagonist
  • Fludarabine or Cytarabine Fludarabine or Cytarabine
  • a hypomethylating agent an agent that upregulates HER2 expression
  • an anti-CD20 agent an anti-CD20 agent.
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD19+ve and CD19-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD22+ve and C22-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD19-ve neoplastic cells, optionally wherein the CD19-ve neoplastic cells are associated with CD19+ve neoplastic or non-neoplastic cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD22-ve neoplastic cells, optionally wherein the CD22-ve neoplastic cells are associated with CD22+ve neoplastic or non-neoplastic cells.
  • the individual may be human.
  • the individual may have cancer, or may have been determined to have cancer.
  • the individual may have, or have been determined to have, a CD19+ cancer or CD19+ tumour-associated non-tumour cells, such as CD19+ infiltrating B-cells.
  • the individual may have, or have been determined to have, a CD22+ cancer or CD22+ tumour-associated non-tumour cells, such as CD22+ infiltrating B-cells.
  • the ADC and secondary agent may be administered before the anti-CD20 agent, simultaneous with the anti-CD20 agent, or after the anti-CD20 agent.
  • the treatment may comprise administering a further chemotherapeutic agent to the individual.
  • the present disclosure relates to the improved efficacy of combinations of an ADC and a secondary agent.
  • the ADC can deliver a drug to a target location.
  • the target location is preferably a proliferative cell population.
  • the antibody is an antibody for an antigen present on a proliferative cell population.
  • the antigen is absent or present at a reduced level in a non-proliferative cell population compared to the amount of antigen present in the proliferative cell population, for example a tumour cell population.
  • the ADC may comprise a linker which may be cleaved so as to release the drug at the target location.
  • the drug may be a compound selected from RelA, RelB, ReIC, RelD or RelE.
  • the conjugate may be used to selectively provide a compound RelA, RelB, Rel C, RelD or RelE to the target location.
  • the linker may be cleaved by an enzyme present at the target location.
  • the disclosure particularly relates treatment with an anti-CD19 ADC disclosed in
  • the disclosure also particularly relates treatment with an anti-CD22 ADC disclosed in WO2014/057122, and as herein described.
  • anti-CD19 ADCs disclosed in WO2014/057122, and as herein described.
  • CD19-ADC refers to an ADC in which the antibody component is an anti-CD19 antibody.
  • PBD-ADC refers to an ADC in which the drug component is a pyrrolobenzodiazepine (PBD) warhead.
  • anti-CD19-ADC refers to an ADC in which the antibody component is an anti-CD19 antibody, and the drug component is a PBD warhead.
  • the ADC m comprise a conjugate of formula L - (D L ) P , where D L is of formula I or II:
  • L is an antibody (Ab) which is an antibody that binds to CD19;
  • R 12 is selected from the group consisting of:
  • R 25a and R 25b are H and the other is selected from: phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl; and
  • R 2 is selected from: H; C1-3 saturated alkyi; C2-3 aikenyl; C2-3 alkynyl; cyclopropyl; phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl;
  • R 12 is , where R 26a and R 26 are independently selected from H, F, C1-4 saturated alkyi, C2-3 aikenyl, which alkyi and aikenyl groups are optionally substituted by a group selected from C alkyi amido and C1-4 alkyi ester; or, when one of R 26a and R 26b is H, the other is selected from nitrile and a C1-4 alkyi ester;
  • R 6 and R 9 are independently selected from H, R, OH, OR, SH, SR, NH 2 , NHR, NRR', nitro, MesSn and halo;
  • R and R' are independently selected from optionally substituted C1-12 alkyi, C3-20 heterocyclyl and C5-20 aryl groups;
  • R 7 is selected from H, R, OH, OR, SH, SR, NH 2 , NHR, NHRR', nitro, Me 3 Sn and halo;
  • R" is a C3-12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. O, S, NR N2 (where R N2 is H or C1-4 alkyl), and/or aromatic rings, e.g. benzene or pyridine;
  • Y and Y' are selected from O, S, or NH;
  • R 6' , R 7' , R 9' are selected from the same groups as R 6 , R 7 and R 9 respectively;
  • R Lr is a linker for connection to the antibody (Ab);
  • R 11 a is selected from OH, OR A , where R A is C1-4 alkyl, and SO z M, where z is 2 or 3 and M is a monovalent pharmaceutically acceptable cation;
  • R 20 and R 21 either together form a double bond between the nitrogen and carbon atoms to which they are bound or;
  • R 20 is selected from H and R c , where R c is a capping group
  • R 21 is selected from OH, OR A and SO z M;
  • R 2 is selected from the group consisting of:
  • R 15a and R 15b are H and the other is selected from phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl; and
  • R 14 is selected from: H; C1-3 saturated alkyl; C2-3 alkenyl; C2-3 alkynyl; cyclopropyl; phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl;
  • R 2 is , where R 16a and R 16b are independently selected from H, F, C1-4 saturated alkyl, C2-3 alkenyl, which alkyl and alkenyl groups are optionally substituted by i group selected from C alkyl amido and C1-4 alkyl ester; or, when one of R 16a and R 16b is H, the other is selected from nitrile and a C1-4 alkyl ester;
  • R 22 is of formula Ilia, formula Illb or formula lllc:
  • A is a C5-7 aryl group
  • Q 1 is a single bond
  • Q 2 is selected from a single bond and -Z-(CH 2 ) n -, where Z is selected from a single bond, O, S and NH and n is from 1 to 3;
  • Q is selected from O-R 1 2 , S-R 1 2' and NR N -R L2' , and R N is selected from H, methyl and ethyl
  • R N is selected from the group comprising H and C1-4 alkyl
  • R 12' is a linker for connection to the antibody (Ab);
  • R 10 and R 11 either together form a double bond between the nitrogen and carbon atoms to which they are bound or;
  • R 10 is H and R 1 1 is selected from OH, OR A and SO z M;
  • R 30 and R 31 either together form a double bond between the nitrogen and carbon atoms to which they are bound or;
  • R 30 is H and R 31 is selected from OH, OR A and SO z M.
  • L-R' 1 or L-R L2' is a group:
  • L 1 is a cleavable linker
  • A is a connecting group connecting L 1 to the antibody
  • L 1 Is enzyme cleavable.
  • anti-CD19-ADC may include any embodiment described in WO2014/0571 17.
  • DC may have the chemical structure:
  • DAR is between 1 and 8.
  • the antibody may comprise a VH domain having the sequence according to any one of SEQ ID NOs. 1 , 2. 3, 4, 5 or 6, optionally further comprising a VL domain having the sequence according to any one of SEQ ID NOs. 7, 8. 9, 10, 1 1 or 12.
  • the antibody component of the anti-CD19-ADC is an antibody comprising: VH and VL domains respectively having the sequences of: SEQ ID NO. 1 and SEQ ID NO. 7, SEQ ID NO. 2 and SEQ ID NO. 8, SEQ ID NO. 3 and SEQ ID NO. 9, SEQ ID NO. 4 and SEQ ID NO. 10, SEQ ID NO. 5 and SEQ ID NO. 1 1. or SEQ ID NO. 6 and SEQ ID NO. 12.
  • the antibody comprises a VH domain having the sequence according to SEQ ID NO. 2. In preferred embodiments the antibody comprises a VL domain having the sequence according to SEQ ID NO. 8.
  • the antibody comprises a VH domain and a VL domain, the VH and domain having the sequence of SEQ ID NO. 2 and the VL domain having the sequences of SEQ ID NO. 8.
  • VH and VL domain(s) may pair so as to form an antibody antigen binding site that binds CD19.
  • the antibody is an intact antibody comprising a VH domain and a VL domain, the VH and VL domains having sequences of SEQ ID NO. 2 and SEQ ID NO. 8. In some embodiments the antibody is an antibody comprising a heavy chain having sequences of SEQ ID NO. 17 and a light chain having the sequences of SEQ ID NO. 18.
  • the antibody is a fully human monoclonal lgG1 antibody, preferably IgGI . K.
  • the antibody is the RB4v1 .2 antibody described in
  • the antibody is an antibody as described herein which has been modified (or further modified) as described below.
  • the antibody is a humanised, deimmunised or resurfaced version of an antibody disclosed herein.
  • the most preferred anti-CD 19-ADC for use with the aspects of the present disclosure is ADCX19, as described herein below.
  • ADCX19 is an antibody drug conjugate composed of a humanized antibody against human CD19 attached to a pyrrolobenzodiazepine (PBD) warhead via a cleavable linker.
  • the mechanism of action of ADCX19 depends on CD19 binding.
  • the CD19 specific antibody targets the antibody drug conjugate (ADC) to cells expressing CD19.
  • ADC antibody drug conjugate
  • the ADC internalizes and is transported to the lysosome, where the protease sensitive linker is cleaved and free PBD dimer is released inside the target cell.
  • the released PBD dimer inhibits transcription in a sequence-selective manner, due either to direct inhibition of RNA polymerase or inhibition of the interaction of associated transcription factors.
  • the PBD dimer produces covalent crosslinks that do not distort the DNA double helix and which are not recognized by nucleotide excision repair factors, allowing for a longer effective period (Hartley 201 1 ).
  • Ab represents Antibody RB4v1.2 (antibody with the VH and VL sequences SEQ ID NO. 2 and SEQ ID NO. 8, respectively). It is synthesised as described in WO2014/0571 17 (RB4v1 .2-E) and typically has a DAR (Drug to Antibody Ratio) of 2 +/- 0.3. . CD19 binding
  • the “first target protein” as used herein may be CD19.
  • “binds CD19” is used to mean the antibody binds CD19 with a higher affinity than a non-specific partner such as Bovine Serum Albumin (BSA, Genbank accession no. CAA76847, version no. CAA76847.1 GL3336842, record update date: Jan 7, 201 1 02:30 PM).
  • BSA Bovine Serum Albumin
  • the antibody binds CD19 with an association constant (K A ) at least 2, 3, 4, 5, 10, 20, 50, 100, 200, 500, 1000, 2000, 5000, 1 0 4 , 10 5 or 10 6 -fold higher than the antibody's association constant for BSA, when measured at physiological conditions.
  • the antibodies of the invention can bind CD19 with a high affinity.
  • the antibody can bind CD19 with a KD equal to or less than about 1 0 "6 M, such as 1 x 10 "6 , 10 7 , 10 "8 , 10 "9 ,10- 10 , 10 "11 , 10 "12 , 10- 13 or 10 "
  • CD 1 9 polypeptide corresponds to Genbank accession no.
  • nucleic acid encoding CD19 polypeptide corresponds to Genbank accession no NM_001 178098, version no. NM_001 178098.1 GL29601 0920, record update date: Sep 10, 2012 12:43 AM.
  • CD19 polypeptide corresponds to Uniprot/Swiss-Prot accession No. P15391 . anti-CD22 ADCs
  • CD22-ADC refers to an ADC in which the antibody component is an anti-CD22 antibody.
  • PPD-ADC refers to an ADC in which the drug component is a pyrrolobenzodiazepine (PBD) warhead.
  • anti-CD22-ADC refers to an ADC in which the antibody component is an anti-CD22 antibody, and the drug component is a PBD warhead.
  • the ADC may comprise a conjugate of formula L - (D L ) P , where D L is of formula I or II:
  • L is an antibody (Ab) which is an antibody that binds to CD22;
  • R 12 is selected from the group consisting of:
  • R 25a and R 25b are H and the other is selected from: phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl; and
  • R 24 is selected from: H; C1-3 saturated alkyi; C2-3 alkenyl; C2-3 alkynyl; cyclopropyl; phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl;
  • R 12 is , where R 26A and R 26B are independently selected from H, F, C
  • R 6 and R 9 are independently selected from H, R, OH, OR, SH, SR, N H 2 , N H R, N RR', nitro, MesSn and halo;
  • R and R' are independently selected from optionally substituted C1-12 alkyi, C3-20 heterocyclyl and C5-20 aryl groups;
  • R 7 is selected from H, R, OH, OR, SH, SR, N H 2 , N H R, N H RR', nitro, Me 3 Sn and halo;
  • R" is a C3-12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. O, S, N R N2 (where R N2 is H or C alkyi), and/or aromatic rings, e.g. benzene or pyridine;
  • Y and Y' are selected from O, S, or N H;
  • R 6' , R 7' , R 9' are selected from the same groups as R 6 , R 7 and R 9 respectively;
  • R L 1 is a linker for connection to the antibody (Ab);
  • R 1 1 A is selected from OH , OR A , where R A is CM alkyi, and SO z M, where z is 2 or 3 and M is a monovalent pharmaceutically acceptable cation; R 20 and R 21 either together form a double bond between the nitrogen and carbon atoms to which they are bound or;
  • R 20 is selected from H and R c , where R c is a capping group
  • R 21 is selected from OH, OR A and SO z M;
  • R 2 is selected from the group consisting of:
  • R 15a and R 15l> are H and the other is selected from: phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl; and
  • R 14 is selected from: H; C1-3 saturated alkyi; C2-3 alkenyi; C2-3 alkynyl; cyclopropyl; phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl;
  • R 2 is , where R 16a and R 16b are independently selected from H, F, C saturated alkyi, C2-3 alkenyi, which alkyi and alkenyi groups are optionally substituted by a group selected from CM alkyi amido and CM alkyi ester; or, when one of R 16a and R 16b is H, the other is selected from nitrile and a CM alkyi ester;
  • R 22 is of formula Ilia, formula lllb or formula lllc:
  • A is a C5-7 aryl group
  • Q 1 is a single bond
  • Q 2 is selected from a single bond and -Z-(CH2)n-, where Z is selected from a single bond, O, S and NH and n is from 1 to 3;
  • Q is selected from 0-R L2' , S-R L2' and R N -R L2' , and R N is selected from H, methyl and ethyl
  • R N is selected from the group comprising H and C1-4 alkyl
  • R' 2' is a linker for connection to the antibody (Ab);
  • R 10 and R 11 either together form a double bond between the nitrogen and carbon atoms to which they are bound or;
  • R 10 is H and R 1 1 is selected from OH, OR A and SO z M;
  • R 30 and R 31 either together form a double bond between the nitrogen and carbon atoms to which they are bound or;
  • R 30 is H and R 31 is selected from OH, OR A and SO z M.
  • L-R 1 1 or L-R 12' is a group:
  • Ab is the antibody
  • LJ is a cleavable linker
  • A is a connecting group connecting L 1 to the antibody
  • L 1 is enzyme cleavable.
  • anti-CD22-ADC may include any embodiment described in WO2014/057122.
  • the ADC may have the chemical structure:
  • the antibody component of the anti-CD22 ADC is the antibody component of the anti-CD22 ADC
  • the antibody may comprise an amino acid substitution of an interchain cysteine residue by an amino acid that is not cysteine, wherein the conjugation of the drug moiety to the antibody is at an interchain cysteine residue
  • the antibody preferably comprises: (i) a heavy chain having an amino acid substitution of each of the interchain cysteine residues HC226 and HC229 according to the EU index as set forth in Kabat; (ii) a light chain having an amino acid substitution of the interchain cysteine residue KLC214 or ALC213 according to the EU index as set forth in Kabat; and (iii) a heavy chain retaining the unsubstituted interchain cysteine HC220 according to the EU index as set forth in Kabat.
  • the drug moiety is conjugated to the unsubstituted interchain cysteine HC220.
  • the interchain cysteine residues HC226 and HC229 may each be substituted for valine.
  • the interchain cysteine residues KLC214 or ALC213 may be substituted for serine.
  • the antibody of the conjugates described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO. 150, or fragment thereof, wherein the cysteine at position 105, if present, is substituted by an amino acid that is not cysteine.
  • SEQ ID NO. 151 discloses a light chain comprising the amino acid sequence of SEQ ID NO. 150 wherein the cysteine at position 105 is substituted by a serine residue.
  • the antibody of the conjugates described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO. 160, or fragment thereof, wherein the cysteine at position 102, if present, is substituted by an amino acid that is not cysteine.
  • SEQ ID NO. 161 discloses a light chain comprising the amino acid sequence of SEQ ID NO. 160 wherein the cysteine at position 102 is substituted by a serine residue.
  • the antibody comprises: (i) a heavy chain having an amino acid substitution of each of the interchain cysteine residues HC226 and HC229 according to the EU index as set forth in Kabat, optionally wherein HC226 and HC229 is each substituted for valine;
  • the antibody preferably further comprises a VH domain having the sequence according to SEQ ID NO. 13 and a VL domain having the sequence according to SEQ ID NO. 14.
  • the light chain may comprise the amino acid sequence of: (i) SEQ ID NO. 150, or fragment thereof, wherein the cysteine at position 105, if present, is substituted by an amino acid that is not cysteine (such as in SEQ ID NO. 151 ); or SEQ ID NO. 160, or fragment thereof, wherein the cysteine at position 102, if present, is substituted by an amino acid that is not cysteine (such as in SEQ ID NO. 161 ).
  • the antibody may comprise a heavy chain comprising the amino acid sequence of SEQ ID N0.1 10, and a light chain comprising the amino acid sequence of SEQ ID NO. 150 or SEQ ID NO. 160;
  • each of the cysteines at positions 109 and 1 12 in SEQ ID NO: 1 10 is substituted by an amino acid that is not cysteine;
  • cysteine at position 105 in SEQ ID NO: 150 or the cysteine at position 102 in SEQ ID NO: 160 is substituted by an amino acid that is not cysteine.
  • drug moiety is conjugated to the cysteine at position 103 of SEQ ID NO:
  • cysteines at positions 109 and 1 12 in SEQ ID NO: 1 10 are substituted for valine, such as in SEQ ID NO: 1 14.
  • cysteine at position 105 in SEQ ID NO: 150 or the cysteine at position 102 in SEQ ID NO: 160 is substituted by serine such as in SEQ ID NOs: 151 and 161 .
  • the antibody component of the anti-CD22-ADC is an antibody comprising: a VH domain having the sequence according to SEQ ID NO. 13.
  • the antibody may further comprise a VL domain having the sequence according to SEQ ID NO. 14.
  • the antibody comprises a VH domain having the sequence according to SEQ ID NO. 13 and a VL domain having the sequence according to SEQ ID NO. 14.
  • the antibody comprises:
  • VH domain having the sequence according to SEQ ID NO. 13;
  • VL domain having the sequence according to SEQ ID NO. 14.
  • the drug moiety is conjugated to the cysteine at position 103 of SEQ ID NO.1 14.
  • the antibody is a fully human monoclonal lgG1 antibody, preferably IgGI . K.
  • the antibody comprises a heavy chain having the sequence according to SEQ ID NO. 15 and a light chain having the sequence according to SEQ ID NO. 16.
  • the drug moiety is conjugated to the cysteine at position 219 of SEQ ID N0.15.
  • the antibody is an antibody as described herein which has been modified (or further modified) as described below.
  • the antibody is a humanised, deimmunised or resurfaced version of an antibody disclosed herein.
  • anti-CD22-ADC for use with the aspects of the present disclosure is ADCX22, as described herein below.
  • ADCX22 is an antibody drug conjugate composed of a human antibody against human CD22 attached to a pyrrolobenzodiazepine (PBD) warhead via a cleavable linker.
  • the mechanism of action of ADCX22 depends on CD22 binding.
  • the CD22 specific antibody targets the antibody drug conjugate (ADC) to cells expressing CD22.
  • ADC antibody drug conjugate
  • the ADC internalizes and is transported to the Iysosome, where the protease sensitive linker is cleaved and free PBD dimer is released inside the target cell.
  • the released PBD dimer inhibits transcription in a sequence-selective manner, due either to direct inhibition of RNA polymerase or inhibition of the interaction of associated transcription factors.
  • the PBD dimer produces covalent crosslinks that do not distort the DNA double helix and which are not recognized by nucleotide excision repair factors, allowing for a longer effective period (Hartley 201 1 ).
  • Ab represents Antibody EMabC220.
  • This antibody comprises a heavy chain having the sequence according to SEQ ID NO. 15 and a light chain having the sequence according to SEQ ID NO. 16. Linkage to the drug occurs on Heavy Chain interchain cysteine Cys220 (EU numbering).
  • HC220 corresponds to position 219 of SEQ ID NO.15.
  • the heavy chain of ADCx22 is expressed with an additional terminal 'K' residue (so, ending ...SPGK), with the terminal K being optionally removed post-translationally to improve the homogeneity of the final therapeutic ADC product.
  • the "first target protein” (FTP) as used herein may be CD22.
  • binds CD22 is used to mean the antibody binds CD22 with a higher affinity than a non-specific partner such as Bovine Serum Albumin (BSA, Genbank accession no. CAA76847, version no. CAA76847.1 GL3336842, record update date: Jan 7, 201 1 02:30 PM).
  • BSA Bovine Serum Albumin
  • the antibody binds CD22 with an association constant (K a ) at least 2, 3, 4, 5, 10, 20, 50, 100, 200, 500, 1000, 2000, 5000, 10 4 , 10 5 or 10 6 -fold higher than the antibody's association constant for BSA, when measured at physiological conditions.
  • the antibodies of the invention can bind CD22 with a high affinity.
  • the antibody can bind CD22 with KD equal to or less than about 10 "6 M, such as 1 x 10 "6 , 10 “7 , 10 10 “9 .10- 10 , 10 “11 , 10 “12 , 10 “13 or 10 14 .
  • CD22 polypeptide corresponds to Genbank accession no. BAB15489, version no. BAB15489.1 Gl:10439338, record update date: Sep 1 1 , 2006 1 1 :24 PM.
  • the nucleic acid encoding CD22 polypeptide corresponds to Genbank accession no AK026467, version no. AK026467.1 Gl:10439337, record update date: Sep 1 1 , 2006 1 1 :24 PM.
  • the ADC is well tolerated and active across a range of cancer types, and will likely be one component of combination therapies that increase the response rate and durability of treatment.
  • the purpose of this disclosure is to combine the ADC with the secondary agent.
  • a secondary agent as described herein may be an Immune-oncology (IO) drug.
  • IO Immune-oncology
  • Immune-oncology (IO) drugs a type of cancer therapy relying on the body's immune system to help fight cancer, have shown enhanced durability of anti-tumor response.
  • IO Immune-oncology
  • types of IO including but not limited to PD1 inhibitors, PD-L1 inhibitors, CLTL4 inhibitors, GITR agonists and OX40 agonists.
  • Immunogenic cell death is a particular form of cell death that stimulates an immune response against dead-cell antigens (released by dying cells) and it is considered as one of the best way to induce an adaptive immune response and improve the efficacy of anticancer treatment. This process is frequently suboptimal, calling for combinatorial strategies that attempt to restore the full immunogenicity of cell death for therapeutic purposes.
  • anti-neoplastic agents that can induce ICD such as various anthracyclines (including doxorubicin, epirubicin and idarubicin), alkylating agents (including oxaliplatin and cyclophosphamide), the topoisomerase II inhibitor mitoxantrone, and the proteasomal inhibitor Bortezomib.
  • Antibody-drug conjugates including those with a PBD warhead, may be particularly suited as combination partners because they are more targeted compared to conventional chemotherapy and expected to offer an increased antigen presentation to infiltrating cells as has been shown for auristatin-based ADCs.
  • ADCs with IO therefore allows for dual benefits: on the one hand, the ADC will directly kill the tumor expressing the target, providing immediate anti-tumor activity, and on the other the immunogenic cell death induced by ADC mediated cell kill may boost a stronger and more durable adaptive immune response, as compared to when the IO is given as a single agent.
  • the secondary agent may be:
  • a Bruton's Tyrosine Kinase inhibitor such as Ibrutinib (Imbruvica), Acalabrutinib/ACP-196, ONO/GS-4059, Spebrutinib/AVL-292/CC-292, HM71224 (Poseltinib) or BGB-31 1 1 (Zanubrutinib);
  • a PD1 antagonist such as pembrolizumab, nivolumab, MEDI0680, PDR001 (spartalizumab), Camrelizumab, AUNP12, Pidilizumab, Cemiplimab (REGN-
  • a PD-L1 antagonist such as atezolizumab (Tecentriq), BMS- 936559/MDX-1 105, durvalumab/MEDI4736, or MSB0010718C (Avelumab);
  • GITR Glucocorticoid-lnduced TNFR-Related protein
  • an OX40 agonist such as MEDI0562, MEDI6383, MOXR0916, RG7888, OX40mAb24, INCAGN1949, GSK3174998, or PF-04518600;
  • CTLA-4 antagonist such as ipilimumab (brand name Yervoy) or Tremelimumab (Originally developed by Pfizer, now Medimmune);
  • a hypomethylating agent such as cytidine analogs - for example, 5-azacytidine (azacitidine) and 5-aza-2'-deoxycytidine (decitabine);
  • an anti-CD20 agent such as rituximab, obinutuzumab, Ibritumomab tiuxetan, tositumomab, Ofatumumab, Ocaratuzumab, Ocrelizumab, and Veltuzumab.
  • an anti-CD20 agent such as rituximab, obinutuzumab, Ibritumomab tiuxetan, tositumomab, Ofatumumab, Ocaratuzumab, Ocrelizumab, and Veltuzumab.
  • BTK is a non-receptor tyrosine kinase indispensable for B lymphocyte development, differentiation and signalling. Binding of antigen to the B-cell antigen receptor (BCR) triggers signalling that ultimately leads to B-cell activation. After BCR engagement and activation at the plasma membrane, BTK phosphorylates PLCG2 at several sites, igniting the downstream signaling pathway through calcium mobilization, followed by activation of the protein kinase C (PKC) family members. PLCG2 phosphorylation is performed in close cooperation with the adapter protein B-cell linker protein BLNK [Yang et al., Proc. Natl. Acad. Sci. U.S.A.
  • BTK acts as a platform to bring together a diverse array of signalling proteins and is implicated in cytokine receptor signalling pathways. It plays an important role in the function of immune cells of innate as well as in adaptive immunity, as a component of the Toll-like receptors (TLR) pathway.
  • TLR Toll-like receptors
  • BTK Another key role for BTK is the regulation of TLR9 activation in splenic B-cells. Within the TLR pathway, BTK induces tyrosine phosphorylation of TIRAP which leads to TIRAP degradation.
  • BTK also plays also a critical role in transcription regulation as it is involved in the signalling pathway linking TLR8 and TLR9.
  • BTK activity induces the activity of NF-kappa- B, which is itself involved in regulating the expression of hundreds of genes.
  • Other transcriptional targets of BTK include ARID3A, NFAT and GTF2I; BTK is required for the formation of functional ARID3A DNA-binding complexes; whilst BTK's transient phosphorylatation of GTF2I causes it to translocate to the nucleus to bind regulatory enhancer elements to modulate gene expression [Rajaiya, Mol. Cell. Biol. 26:4758- 4768(2006)].
  • BTK has a dual role in the regulation of apoptosis.
  • BTK inhibitor means any chemical compound or biological molecule that inhibits the activity of BTK.
  • the BTK enzyme inhibitory activity may measured, based on the protocol provided by the manufacturer, using Btk (Invitrogen Corporation) and the Z'-LYTETM Kinase Assay Kit-Tyr1 peptide (Invitrogen Corporation), which contains the following reagents: Tyr-1 peptide, Thy- 1 phosphopeptide, 5x kinase buffer, ATP, development reagent B, development buffer, and stop reagent.
  • 5 ⁇ /well of a solution of a BTK inhibitor may be diluted with dimethyl sulfoxide (DMSO), or DMSO, and 10 ⁇ l/well of the substrate/enzyme mixture solution dispensed to a 96- well assay plate and a reaction carried out for 20 minutes at 30 C.
  • DMSO dimethyl sulfoxide
  • the substrate/enzyme mixture solution may be prepared by dilution with the kinase buffer (DL- dithiothreitol (DTT, 2.7 mM), 1.33x kinase buffer) to provide a final concentration for the Tyr- 1 peptide of 4 ⁇ and a final BTK concentration of 5 nM.
  • 10 ⁇ ., of a development solution provided by diluting the development reagent B to 128x using the development buffer, may be added and a reaction carried out for an additional 1 hour at 30 C.
  • the enzymatic reaction can then be stopped by adding 10 ⁇ ., of the stop solution.
  • the fluorescence intensity at 445 nm and 520 nm in each well may be measured using a Fusion Universal Microplate Analyzer (PerkinElmer Inc.) fluorescence plate reader.
  • the percent phosphorylation may be determined using the ratio of the emission at 445 nm (coumarin emission) to the emission at 520 nm (fluorescein emission) in accordance with the protocol provided with the kit.
  • the 50% inhibition value (IC50 value) for a BTK inhibitor may be determined from the inhibition curve based on the % inhibition at each concentration of a BTK inhibitor.
  • the BTKi Ibrutinib (Imbruvica) is a small molecule drug that covalently binds to Bruton's tyrosine kinase (BTK) and has been used to treat B-celi cancers like mantle cell lymphoma, chronic lymphocytic leukemia, and Waldenstrom's macroglobulinemia, a form of non- Hodgkin's lymphoma.
  • BTK Bruton's tyrosine kinase
  • Ibrutinib has been reported to reduce chronic lymphocytic leukemia (CLL) cell chemotaxis towards the chemokines CXCL12 and CXCL13, and inhibit cellular adhesion following stimulation at the B cell receptor (BCR) (S Ponader et al. 201 1 , doi:10.1 182/blood-201 1 - 10-386417. PMID 22180443.) Additionally, ibrutinib down-modulates the expression of CD20 by targeting the CXCR4/SDF1 axis (Pavlasova 2016, PMID 274801 13. Together, these data are consistent with a mechanistic model whereby ibrutinib blocks BCR signalling, which drives B-cells into apoptosis and/or disrupts cell migration and adherence to protective tumour microenvironments.
  • CLL chronic lymphocytic leukemia
  • CLL chronic lymphocytic leukemia
  • ibrutinib has been reported to promote apoptosis, inhibit proliferation, and also prevent CLL cells from responding to survival stimuli provided by the microenvironment (Pavlasova 2016). This also leads to a reduction of Mcl1 levels (anti-apoptotic protein) in malignant B cells.
  • Treatment of activated CLL cells with ibrutinib resulted in inhibition of BTK tyrosine phosphorylation and also effectively abrogated downstream survival pathways activated by this kinase including ERK1/2, PI3K, and NF- ⁇ .
  • ibrutinib inhibited proliferation of CLL cells in vitro, effectively blocking survival signals provided externally to CLL cells from the microenvironment including soluble factors (CD40L, BAFF, IL-6, IL-4, and TNF- a), fibronectin engagement and stromal cell contact.
  • soluble factors CD40L, BAFF, IL-6, IL-4, and TNF- a
  • an ADC which targets a first target protein (FTP) with a BTKi is advantageous, because on the one hand, the ADC will directly kill the FTP positive tumor cells, while on the other hand the BTKi will interact with malignant B-cells resulting in inhibition of proliferation of the cancer cells.
  • FTP first target protein
  • BTKi will interact with malignant B-cells resulting in inhibition of proliferation of the cancer cells.
  • FTP negative tumor cells in close proximity to FTP(+) tumor cells will potentially be killed by the bystander mechanism of the PBD-dimer released after cell kill of FTP(+) cells.
  • the ADC will directly kill the tumor cells.
  • BTKi reduces tumour cell mobility and tips the regulatory balance in these cells more towards apoptosis. It is believed that these changes induced by the BTKi will make the tumour cells more susceptible to direct and indirect ADC medicated killing.
  • a panel of FTP (+) cell lines will be co-treated with a range of concentration of both ADC and BTK1.
  • the same panel of cell lines will be treated with a range of concentrations of BTKi or with a range of concentration of ADC and vehicle.
  • two parameters will be measured: the amount of surface FTP (as determined by flow cytometry) and the in vitro cytotoxicity of the combinations (as determined by MTS assays).
  • MTS assays MTS assays
  • Cytotoxic synergy is calculated by transforming the cell viability data into fraction affected, and calculating the combination index using the CalcuSyn analysis program.
  • BTKi suitable for use as secondary agents in the present disclosure include:
  • Preferred BTK inhibitors for use as secondary agents in the present disclosure include (Ibrutnib being most preferred):
  • Ibrutinib 1 -[(3R)-3-[4-Amino-3-(4-phenoxyphenyl)-1 H-pyrazolo[3,4-d]pyrimidin- 1 -yl]piperidin-1 -yl]prop-2-en-1 -one b) Acalabrutinib/ACP-196
  • Zanubrutinib (7S)-4,5,6,7-Tetrahydro-7-[1 -(1 -oxo-2-propen-1-yl)-4- piperidinyl]-2-(4-phenoxyphenyl)pyrazolo[1 ,5-a]pyrimidine-3-carboxamide f) HM71224 (Poseltinib)
  • BTK polypeptide corresponds to Genbank accession no. CAA41728, version no. CAA41728.1 , record update date: Feb 2, 201 1 10:07 AM.
  • the nucleic acid encoding BTK polypeptide corresponds to Genbank accession no. X58957, version no. X58957.1 , record update date: Feb 2, 201 1 10:07 AM.
  • BTK polypeptide corresponds to Uniprot/Swiss-Prot accession No. Q06187.
  • Programmed death receptor I is an immune-inhibitory receptor that is primarily expressed on activated T and B cells. Interaction with its ligands has been shown to attenuate T-cell responses both in vitro and in vivo. Blockade of the interaction between PD1 and one of its ligands, PD-L1 , has been shown to enhance tumor-specific CD8+ T- cell immunity and may therefore be helpful in clearance of tumor cells by the immune system.
  • PD1 (encoded by the gene Pdcdl) is an Immunoglobulin superfamily member related to CD28, and CTLA-4. PD1 has been shown to negatively regulate antigen receptor signalling upon engagement of its ligands (PD-L1 and/or PD-L2). The structure of murine PD1 has been solved as well as the co-crystal structure of mouse PD1 with human PD-L1
  • PD1 and like family members are type I transmembrane glycoproteins containing an Ig Variable-type (V-type) domain responsible for ligand binding and a cytoplasmic tail that is responsible for the binding of signaling molecules.
  • the cytoplasmic tail of PD1 contains two tyrosine-based signaling motifs, an ITIM (immunoreceptor tyrosine- based inhibition motif) and an ITSM (immunoreceptor tyrosine-based switch motif).
  • PD1 on tumor infiltrating lymphocytes
  • PD-L1 on tumor cells
  • Such tissues include cancers of the lung, liver, ovary, cervix, skin, colon, glioma, bladder, breast, kidney, esophagus, stomach, oral squamous cell, urothelial cell, and pancreas as well as tumors of the head and neck (Brown, J. A., et al., (2003) J Immunol. I 70: I257-I266; Dong H., et al., (2002) Nat. Med.
  • Antibody blockade effectively promoted tumor reactive CD8+ T cell infiltration into the tumor resulting in the up-regulation of anti-tumor effectors including I FN gamma, granzyme Band perforin. Additionally, the authors showed that PD1 blockade can be effectively combined with chemotherapy to yield a synergistic effect.
  • antibody blockade of PD1 or PD-L1 significantly inhibited tumor growth (Tsushima, F., et al., (2006) Oral Oneal. 42: 268-274).
  • PD1 antagonist means any chemical compound or biological molecule that stimulates an immune reaction through inhibition of PD1 signalling.
  • samples or assays comprising a given, e.g., protein, gene, cell, or organism, are treated with a potential activating or inhibiting agent and are compared to control samples treated with an inactive control molecule. Control samples are assigned a relative activity value of 100%.
  • Inhibition is achieved when the activity value relative to the control is about 90% or less, typically 85% or less, more typically 80% or less, most typically 75% or less, generally 70% or less, more generally 65% or less, most generally 60% or less, typically 55% or less, usually 50% or less, more usually 45% or less, most usually 40% or less, preferably 35% or less, more preferably 30% or less, still more preferably 25% or less, and most preferably less than 20%.
  • Activation is achieved when the activity value relative to the control is about 1 10%, generally at least 120%, more generally at least 140%, more generally at least 160%, often at least 180%, more often at least 2-fold, most often at least 2.5-fold, usually at least 5-fold, more usually at least 10-fold, preferably at least 20-fold, more preferably at least 40-fold, and most preferably over 40-fold higher.
  • an ADC which targets a first target protein (FTP) with PD1 inhibitors is advantageous, because on the one hand, the ADC will directly kill the FTP positive tumor cells, while on the other hand the PD1 inhibitor will engage the patient's own immune system to eliminate the cancer cells.
  • FTP first target protein
  • the PD1 inhibitor will engage the patient's own immune system to eliminate the cancer cells.
  • FTP(+) tumor cells FTP negative tumor cells in close proximity to FTP(+) tumor cells will potentially be killed by the bystander mechanism of the PBD-dimer released after cell kill of CD25(+) cells.
  • the ADC will directly kill the tumor cells.
  • PD1 programmed cell death protein 1
  • TILs tumour infiltrating lymphocytes
  • PD1 The major function of PD1 is to limit the activity of T-cells at the time of an anti-inflammatory response to infection and to limit autoimmunity. PD1 expression is induced when T-cells become activated, and binding of one of its own ligands inhibits kinases involved in T-cell activation. Hence, in the tumor environment this may translate into a major immune resistance, because many tumours are highly infiltrated with TReg cells that probably further suppress effector immune responses. This resistance mechanism is alleviated by the use of PD1 inhibitors in combination with the ADC.
  • PD1 antagonists suitable for use as secondary agents in the present disclosure include: a) a PD1 antagonist which inhibits the binding of PD1 to its ligand binding partners. b) a PD1 antagonist which inhibits the binding of PD1 to PD- L1 .
  • a PD1 antagonist which inhibits the binding of PD-1 to PDL2.
  • a PD1 antagonist which inhibits the binding of PD-1 to both PDLI and PDL2.
  • PD1 antagonists suitable for use as secondary agents in the present disclosure include:
  • pembrolizumab brand name Keytruda
  • PD1 polypeptide corresponds to Genbank accession no. AAC51773, version no. AAC51773.1 , record update date: Jun 23, 2010 09:24 AM.
  • the nucleic acid encoding PD1 polypeptide corresponds to Genbank accession no. U64863, version no. U64863.1 , record update date: Jun 23, 2010 09:24 AM.
  • PD1 polypeptide corresponds to Uniprot/Swiss-Prot accession No. Q151 16.
  • PD-L1 antagonist means any chemical compound or biological molecule that stimulates an immune reaction through inhibition of PD-L1 signalling.
  • samples or assays comprising a given, e.g., protein, gene, cell, or organism, are treated with a potential activating or inhibiting agent and are compared to control samples treated with an inactive control molecule. Control samples are assigned a relative activity value of 100%.
  • Inhibition is achieved when the activity value relative to the control is about 90% or less, typically 85% or less, more typically 80% or less, most typically 75% or less, generally 70% or less, more generally 65% or less, most generally 60% or less, typically 55% or less, usually 50% or less, more usually 45% or less, most usually 40% or less, preferably 35% or less, more preferably 30% or less, still more preferably 25% or less, and most preferably less than 20%.
  • Activation is achieved when the activity value relative to the control is about 1 10%, generally at least 120%, more generally at least 140%, more generally at least 160%, often at least 180%, more often at least 2-fold, most often at least 2.5-fold, usually at least 5-fold, more usually at least 10-fold, preferably at least 20-fold, more preferably at least 40-fold, and most preferably over 40-fold higher.
  • an ADC which targets a first target protein (FTP) positive lymphomas and leukemias with PD-L1 inhibitors is advantageous because, on the one hand, the ADC will directly kill the FTP positive tumor cells while, on the other hand, the PD-L1 inhibitor will engage the patient's own immune system to eliminate the cancer cells.
  • FTP first target protein
  • target negative tumor cells in close proximity to FTP(+) tumor cells will potentially be killed by the bystander mechanism of the PBD-dimer released after cell kill of FTP(+) cells.
  • the ADC will directly kill the tumor cells.
  • the resulting release of tumor associated antigens from cells that are killed with the PBD dimer will trigger the immune system, which will be further enhanced by the use of programmed cell death protein 1 ligand inhibitors (PD-L1 , aka B7-H1 or CD274 ).
  • PD-L1 is commonly upregulated on the tumour cell surface from many different human tumours. Interfering with the PD1 ligand expressed on the tumor will avoid the immune inhibition in the tumor microenvironment and therefore blockade of the PD1 pathway using PDL1 inhibitors may enhance antitumour immune responses against the antigens released from the tumors killed by the ADC.
  • PDL1 inhibitors may enhance antitumour immune responses against the antigens released from the tumors killed by the ADC.
  • FTP first target protein
  • FTP negative tumor cells in close proximity to FTP(+) tumor cells will potentially be killed by the bystander mechanism of the PBD-dimer released after cell kill of CD19(+) or CD22 (+) cells. Hence, the ADC will directly kill the tumor cells.
  • PD-L1 antagonists suitable for use as secondary agents in the present disclosure include PD-L1 antagonists that:
  • (e) are anti-PD-L1 antibodies.
  • Specific PD-L1 antagonists suitable for use as secondary agents in the present disclosure include:
  • VH CDR1 DYGFS
  • VH CDR2 WITAYNGNTNYAQKLQG
  • VH CDR3 DYFYGMDV d.
  • VL CDR1 RASQSVSSYLV
  • VL CDR2 DAS N RAT
  • VL CDR3 QQRSNWPRT
  • Antibody having:
  • VH CDR1 TYAIS
  • VH CDR2 GIIPIFGKAHYAQKFQG
  • VH CDR3 KFHFVSGSPFGMDV
  • VL CDR1 RASQSVSSYLA
  • VL CDR2 DASNRAT
  • VL CDR3 QQRSNWPT
  • Antibody having:
  • VH CDR1 SYDVH
  • VH CDR2 WLHADTGITKFSQKFQG
  • VH CDR3 ERIQLWFDY
  • VL CDR1 RASQGISSWLA
  • VL CDR2 AASSLQS
  • VL CDR3 QQYNSYPYT c) durvalumab/MEDI4736
  • PD-L1 polypeptide corresponds to Genbank accession no. AAF25807, version no. AAF25807.1 , record update date: Mar 10, 2010 10:14 PM.
  • the nucleic acid encoding PD1 polypeptide corresponds to Genbank accession no. AF177937, version no. AF177937.1 , record update date: Mar 10, 2010 10: 14 PM.
  • PD1 polypeptide corresponds to Uniprot/Swiss-Prot accession No. Q9NZQ7.
  • glucose-induced TNF receptor (abbreviated herein as
  • GITR also known as TNF receptor superfamily 18 (TNFRSF18, CD357), TEASR, and 312C2, as used herein, refers to a member of the tumor necrosis factor/nerve growth factor receptor family.
  • GITR is a 241 amino acid type I transmembrane protein characterized by three cysteine pseudo-repeats in the extracellular domain and specifically protects T-cell receptorinduced apoptosis, although it does not protect cells from other apoptotic signals, including Fas triggering, dexamethasone treatment, or UV irradiation (Nocentini, G., et al. (1997) Proc. Natl. Acad. Sci. USA 94:6216-622).
  • GITR activation increases resistance to tumors and viral infections, is involved in autoimmune/inflammatory processes and regulates leukocyte extravasation (Nocentini supra; Cuzzocrea, et al. (2004) J Leukoc. Biol. 76:933-940; Shevach, et al. (2006) Nat. Rev. Immunol. 6:613-618; Cuzzocrea, et al. (2006) J Immunol. I 77:631-641; and Cuzzocrea, et al. (2007) FASEB J 21 :l I 7-129).
  • hGITR human GITR
  • GenBank Accession Nos. gi:40354198, gi:23238190, gi:23238193, and gi:23238196 GenBank Accession Nos. gi:40354198, gi:23238190, gi:23238193, and gi:23238196.
  • GITR agonist means any chemical compound or biological molecule that stimulates an immune reaction through activation of GITR signalling. Also contemplated are soluble GITR-L proteins, a GITR binding partner. To examine the extent of enhancement of, e.g., GITR activity, samples or assays comprising a given, e.g., protein, gene, cell, or organism, are treated with a potential activating or inhibiting agent and are compared to control samples treated with an inactive control molecule. Control samples are assigned a relative activity value of 100%.
  • Inhibition is achieved when the activity value relative to the control is about 90% or less, typically 85% or less, more typically 80% or less, most typically 75% or less, generally 70% or less, more generally 65% or less, most generally 60% or less, typically 55% or less, usually 50% or less, more usually 45% or less, most usually 40% or less, preferably 35% or less, more preferably 30% or less, still more preferably 25% or less, and most preferably less than 20%.
  • Activation is achieved when the activity value relative to the control is about 1 10%, generally at least 120%, more generally at least 140%, more generally at least 160%, often at least 180%, more often at least 2-fold, most often at least 2.5-fold, usually at least 5-fold, more usually at least 10-fold, preferably at least 20-fold, more preferably at least 40-fold, and most preferably over 40-fold higher.
  • an ADC which targets a first target protein (FTP) positive lymphomas and leukemias with GITR agonists is advantageous, because on the one hand the ADC will directly kill the FTP positive tumor cells, while on the other hand the GITR agonist will engage the patient's own immune system to eliminate the cancer cells.
  • FTP target protein
  • target negative tumor cells in close proximity to FTP(+) tumor cells will potentially be killed by the bystander mechanism of the PBD-dimer released after cell kill of FTP(+) cells.
  • the ADC will directly kill the tumor.
  • the resulting release of tumor associated antigens from cells killed with the PBD dimer will trigger the immune system, which will be further enhanced by the use of a GITR agonist.
  • GITR Glucocorticoid-lnduced TNFR-Related protein
  • Iigand GITRL stimulates both proliferation and function of both effector and regulatory CD4+ T cells. This promotes T-cell survival, and differentiation into effector cells, while abrogating suppression. Therefore it will be beneficial to target a FTP(+) tumor with the ADC, causing the antigenic cell death, while the GITR agonist induces a stronger, durable immune response.
  • GITR agonists suitable for use as secondary agents in the present disclosure include:
  • INCAGN1876 is an agonist antibody targeting the glucocorticoid-induced TNFR- related protein, or GITR. Discovered during a collaboration with Ludwig Cancer Research. INCAGN1876 is being co-developed with
  • ⁇ VL comprising the sequence (CDR underline): EIVMTQSPATLSVSPGERATLSCKASQNVGTNVAWYQQKPG
  • VH comprising the sequence (CDR underline):
  • GWN323 an anti-GITR agonistic monoclonal antibody, which activates GITRs found on multiple types of T-cells. GWN323 is developed by Novartis
  • MK-1248 a humanized lgG4 anti-human glucocorticoid-induced tumor necrosis factor receptor (GITR) agonistic monoclonal antibody (MoAb) with significantly reduced effector function
  • MK-4166 a humanized IgGi anti-human glucocorticoid-induced tumor necrosis factor receptor (GITR) agonistic monoclonal antibody (MoAb) with potential immunomodulating activity (see Sukumar et al., Cancer Res. 2017).
  • GITR glucocorticoid-induced tumor necrosis factor receptor
  • GTR tumor necrosis factor superfamily member 18
  • TNFRSF18 tumor necrosis factor receptor
  • GITR polypeptide corresponds to Genbank accession no. AAD22635, version no. AAD22635.1 , record update date: Mar 10, 2010 09:42 PM.
  • the nucleic acid encoding GITR polypeptide corresponds to Genbank accession no. AF125304, version no. AF125304.1 , record update date: Mar 10, 2010 09:42 PM.
  • GITR polypeptide corresponds to Uniprot/Swiss-Prot accession No. Q9Y5U5. OX40 agonists
  • OX40 (CD134; TNFRSF4) is a member of the TNFR super-family and is expressed by CD4 and CD8 T cells during antigen-specific priming. OX40 expression is largely transient following TCR/CD3 cross-linking, and by the presence of inflammatory cytokines. In the absence of activating signals, relatively few mature T cell subsets express OX40 at biologically relevant levels. Generating optimal "killer" CD8 T cell responses requires T cell receptor activation plus co-stimulation, which can be provided through ligation of OX40 using a OX40 agonist. This activating mechanism augments T cell differentiation and cytolytic function leading to enhanced anti-tumor immunity. Therefore it will be beneficial to target a FTP(+) tumor with the ADC, causing the antigenic cell death, while the OX40 agonist induces a stronger, durable immune response.
  • the OX40 agonist may be selected from the group consisting of an OX40 agonist antibody, an OX40L agonist fragment, an OX40 oligomeric receptor, and an OX40 immunoadhesin.
  • the OX40 binding agonist is a trimeric OX40L-Fc protein.
  • the OX40 binding agonist is an OX40L agonist fragment comprising one or more extracellular domains of OX40L.
  • the OX40 binding agonist is an OX40 agonist antibody that binds human OX40.
  • the OX40 agonist antibody depletes cells that express human OX40.
  • the OX40 agonist antibody depletes cells that express human OX40 in vitro.
  • the cells are CD4+ effector T cells.
  • the cells are Treg cells.
  • the depleting is by ADCC and/or phagocytosis. In some embodiments, the depleting is by ADCC.
  • the OX40 agonist antibody binds human OX40 with an affinity of less than or equal to about 1 nM. In some embodiments, the OX40 agonist antibody increases CD4+ effector T cell proliferation and/or increasing cytokine production by the CD4+ effector T cell as compared to proliferation and/or cytokine production prior to treatment with anti-human OX40 agonist antibody. In some embodiments, the cytokine is gamma interferon. In some embodiments, the OX40 agonist antibody increases memory T cell proliferation and/or increasing cytokine production by the memory cell. In some embodiments, the cytokine is gamma interferon. In some embodiments, the OX40 agonist antibody inhibits Treg function.
  • the OX40 agonist antibody inhibits Treg suppression of effector T cell function.
  • effector T cell function is effector T cell proliferation and/or cytokine production.
  • the effector T cell is a CD4+ effector T cell.
  • the OX40 agonist antibody increases OX40 signal transduction in a target cell that expresses OX40.
  • OX40 signal transduction is detected by monitoring NFkB downstream signalling.
  • ⁇ 40 agonist means any chemical compound or biological molecule that stimulates an immune reaction through iactivation of OX40 signalling.
  • samples or assays comprising a given, e.g., protein, gene, cell, or organism, are treated with a potential activating or inhibiting agent and are compared to control samples treated with an inactive control molecule. Control samples are assigned a relative activity value of 100%.
  • Inhibition is achieved when the activity value relative to the control is about 90% or less, typically 85% or less, more typically 80% or less, most typically 75% or less, generally 70% or less, more generally 65% or less, most generally 60% or less, typically 55% or less, usually 50% or less, more usually 45% or less, most usually 40% or less, preferably 35% or less, more preferably 30% or less, still more preferably 25% or less, and most preferably less than 20%.
  • Activation is achieved when the activity value relative to the control is about 1 10%, generally at least 120%, more generally at least 140%, more generally at least 160%, often at least 180%, more often at least 2-fold, most often at least 2.5-fold, usually at least 5-fold, more usually at least 10-fold, preferably at least 20-fold, more preferably at least 40-fold, and most preferably over 40-fold higher.
  • an ADC which targets a first target protein (FTP) positive lymphomas and leukemias with OX40 agonists is advantageous, because on the one hand the ADC will directly kill the FTP positive tumor cells, while on the other hand the OX40 agonist will engage the patient's own immune system to eliminate the cancer cells.
  • FTP target protein
  • target negative tumor cells in close proximity to FTP(+) tumor cells will potentially be killed by the bystander mechanism of the PBD-dimer released after cell kill of FTP(+) cells.
  • the ADC will directly kill the tumor.
  • the resulting release of tumor associated antigens from cells killed with the PBD dimer will trigger the immune system, which will be further enhanced by the use of a OX40 agonist.
  • OX40 agonists suitable for use as secondary agents in the present disclosure include:
  • MEDI0562 (aka Tavolixizumab, Tavolimab)
  • OX40mAb24 is a humanised version of 9B12.
  • 9B12 is a murine IgGI, anti- OX40 mAb directed against the extracellular domain of human OX40 (CD134) (Weinberg, A.D., et al. J Immunother 29, 575-585 (2006)).
  • an antibody comprising the sequences:
  • PF-04518600 (PF-8600) is an investigational, fully human, monoclonal antibody (mAb) that targets OX40 protein
  • OX40 polypeptide corresponds to Genbank accession no. CAA53576, version no. CAA53576.1 , record update date: Feb 2, 201 1 10:10 AM.
  • the nucleic acid encoding OX40 polypeptide corresponds to Genbank accession no. X75962, version no. X75962.1 , record update date: Feb 2, 201 1 10:10 AM.
  • OX40 polypeptide corresponds to Uniprot/Swiss-Prot accession No. P43489.
  • CTLA4 (CD152) is expressed on activated T cells and serves as a co-inhibitor to keep T cell responses in check following CD28-mediated T cell activation.
  • CTLA4 is believed to regulate the amplitude of the early activation of naive and memory T cells following TCR engagement and to be part of a central inhibitory pathway that affects both antitumor immunity and autoimmunity.
  • CTLA4 is expressed exclusively on T cells, and the expression of its ligands CD80 (B7.1 ) and CD86 (B7.2), is largely restricted to antigen-presenting cells, T cells, and other immune mediating cells.
  • Antagonistic anti-CTLA4 antibodies that block the CTLA4 signalling pathway have been reported to enhance T cell activation.
  • ipilimumab was approved by the FDA in 201 1 for the treatment of metastatic melanoma.
  • Another anti-CTLA4 antibody, tremelimumab was tested in phase III trials for the treatment of advanced melanoma, but did not significantly increase the overall survival of patients compared to the standard of care (temozolomide or dacarbazine) at that time.
  • CTLA4 agonist means any chemical compound or biological molecule that stimulates an immune reaction through inhibition of CTLA4 signalling.
  • samples or assays comprising a given, e.g., protein, gene, cell, or organism, are treated with a potential activating or inhibiting agent and are compared to control samples treated with an inactive control molecule. Control samples are assigned a relative activity value of 100%.
  • Inhibition is achieved when the activity value relative to the control is about 90% or less, typically 85% or less, more typically 80% or less, most typically 75% or less, generally 70% or less, more generally 65% or less, most generally 60% or less, typically 55% or less, usually 50% or less, more usually 45% or less, most usually 40% or less, preferably 35% or less, more preferably 30% or less, still more preferably 25% or less, and most preferably less than 20%.
  • Activation is achieved when the activity value relative to the control is about 1 10%, generally at least 120%, more generally at least 140%, more generally at least 160%, often at least 180%, more often at least 2-fold, most often at least 2.5-fold, usually at least 5-fold, more usually at least 10-fold, preferably at least 20-fold, more preferably at least 40-fold, and most preferably over 40-fold higher.
  • an ADC which targets a first target protein (FTP) positive lymphomas and leukemias with CTLA4 inhibitors is advantageous, because on the one hand, the ADC will directly kill the FTP positive tumor cells, while on the other hand the CTLA4 inhibitor will engage the patient's own immune system to eliminate the cancer cells.
  • FTP target protein
  • target negative tumor cells in close proximity to FTP(+) tumor cells will potentially be killed by the bystander mechanism of the PBD-dimer released after cell kill of FTP(+) cells. Hence, the ADC will directly kill the tumor.
  • TILs tumour infiltrating lymphocytes
  • CTLA4 The major function of CTLA4 (CD152) is to regulate the amplitude of the early stages of T cell activation, and as such it counteracts the activity of the T cell co-stimulatory receptor, CD28, In the tumor microenvironment. Blockade of the CTLA4 pathway may therefore enhance enhancement of effector CD4+T cell activity, while it inhibits TReg cell-dependent immunosuppression. Therefore it will be beneficial to target a FTP(+) tumor with the ADC, causing the antigenic cell death, while the CTLA4 blockade induces a stronger immune, durable response.
  • CTLA4 antagonists suitable for use as secondary agents in the present disclosure include:
  • CTLA polypeptide corresponds to Genbank accession no. AAL07473, version no. AAL07473.1 , record update date: Mar 1 1 , 2010 01 :28 AM .
  • the nucleic acid encoding CTLA4 polypeptide corresponds to Genbank accession no. AF414120, version no. AF414120.1 , record update date: Mar 1 1 , 2010 01 :28 AM .
  • OX40 polypeptide corresponds to Uniprot/Swiss- Prot accession No. P16410.
  • Combination of agents with different action mechanisms is an established therapeutic principle for combating cancer. It can be a way of increasing anti-tumour activity when a synergic effect is shown and/or when reduced toxicity is observed.
  • Antibody-drug conjugates including those with a PBD warhead, may be particularly suited as combination partners because they are more targeted compared to conventional chemotherapy.
  • PBD dimers cross-link DNA in a covalent fashion, combining them with other agents that interfere with DNA synthesis via a different mechanism is likely to provide a benefit. Examples of such potential combinations are Fiudarabine and Cytarabine.
  • Fiudarabine or fiudarabine phosphate is a chemotherapy drug used in the treatment of hematological malignancies such as leukemias and lymphomas. It is a purine analog, which interferes with DNA by interfering with ribonucleotide reductase (RNAR) and DNA polymerase. It is active against both dividing and resting cells. Fiudarabine has also been shown to suppress ERCC1 transcription and this may explain the observed synergy between Fiudarabine and the PBD Dimer SJG136 (SG2000) against chronic lymphocytic leukaemia cells.
  • CLAG/CLAG-M Cladribine is another purine analogue that inhibits RNR.
  • the ADC which targets First Target Protein (FTP) positive lymphomas and leukemias
  • FTP First Target Protein
  • the ADC will directly kill the FTP positive tumor cells via a mechanisms depending on DNA cross-linking resulting in apoptosis, while on the other hand the Fiudarabine will inhibit the cells RNA and DNA polymerase, while also suppressing the DNA repair enzymes needed to resolve the DNA cross-links induced by the PBD dimer.
  • FTP First Target Protein
  • a panel of FTP(+) cell lines will be co-treated with a range of concentration of both the ADC and Fiudarabine.
  • the same panel of cell lines will be co-treated with a range of concentrations of Fiudarabine and a non-targeted control ADC or with a range of concentration of the ADC and vehicle.
  • two parameters will be measured: the amount of surface FTP (as determined by flow cytometry) and the in vitro cytotoxicity of the combinations (as determined by CellTiter-Glo® or MTS assays). Cytotoxic synergy is calculated by transforming the cell viability data into fraction affected, and calculating the combination index using the CalcuSyn analysis program.
  • Cytarabine or cytosine arabinoside is a antimetabolic chemotherapy drug used in the treatment of hematological malignancies such as acute myeloid leukemia (AML) and non-Hodgkin lymphoma. It is also known as ara-C (arabinofuranosyl cytidine). It kills cancer cells by interfering with DNA synthesis. It is actively metabolized to cytosine arabinoside triphosphate, which damages DNA when the cell cycle holds in the S phase (synthesis of DNA). Rapidly dividing cells, which require DNA replication for mitosis, are therefore most affected.
  • Cytosine arabinoside also inhibits both DNA and RNA polymerases and nucleotide reductase enzymes needed for DNA synthesis.
  • Combining the ADC, which targets First Target Protein (FTP) positive lymphomas and leukemias, with Cytarabine is advantageous, because on the one hand, the ADC will directly kill the FTP positive tumor cells via a mechanisms depending on DNA cross-linking resulting in apoptosis, while on the other hand the Cytarabine will inhibit the cells RNA and DNA polymerase, while also suppressing DNA synthesis.
  • FTP First Target Protein
  • a panel of FTP(+) cell lines will be co-treated with a range of concentration of both the ADC and Cytarabine.
  • the same panel of cell lines will be co-treated with a range of concentrations of Cytarabine and a non-targeted control ADC or with a range of concentration of the ADC and vehicle.
  • two parameters will be measured: the amount of surface FTP (as determined by flow cytometry) and the in vitro cytotoxicity of the combinations (as determined by CellTiter-Glo® or MTS assays). Cytotoxic synergy is calculated by transforming the cell viability data into fraction affected, and calculating the combination index using the CalcuSyn analysis program).
  • hypomethylating agent refers to a class of compounds that interfere with DNA methylation which is the addition of a methyl group to the 5- position of the cytosine pyrimidine ring or the nitrogen in position 6 of the adenine purine ring.
  • DNA methylation stably alters the gene expression pattern in cells i.e. decrease gene expression (i.e. for the Vitamin D receptor).
  • Hypomethylating agent are compounds that can inhibit methylation, resulting in the expression of the previously hypermethylated silenced genes.
  • Cytidine analogs such as 5-aza cytidine (azacitidine) and 5-aza-2'-deoxycytidine (decitabine are the most commonly used Hypomethylating agent. These compounds work by binding to the enzymes that catalyse the methylation reaction, i.e. DNA methyltransferases.
  • samples or assays comprising a given, e.g., protein, gene, cell, or organism, are treated with a potential activating or inhibiting agent and are compared to control samples treated with an inactive control molecule.
  • Control samples are assigned a relative activity value of 100%. Inhibition is achieved when the activity value relative to the control is about 90% or less, typically 85% or less, more typically 80% or less, most typically 75% or less, generally 70% or less, more generally 65% or less, most generally 60% or less, typically 55% or less, usually 50% or less, more usually 45% or less, most usually 40% or less, preferably 35% or less, more preferably 30% or less, still more preferably 25% or less, and most preferably less than 20%.
  • Activation is achieved when the activity value relative to the control is about 1 10%, generally at least 120%, more generally at least 140%, more generally at least 160%, often at least 180%, more often at least 2-fold, most often at least 2.5-fold, usually at least 5-fold, more usually at least 10-fold, preferably at least 20-fold, more preferably at least 40-fold, and most preferably over 40-fold higher.
  • an ADC which targets a first target protein (FTP) positive lymphomas and leukemias with a hypomethylating agent is advantageous, because on the one hand the ADC will directly kill the FTP positive tumor cells, while on the other hand the a hypomethylating agent will interfere with DNA methylation. This interference is by way of causing demethylation in that sequence, which adversely affects the way that cell regulatory proteins are able to bind to the DNA RNA substrate. This activity synergises with the ADC because PBD dimers cross-link DNA in a covalent fashion, so combining them with other agents that interfere with DNA synthesis via a different mechanism provides a benefit.
  • FTP first target protein
  • Specific Hypomethylating agents suitable for use as secondary agents in the present disclosure include:
  • An agent that "upregulates HER2 expression” means any chemical compound or biological molecule that increase the amount of HER2 protein on a tumour cell surface.
  • enhancement samples or assays comprising a given, e.g., protein, gene, cell, or organism, are treated with a potential activating agent and are compared to control samples treated with an inactive control molecule.
  • Control samples are assigned a relative expression value of 100%. Activation is achieved when the expression value relative to the control is about 1 10%, generally at least 120%, more generally at least 140%, more generally at least 160%, often at least 180%, more often at least 2 -fold, most often at least 2.5-fold, usually at least 5-fold, more usually at least 10- fold, preferably at least 20-fold, more preferably at least 40-fold, and most preferably over 40-fold higher.
  • agents that upregulate HER2 expression suitable for use as secondary agents in the present disclosure include: a) gemcitabine
  • the anti-CD20 agent is administered in combination with the ADC as a tertiary agent (i.e.
  • anti-CD20 agent tertiary agent
  • a secondary agent as described herein (such as a Bruton's Tyrosine Kinase inhibitor (BTKi), a PD1 antagonist, a PD-L1 antagonist, a GITR agonist, an 0X40 agonist, a CTLA-4 antagonist, Fludarabine or Cytarabine, a hypomethylating agent, or an agent that upregulates HER2 expression).
  • a combination of [ADC + secondary agent + anti-CD20 agent] is administered to the individual in combination; for example, [ADCx19 + secondary agent + Rituximab] or [ADCx22 + secondary agent + Rituximab].
  • the individual is administered a combination of [ADC + Cytarabine + anti-CD20 agent], such as [ADCx19 + Cytarabine + Rituximab] or [ADCx22 + Cytarabine + Rituximab].
  • [ADC + Cytarabine + anti-CD20 agent] such as [ADCx19 + Cytarabine + Rituximab] or [ADCx22 + Cytarabine + Rituximab].
  • the individual is administered a combination of [ADC + Fludarabine + anti-CD20 agent], such as [ADCx19 + Fludarabine + Rituximab] or [ADCx22 + Fludarabine + Rituximab].
  • [ADC + Fludarabine + anti-CD20 agent] such as [ADCx19 + Fludarabine + Rituximab] or [ADCx22 + Fludarabine + Rituximab].
  • the ADC is an anti-CD19 ADC such as ADCx19.
  • the anti-CD20 agent may be an anti-CD20 antibody or antibody-conjugate.
  • Suitable anti- CD20 antibodies or antibody-conjugates include rituximab, obinutuzumab, Ibritumomab tiuxetan, tositumomab, Ofatumumab, Ocaratuzumab, Ocrelizumab, and Veltuzumab.
  • the anti-CD20 agent is rituximab.
  • CD20 is a 33-37 kDa, non-glycosylated phosphoprotein expressed on the surface of the majority of B-cells, both normal and malignant.
  • CD20 is resident in lipid raft domains of the plasma membrane where it has been suggested to function as a store-operated calcium channel following ligation of the B-cell receptor for antigen (see Boross et al., Am J Cancer Res. 2012; 2(6): 676-690).
  • Anti-CD20 agent is used herein to mean any agent that specifically binds to and/or inhibits a biological activity of CD20.
  • a preferred class of anti-CD20 agents is antibodies or antibody-conjugates that specifically bind CD20.
  • telomere binding constant at least 2, 3, 4, 5, 10, 20, 50, 100, 200, 500, 1000, 2000, 5000, 10 4 , 10 5 or 10 6 -fold higher than the antibody's association constant for BSA, when measured at physiological conditions.
  • the antibodies may bind CD20 with a high affinity.
  • the antibody can bind CD20 with a KD equal to or less than about 10- 6 M, such as 1 x 10 "6 , 10 “7 , 10 10 “9 ,10 ⁇ 10 , 10 "11 , 10 "12 , 10- 13 or 10 "14 .
  • CD20 polypeptide corresponds to Genbank accession no.
  • CD20 polypeptide corresponds to Genbank accession no X12530, version no. X12530.1 , record update date: Feb 2, 201 1 10:09 AM.
  • CD20 polypeptide corresponds to Uniprot/Swiss-Prot accession No. P1 1836.
  • concentrations of the anti-CD20 agent or with a range of concentration of anti-CD19 ADC / secondary agent and vehicle After incubation, two parameters will be measured: the amount of surface CD19 (as determined by flow cytometry) and the in vitro cytotoxicity of the combinations (as determined by MTS assays). To determine the cytotoxicity, Cell viability is measured by adding MTS per well and incubating for 4 hours at 37 C.
  • Percentage cell viability is calculated compared to the untreated control. Cytotoxic synergy is calculated by transforming the cell viability data into fraction affected, and calculating the combination index using the CalcuSyn analysis program.
  • Anti-CD20 agents suitable for use in the present disclosure include:
  • ADC and secondary agent when used as a single agent in isolation have demonstrated clinical utility - for example, in the treatment of cancer.
  • combination of the ADC and secondary agent is expected to provide one or more of the following advantages over treatment with either ADC or secondary agent alone:
  • Effective treatment of a broader range of cancers as used herein means that following treatment with the combination a complete response is observed with a greater range of recognised cancer types. That is, a complete response is seen from cancer types not previously reported to completely respond to ADC, secondary agent, or anti-CD20 agent alone (or in combinations of two of the three elements).
  • the combination of the anti-CD19 ADC, ADCx19, and Cytarabine have also been demonstrated to show synergistically enhanced cytotoxicity (see Example 5 and Figure 3), as has the combination of the anti-CD22 ADC, ADCx22, and Cytarabine (see Example 6 and Figure 4A).
  • the combination of ADCx22 and Fludarabine also shows synergistically enhanced cytotoxicity (see Example 6 and Figure 4B).
  • Effective treatment of a resistant, refractory, or relapsed forms as used herein means that following treatment with the combination a complete response is observed in individuals that are either partially or completely resistant or refractory to treatment with ADC, secondary agent, or anti-CD20 agent alone (or in combinations of two of the three elements; for example, individuals who show no response or only partial response following treatment with any agent alone (or combinations of 2 of the 3 elements), or those with relapsed disorder).
  • a complete response following treatment with the ADC / secondary agent / anti-CD20 agent combination is observed at least 10% of individuals that are either partially or completely resistant or refractory to treatment with ADC, secondary agent, or anti-CD20 agent alone (or in combinations of two of the three elements.
  • a complete response following treatment with the ADC / secondary agent / anti-CD20 agent combination is observed at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, or at least 99% of individuals that are either partially or completely resistant or refractory to treatment with ADC, secondary agent, or anti-CD20 agent alone (or in combinations of two of the three elements.
  • Increased response rate to treatment as used herein means that following treatment with the combination a complete response is observed in a greater proportion of individuals than is observed following treatment with ADC, secondary agent, or anti-CD20 agent alone (or in combinations of two of the three elements.
  • a complete response following treatment with the ADC / secondary agent / anti-CD20 agent combination is observed at least 10% of treated individuals. In some embodiments, a complete response following treatment with the ADC / secondary agent / anti-CD20 agent combination is observed at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, or at least 99% of treated individuals.
  • Increased durability of treatment means that average duration of complete response in individuals treated with the triple combination is longer than in individuals who achieve complete response following treatment with ADC, secondary agent, or anti-CD20 agent alone (or in combinations of two of the three elements). In some embodiments, the average duration of a complete response following treatment with the ADC / secondary agent / anti-CD20 agent combination is at least 6 months.
  • the average duration of a complete response following treatment with the ADC / secondary agent / anti-CD20 agent combination is at least 12 months, at least 18 months, at least 24 months, at least 3 years, at least 4 years, at least 5 years, at least 6 years, at least 7 years, at least 8 years, at least 9 years, at least 10 years, at least 15 years, or at least 20 years.
  • 'Complete response' is used herein to mean the absence of any clinical evidence of disease in an individual. Evidence may be assessed using the appropriate methodology in the art, for example CT or PET scanning, or biopsy where appropriate.
  • the number of doses required to achieve complete response may be one, two, three, four, five, ten or more.
  • the individuals achieve complete response no more than a year after administration of the first dose, such as no more than 6 months, no more than 3 months, no more than a month, no more than a fortnight, or no more than a week after administration of the first dose.
  • the therapies described herein include those with utility for anticancer activity.
  • the therapies include an antibody conjugated, i.e. covalently attached by a linker, to a PBD drug moiety, i.e. toxin.
  • a linker i.e. covalently attached by a linker
  • the PBD drug has a cytotoxic effect.
  • the biological activity of the PBD drug moiety is thus modulated by conjugation to an antibody.
  • the antibody-drug conjugates (ADC) of the disclosure selectively deliver an effective dose of a cytotoxic agent to tumor tissue whereby greater selectivity, i.e. a lower efficacious dose, may be achieved.
  • the present disclosure provides combined therapies comprising administering an ADC which binds a first target protein for use in therapy, wherein the method comprises selecting a subject based on expression of the target protein.
  • the present disclosure provides a combined therapy with a label that specifies that the therapy is suitable for use with a subject determined to be suitable for such use.
  • the label may specify that the therapy is suitable for use in a subject has expression of the first target protein, such as overexpression of the first target protein.
  • the label may specify that the subject has a particular type of cancer.
  • the first target protein is preferably CD19 or CD22.
  • the cancer may be lymphoma, such as non-Hodgkins lymphoma.
  • the label may specify that the subject has a CD19+ or CD22+ lymphoma.
  • a combined therapy as described herein for use in the treatment of a proliferative disease provides the use of a conjugate compound in the manufacture of a medicament for treating a proliferative disease.
  • proliferative disease pertains to an unwanted or uncontrolled cellular proliferation of excessive or abnormal cells which is undesired, such as, neoplastic or hyperplastic growth, whether in vitro or in vivo.
  • proliferative conditions include, but are not limited to, benign, pre-malignant, and malignant cellular proliferation, including but not limited to, neoplasms and tumours (e.g. histocytoma, glioma, astrocyoma, osteoma), cancers (e.g.
  • lung cancer small cell lung cancer, gastrointestinal cancer, bowel cancer, colon cancer, breast carinoma, ovarian carcinoma, prostate cancer, testicular cancer, liver cancer, kidney cancer, bladder cancer, pancreas cancer, brain cancer, sarcoma, osteosarcoma, Kaposi's sarcoma, melanoma), lymphomas, leukemias, psoriasis, bone diseases, fibroproliferative disorders (e.g. of connective tissues), and atherosclerosis.
  • Cancers of interest include, but are not limited to, leukemias and ovarian cancers.
  • Any type of cell may be treated, including but not limited to, lung, gastrointestinal (including, e.g. bowel, colon), breast (mammary), ovarian, prostate, liver (hepatic), kidney (renal), bladder, pancreas, brain, and skin.
  • gastrointestinal including, e.g. bowel, colon
  • breast mammary
  • ovarian prostate
  • liver hepatic
  • kidney renal
  • bladder pancreas
  • brain and skin.
  • Non-Hodgkin's Lymphoma including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome-positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • DLBCL diffuse large B-cell lymphoma
  • FL follicular lymphoma
  • MCL Mantle Cell lymphoma
  • CLL chronic lymphatic lymphoma
  • MZBL Marginal Zone B- cell lymphoma
  • leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lympho
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD19+ve and CD19-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm comprising both CD22+ve and C22-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD19-ve neoplastic cells, optionally wherein the CD19-ve neoplastic cells are associated with CD19+ve neoplastic or non-neoplastic cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD22-ve neoplastic cells, optionally wherein the CD22-ve neoplastic cells are associated with CD22+ve neoplastic or non-neoplastic cells.
  • the target cancer or cancer cells may be all or part of a solid tumour.
  • Solid tumor herein will be understood to include solid haematological cancers such as lymphomas (Hodgkin's lymphoma or non-Hodgkin's lymphoma) which are discussed in more detail herein.
  • lymphomas Hodgkin's lymphoma or non-Hodgkin's lymphoma
  • the solid tumour may be a tumour with high levels of infiltrating T-cells, such as infiltrating regulatory T-cells (Treg; Menetrier-Caux, C, et al., Targ Oncol (2012) 7:15- 28; Arce Vargas et al., 2017, Immunity 46, 1 -10; Tanaka, A., et al., Cell Res. 2017 Jan;27(1 ):109-1 18).
  • the solid tumour may be pancreatic cancer, breast cancer, colorectal cancer, gastric and oesophageal cancer, leukemia and lymphoma, melanoma, non-small cell lung cancer, ovarian cancer, hepatocellular carcinoma, renal cell carcinoma, and head and neck cancer.
  • the combined therapies of the present disclosure may be used to treat various diseases or disorders, e.g. characterized by the overexpression of a tumor antigen.
  • exemplary conditions or hyperproliferative disorders include benign or malignant tumors; leukemia, haematological, and lymphoid malignancies.
  • Others include neuronal, glial, astrocytal, hypothalamic, glandular, macrophagal, epithelial, stromal, blastocoelic, inflammatory, angiogenic and immunologic, including autoimmune disorders and graft- versus-host disease (GVHD).
  • GVHD graft- versus-host disease
  • the disease or disorder to be treated is a hyperproliferative disease such as cancer.
  • cancer to be treated herein include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g.
  • lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
  • lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer,
  • Autoimmune diseases for which the combined therapies may be used in treatment include rheumatologic disorders (such as, for example, rheumatoid arthritis, Sjogren's syndrome, scleroderma, lupus such as SLE and lupus nephritis, polymyositis/dermatomyositis, cryoglobulinemia, anti-phospholipid antibody syndrome, and psoriatic arthritis), osteoarthritis, autoimmune gastrointestinal and liver disorders (such as, for example, inflammatory bowel diseases (e.g.
  • autoimmune gastritis and pernicious anemia such as, for example, ANCA- associated vasculitis, including Churg-Strauss vasculitis, Wegener's granulomatosis, and polyadenitis
  • vasculitis such as, for example, ANCA- associated vasculitis, including Churg-Strauss vasculitis, Wegener's granulomatosis, and polyadenitis
  • autoimmune neurological disorders such as, for example, multiple sclerosis, opsoclonus myoclonus syndrome, myasthenia gravis, neuromyelitis optica, Parkinson's disease, Alzheimer's disease, and autoimmune polyneuropathies
  • renal disorders such as, for example, glomerulonephritis, Goodpasture's syndrome, and Berger's disease
  • autoimmune dermatologic disorders such as, for example, psoriasis, urticaria, hives, pemphigus vulgaris, bullous pemphigoid,
  • Graves' disease and thyroiditis More preferred such diseases include, for example, rheumatoid arthritis, ulcerative colitis, ANCA-associated vasculitis, lupus, multiple sclerosis, Sjogren's syndrome, Graves' disease, IDDM, pernicious anemia, thyroiditis, and glomerulonephritis.
  • the subject has a proliferative disorder selected from non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B- cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome-positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • DLBCL diffuse large B-cell lymphoma
  • FL follicular lymphoma
  • MCL Mantle Cell lymphoma
  • CLL chronic lymphatic lymphoma
  • MZBL Marginal Zone B- cell lymphoma
  • leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia
  • the subject has a proliferative disease characterised by the presence of a neoplasm comprising both CD19+ve and CD19-ve cells. In some aspects, the subject has a proliferative disease characterised by the presence of a neoplasm comprising both CD22+ve and C22-ve cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD 19- ve neoplastic cells, optionally wherein the CD19-ve neoplastic cells are associated with CD19+ve neoplastic or non-neoplastic cells.
  • the proliferative disease may be characterised by the presence of a neoplasm composed of CD22-ve neoplastic cells, optionally wherein the CD22-ve neoplastic cells are associated with CD22+ve neoplastic or non-neoplastic cells.
  • the target neoplasm or neoplastic cells may be all or part of a solid tumour In some aspects, the subject has a solid tumour.
  • Solid tumor herein will be understood to include solid haematological cancers such as lymphomas (Hodgkin's lymphoma or non-Hodgkin's lymphoma) which are discussed in more detail herein.
  • lymphomas Hodgkin's lymphoma or non-Hodgkin's lymphoma
  • the solid tumour may be a tumour with high levels of infiltrating T-cells, such as infiltrating regulatory T-cells (Treg; Menetrier-Caux, C, et al., Targ Oncol (2012) 7:15- 28; Arce Vargas et al., 2017, Immunity 46, 1-10; Tanaka, A., et al., Cell Res. 2017 Jan;27(1 ):109-1 18).
  • the solid tumour may be pancreatic cancer, breast cancer, colorectal cancer, gastric and oesophageal cancer, leukemia and lymphoma, melanoma, non-small cell lung cancer, ovarian cancer, hepatocellular carcinoma, renal cell carcinoma, and head and neck cancer.
  • the individuals are selected as suitable for treatment with the combined treatments before the treatments are administered.
  • individuals who are considered suitable for treatment are those individuals who are expected to benefit from, or respond to, the treatment.
  • Individuals may have, or be suspected of having, or be at risk of having cancer.
  • Individuals may have received a diagnosis of cancer.
  • individuals may have, or be suspected of having, or be at risk of having, lymphoma.
  • individuals may have, or be suspected of having, or be at risk of having, a solid cancer that has tumour associated non-tumor cells that express a first target protein, such as infiltrating cells that express a first target protein.
  • individuals are selected on the basis of the amount or pattern of expression of a first target protein. In some aspects, the selection is based on expression of a first target protein at the cell surface. In some aspects, individuals are selected on the basis they have a neoplasm comprising both CD19+ve and CD19-ve cells.
  • the neoplasm may be composed of CD19-ve neoplastic cells, optionally wherein the CD19-ve neoplastic cells are associated with CD19+ve neoplastic or non-neoplastic cells.
  • the neoplasm or neoplastic cells may be all or part of a solid tumour. The solid tumour may be partially or wholly CD19-ve.
  • individuals are selected on the basis they have a neoplasm comprising both CD22+ve and CD22-ve cells.
  • the neoplasm may be composed of CD22-ve neoplastic cells, optionally wherein the CD22-ve neoplastic cells are associated with CD22+ve neoplastic or nonneoplastic cells.
  • the neoplasm or neoplastic cells may be all or part of a solid tumour.
  • the solid tumour may be partially or wholly CD22-ve.
  • the target is a second target protein.
  • the selection is based on expression of a second target protein at the cell surface.
  • the selection is based on levels of both a first target protein and a second target protein at the cell surface.
  • expression of the target in a particular tissue of interest is determined. For example, in a sample of lymphoid tissue or tumor tissue. In some cases, systemic expression of the target is determined. For example, in a sample of circulating fluid such as blood, plasma, serum or lymph.
  • the individual is selected as suitable for treatment due to the presence of target expression in a sample. In those cases, individuals without target expression may be considered not suitable for treatment.
  • the level of target expression is used to select a individual as suitable for treatment. Where the level of expression of the target is above a threshold level, the individual is determined to be suitable for treatment. In some aspects, the presence of a first target protein and/or a second target protein in cells in the sample indicates that the individual is suitable for treatment with a combination comprising an ADC and a secondary agent. In other aspects, the amount of first target protein and/or a second target protein expression must be above a threshold level to indicate that the individual is suitable for treatment. In some aspects, the observation that first target protein and/or a second target protein localisation is altered in the sample as compared to a control indicates that the individual is suitable for treatment.
  • an individual is indicated as suitable for treatment if cells obtained from lymph node or extra nodal sites react with antibodies against first target protein and/or a second target protein as determined by IHC.
  • a patient is determined to be suitable for treatment if at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or more of all cells in the sample express a first target protein. In some aspects disclosed herein, a patient is determined to be suitable for treatment if at least at least 10% of the cells in the sample express a first target protein.
  • a patient is determined to be suitable for treatment if at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or more of all cells in the sample express a second target protein. In some aspects disclosed herein, a patient is determined to be suitable for treatment if at least at least 10% of the cells in the sample express a second target protein.
  • the individual is selected as suitable for treatment based on their current or previous treatment regime. In some embodiments the individual is selected for treatment with the ADC and/or secondary agent combination if the individual has been treated with an anti-CD20 agent. In some embodiments the individual is selected for treatment with the ADC and/or secondary agent combination if the individual is being treated with an anti- CD20 agent. In some cases the individual is selected for treatment if they are refractory to treatment (or further treatment) with the anti-CD20 agent. In some cases the anti-CD20 agent may be Rituximab.
  • the ADC and/or secondary agent combination may be administered in combination with an anti-CD20 agent, or without continued administration of the anti-CD20 agent.
  • the ADC may be an anti-CD19 ADC, such as ADCx19.
  • the ADC may be an anti-CD22 ADC, such as ADCx22.
  • the ADC and/or secondary agent combination is administered to the selected individual in combination with an anti-CD20 agent. In some embodiments the ADC and/or secondary agent combination is administered to the selected individual without continued administration of an anti-CD20 agent.
  • the anti-CD20 agent is preferably Rituximab.
  • the ADC may be an anti-CD19 ADC, such as ADCx19.
  • the ADC may be an anti-CD22 ADC, such as ADCx22.
  • the term 'refractory to treatment (or further treatment) with the anti-CD20 agent' is used herein to mean that the disorder (such as cancer) does not respond, or has ceased to respond, to administration of the anti-CD20 agent when administered as a monotherapy.
  • individuals with refractory NHL are identified using the response criteria disclosed in Cheson at al., 2014 (South Asian J Cancer. 2014 Jan-Mar; 3(1 ): 66- 70).
  • non-responders are defined as individuals where there is either (i) a >50% increase from nadir in the sum product of diameters of any previously identified abnormal node, or (ii) an appearance of any new lesion during or at the end of therapy.
  • individuals with refractory leukaemia are identified as individuals with either stable or progressive disease who have completed one complete treatment cycle, or individual achieving partial response after two or more complete treatment cycles.
  • the first target protein is preferably CD19 or CD22.
  • the sample may comprise or may be derived from: a quantity of blood; a quantity of serum derived from the individual's blood which may comprise the fluid portion of the blood obtained after removal of the fibrin clot and blood cells; a quantity of pancreatic juice; a tissue sample or biopsy; or cells isolated from said individual.
  • a sample may be taken from any tissue or bodily fluid.
  • the sample may include or may be derived from a tissue sample, biopsy, resection or isolated cells from said individual.
  • the sample is a tissue sample.
  • the sample may be a sample of tumor tissue, such as cancerous tumor tissue.
  • the sample may have been obtained by a tumor biopsy.
  • the sample is a lymphoid tissue sample, such as a lymphoid lesion sample or lymph node biopsy.
  • the sample is a skin biopsy.
  • the sample is taken from a bodily fluid, more preferably one that circulates through the body. Accordingly, the sample may be a blood sample or lymph sample.
  • the sample is a urine sample or a saliva sample.
  • the sample is a blood sample or blood-derived sample.
  • the blood derived sample may be a selected fraction of a individual's blood, e.g. a selected cell-containing fraction or a plasma or serum fraction.
  • a selected cell-containing fraction may contain cell types of interest which may include white blood cells (WBC), particularly peripheral blood mononuclear cells (PBC) and/or granulocytes, and/or red blood cells (RBC).
  • WBC white blood cells
  • PBC peripheral blood mononuclear cells
  • RBC red blood cells
  • methods according to the present disclosure may involve detection of a first target polypeptide or nucleic acid in the blood, in white blood cells, peripheral blood mononuclear cells, granulocytes and/or red blood cells.
  • the sample may be fresh or archival.
  • archival tissue may be from the first diagnosis of an individual, or a biopsy at a relapse.
  • the sample is a fresh biopsy.
  • the first target polypeptide is preferably CD19 or CD22.
  • the individual may be an animal, mammal, a placental mammal, a marsupial (e.g., kangaroo, wombat), a monotreme (e.g., duckbilled platypus), a rodent (e.g., a guinea pig, a hamster, a rat, a mouse), murine (e.g., a mouse), a lagomorph (e.g., a rabbit), avian (e.g., a bird), canine (e.g., a dog), feline (e.g., a cat), equine (e.g., a horse), porcine (e.g., a pig), ovine (e.g., a sheep), bovine (e.g., a cow), a primate, simian (e.g., a monkey or ape), a monkey (e.g., marmoset, baboon), an a
  • an individual has, or is suspected as having, or has been identified as being at risk of, cancer.
  • the individual has already received a diagnosis of cancer.
  • the individual may have received a diagnosis of non-Hodgkin's Lymphoma, including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B-cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome-positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • DLBCL diffuse large B-cell lymphoma
  • FL follicular lymphoma
  • MCL Mantle Cell lymphoma
  • CLL chronic lymphatic lymphoma
  • MZBL
  • non-Hodgkin's Lymphoma including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B-cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome- positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • DLBCL diffuse large B-cell lymphoma
  • FL follicular lymphoma
  • MCL Mantle Cell lymphoma
  • CLL chronic lymphatic lymphoma
  • MZBL Marginal Zone B-cell lymphoma
  • leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lympho
  • the individual has, is suspected of having, or has received a diagnosis of, a proliferative disease characterised by the presence of a neoplasm comprising both CD19+ve and CD19-ve cells.
  • the neoplasm may be composed of CD19-ve neoplastic cells, optionally wherein the CD19-ve neoplastic cells are associated with CD19+ve neoplastic or non-neoplastic cells.
  • the neoplasm or neoplastic cells may be all or part of a solid tumour.
  • the solid tumor may be a neoplasm, including a non-haematological cancer, comprising or composed of CD19+ve neoplastic cells.
  • the individual has, is suspected of having, or has received a diagnosis of, a proliferative disease characterised by the presence of a neoplasm comprising both CD22+ve and CD22-ve cells.
  • the neoplasm may be composed of CD22-ve neoplastic cells, optionally wherein the CD22-ve neoplastic cells are associated with CD22+ve neoplastic or non-neoplastic cells.
  • the neoplasm or neoplastic cells may be all or part of a solid tumour.
  • the solid tumor may be a neoplasm, including a non-haematological cancer, comprising or composed of CD22+ve neoplastic cells
  • Solid tumor herein will be understood to include solid haematological cancers such as lymphomas (Hodgkin's lymphoma or non-Hodgkin's lymphoma) which are discussed in more detail herein.
  • the solid tumour may be a tumour with high levels of infiltrating T-cells, such as infiltrating regulatory T-cells (Treg; Menetrier-Caux, C, et al., Targ Oncol (2012) 7:15- 28; Arce Vargas et al., 2017, Immunity 46, 1-10; Tanaka, A., et al., Cell Res. 2017 Jan;27(1 ):109-1 18).
  • the solid tumour may be pancreatic cancer, breast cancer, colorectal cancer, gastric and oesophageal cancer, leukemia and lymphoma, melanoma, non-small cell lung cancer, ovarian cancer, hepatocellular carcinoma, renal cell carcinoma, and head and neck cancer.
  • the individual has received a diagnosis of a solid cancer containing CD19+ or CD22+ expressing infiltrating cells.
  • the Individual may be undergoing, or have undergone, a therapeutic treatment for that cancer.
  • the subject may, or may not, have previously received ADCX19 or ADCX22.
  • the cancer is lymphoma, including non-Hodgkins lymphoma.
  • the Individual may be undergoing, or have undergone, treatment with an anti-CD20 agent.
  • the individual may be refractory to treatment (or further treatment) with the anti-CD20 agent.
  • the anti-CD20 agent may be Rituximab.
  • the anti-CD19 ADC / secondary agent combination may be administered in combination with an anti-CD20 agent, or without continued administration of the anti-CD20 agent.
  • target expression in the individual is compared to target expression in a control.
  • Controls are useful to support the validity of staining, and to identify experimental artefacts.
  • the control may be a reference sample or reference dataset.
  • the reference may be a sample that has been previously obtained from a individual with a known degree of suitability.
  • the reference may be a dataset obtained from analyzing a reference sample.
  • Controls may be positive controls in which the target molecule is known to be present, or expressed at high level, or negative controls in which the target molecule is known to be absent or expressed at low level.
  • Controls may be samples of tissue that are from individuals who are known to benefit from the treatment.
  • the tissue may be of the same type as the sample being tested.
  • a sample of tumor tissue from a individual may be compared to a control sample of tumor tissue from a individual who is known to be suitable for the treatment, such as a individual who has previously responded to the treatment.
  • control may be a sample obtained from the same individual as the test sample, but from a tissue known to be healthy.
  • a sample of cancerous tissue from a individual may be compared to a non-cancerous tissue sample.
  • control is a cell culture sample.
  • test sample is analyzed prior to incubation with an antibody to determine the level of background staining inherent to that sample.
  • Isotype controls use an antibody of the same class as the target specific antibody, but are not immunoreactive with the sample. Such controls are useful for distinguishing non-specific interactions of the target specific antibody.
  • the methods may include hematopathologist interpretation of morphology and immunohistochemistry, to ensure accurate interpretation of test results.
  • the method may involve confirmation that the pattern of expression correlates with the expected pattern. For example, where the amount of a first target protein and/or a second target protein expression is analyzed, the method may involve confirmation that in the test sample the expression is observed as membrane staining, with a cytoplasmic component. The method may involve confirmation that the ratio of target signal to noise is above a threshold level, thereby allowing clear discrimination between specific and non-specific background signals.
  • the first target protein is preferably CD19 or CD22.
  • treatment pertains generally to treatment and therapy, whether of a human or an animal (e.g., in veterinary applications), in which some desired therapeutic effect is achieved, for example, the inhibition of the progress of the condition, and includes a reduction in the rate of progress, a halt in the rate of progress, regression of the condition, amelioration of the condition, and cure of the condition.
  • Treatment as a prophylactic measure i.e., prophylaxis, prevention is also included.
  • therapeutically-effective amount or “effective amount” as used herein, pertains to that amount of an active compound, or a material, composition or dosage from comprising an active compound, which is effective for producing some desired therapeutic effect, commensurate with a reasonable benefit/risk ratio, when administered in accordance with a desired treatment regimen.
  • prophylactically-effective amount pertains to that amount of an active compound, or a material, composition or dosage from comprising an active compound, which is effective for producing some desired prophylactic effect, commensurate with a reasonable benefit/risk ratio, when administered in accordance with a desired treatment regimen.
  • a method of treatment comprising administering to a subject in need of treatment a therapeuticaiiy-effective amount of an ADC and a secondary agent.
  • therapeutically effective amount is an amount sufficient to show benefit to a subject. Such benefit may be at least amelioration of at least one symptom.
  • the actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g. decisions on dosage, is within the responsibility of general practitioners and other medical doctors.
  • the subject may have been tested to determine their eligibility to receive the treatment according to the methods disclosed herein.
  • the method of treatment may comprise a step of determining whether a subject is eligible for treatment, using a method disclosed herein.
  • the ADC may comprise an anti-CD19 antibody or an anti-CD22 antibody.
  • the anti-CD19 antibody may be RB4v1 .2 antibody.
  • the anti-CD22 antibody may be EMabC220.
  • the ADC may comprise a drug which is a PBD dimer.
  • the ADC may be an anti-CD19-ADC, and in particular, ADCX19.
  • the ADC may be an anti-CD22-ADC, and in particular, ADCX22.
  • the ADC may be an ADC disclosed in WO2014/0571 17 or WO2014/057122.
  • the secondary agent may be: (a) a Bruton's Tyrosine Kinase inhibitor (BTKi), such as Ibrutinib (Imbruvica), Acalabrutinib/ACP-196, ONO/GS-4059, Spebrutinib/AVL-292/CC-292, HM71224 (Poseltinib) or BGB-31 1 1 (Zanubrutinib);
  • BTKi Bruton's Tyrosine Kinase inhibitor
  • a PD1 antagonist such as pembrolizumab, nivolumab, MEDI0680, PDR001 (spartalizumab), Camreiizumab, AUNP12, Pidilizumab, Cemiplimab (REGN-
  • a PD-L1 antagonist such as atezolizumab (Tecentriq), BMS- 936559/MDX-1 105, durvalumab/MEDI4736, or MSB0010718C (Avelumab);
  • GITR Glucocorticoid-lnduced TNFR-Related protein
  • an OX40 agonist such as EDI0562, MEDI6383, MOXR0916, RG7888, OX40mAb24, INCAGN1949, GSK3174998, or PF-04518600;
  • CTLA-4 antagonist such as ipilimumab (brand name Yervoy) or Tremeiimumab (Originally developed by Pfizer, now Medimmune);
  • a hypomethylating agent such as cytidine analogs - for example, 5-azacytidine (azacitidine) and 5-aza-2'-deoxycytidine (decitabine);
  • an anti-CD20 agent such as rituximab, obinutuzumab, Ibritumomab tiuxetan, tositumomab, Ofatumumab, Ocaratuzumab, Ocrelizumab, and Veltuzumab.
  • the treatment may involve administration of the ADC / secondary agent combination alone or in further combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
  • An example method of treatment involves:
  • an anti-CD20 agent such as Rituximab in combination with the anti-CD19 ADC and/or secondary agent (for example, at the same time as the ADC, or after the ADC).
  • treatments and therapies include, but are not limited to, chemotherapy (the administration of active agents, including, e.g. drugs, such as chemotherapeutics); surgery; and radiation therapy.
  • a “chemotherapeutic agent” is a chemical compound useful in the treatment of cancer, regardless of mechanism of action.
  • Classes of chemotherapeutic agents include, but are not limited to: alkylating agents, antimetabolites, spindle poison plant alkaloids, cytotoxic/antitumor antibiotics, topoisomerase inhibitors, antibodies, photosensitizers, and kinase inhibitors.
  • Chemotherapeutic agents include compounds used in "targeted therapy” and conventional chemotherapy.
  • chemotherapeutic agents include: Lenalidomide ( EVLIMID®, Celgene), Vorinostat (ZOLINZA®, Merck), Panobinostat (FARYDAK®, Novartis), Mocetinostat (MGCD0103), Everolimus (ZORTRESS®, CERTICAN®, Novartis), Bendamustine (TREAKISYM®, RIBOMUSTIN®, LEVACT®, TREANDA®, Mundip arma International), erlotinib (TARCEVA®, Genentech/OSI Pharm.), docetaxel (TAXOTERE®, Sanofi-Aventis), 5-FU (fluorouracil, 5-fluorouracil, CAS No.
  • gemcitabine Lilly
  • PD- 0325901 CAS No. 391210-10-9, Pfizer
  • cisplatin cis-diamine, dichloroplatinum(ll), CAS No. 15663-27-1
  • carboplatin CAS No. 41575-94-4
  • paclitaxel TAXOL®, Bristol-Myers Squibb Oncology, Princeton, N.J.
  • trastuzumab HERCEPTIN®, Genentech
  • temozoiomide 4-methyl-5-oxo- 2.3.4,6.8-pentazabicyclo [4.3.0] nona-2.7,9-triene- 9- carboxamide, CAS No.
  • tamoxifen (Z)-2-[4-(1 ,2-diphenylbut-1 -enyl)phenoxy]-A/.A/-dimethylethanamine, NOLVADEX®, ISTUBAL®, VALODEX®), and doxorubicin (ADRIAMYCIN®), Akti-1/2, HPPD, and rapamycin.
  • chemotherapeutic agents include: oxaliplatin (ELOXATIN®, Sanofi), bortezomib (VELCADE®, Millennium Pharm.), sutent (SUNITINIB®, SU1 1248, Pfizer), letrozole (FEMARA®, Novartis), imatinib mesylate (GLEEVEC®, Novartis), XL-518 (Mek inhibitor, Exelixis, WO 2007/044515), ARRY-886 (Mek inhibitor, AZD6244, Array BioPharma, Astra Zeneca), SF-1 126 (PI3K inhibitor, Semafore Pharmaceuticals), BEZ-235 (PI3K inhibitor, Novartis), XL-147 (PI3K inhibitor, Exelixis), PTK787/ZK 222584 (Novartis), fulvestrant (FASLODEX®, AstraZeneca), leucovorin (folinic acid), rapamycin (si
  • calicheamicin calicheamicin gammal I, calicheamicin omegaM (Angew Chem. Intl. Ed. Engl. (1994) 33:183-186); dynemicin, dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-l_-norleucine, morpholino- doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubi
  • chemotherapeutic agent such as CHP (doxorubicin, prednisone, cyclophosphamide), or CHOP (doxorubicin, prednisone, cyclophopsphamide, vincristine).
  • anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX®; tamoxifen citrate), raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY1 17018, onapristone, and FARESTON® (toremifine citrate); (ii) aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminogluteth
  • chemotherapeutic agent therapeutic antibodies such as alemtuzumab (Campath), bevacizumab (AVASTIN®, Genentech); cetuximab (ERBITUX®, Imclone); panitumumab (VECTIBIX®, Amgen), pertuzumab (PERJETATM, OMNITARGTM, 2C4, Genentech), trastuzumab (HERCEPTIN®, Genentech), MDX-060 (Medarex) and the antibody drug conjugate, gemtuzumab ozogamicin (MYLOTARG®, Wyeth).
  • therapeutic antibodies such as alemtuzumab (Campath), bevacizumab (AVASTIN®, Genentech); cetuximab (ERBITUX®, Imclone); panitumumab (VECTIBIX®, Amgen), pertuzumab (PERJETATM, OMNITARGTM, 2C4, Genentech), trastuzumab
  • Humanized monoclonal antibodies with therapeutic potential as chemotherapeutic agents in combination with the conjugates of the disclosure include: alemtuzumab, apolizumab, aselizumab, atlizumab, bapineuzumab, bevacizumab, bivatuzumab mertansine, cantuzumab mertansine, cedelizumab, certolizumab pegol, cidfusituzumab, cidtuzumab, daclizumab, eculizumab, efalizumab, epratuzumab, erlizumab, felvizumab, fontolizumab, gemtuzumab ozogamicin, inotuzumab ozogamicin, ipilimumab, labetuzumab, lintuzumab, matuzumab, mepolizumab, motavizumab, motovizumab,
  • compositions according to the present disclosure are preferably pharmaceutical compositions.
  • Pharmaceutical compositions according to the present disclosure, and for use in accordance with the present disclosure may comprise, in addition to the active ingredient, i.e. a conjugate compound, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
  • the precise nature of the carrier or other material will depend on the route of administration, which may be oral, or by injection, e.g. cutaneous, subcutaneous, or intravenous.
  • compositions for oral administration may be in tablet, capsule, powder or liquid form.
  • a tablet may comprise a solid carrier or an adjuvant.
  • Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
  • a capsule may comprise a solid carrier such a gelatin.
  • the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, La eta ted Ringer's Injection.
  • Preservatives, stabilisers, buffers, antioxidants and/or other additives may be included, as required.
  • appropriate dosages of the ADC, secondary agent, and/or the anti-CD20 agent, and compositions comprising these active elements can vary from subject to subject. Determining the optimal dosage will generally involve the balancing of the level of therapeutic benefit against any risk or deleterious side effects.
  • the selected dosage level will depend on a variety of factors including, but not limited to, the activity of the particular compound, the route of administration, the time of administration, the rate of excretion of the compound, the duration of the treatment, other drugs, compounds, and/or materials used in combination, the severity of the condition, and the species, sex, age, weight, condition, general health, and prior medical history of the subject.
  • the amount of compound and route of administration will ultimately be at the discretion of the physician, veterinarian, or clinician, although generally the dosage will be selected to achieve local concentrations at the site of action which achieve the desired effect without causing substantial harmful or deleterious side-effects.
  • the dosage of ADC is determined by the expression of a first target protein observed in a sample obtained from the subject.
  • the level or localisation of expression of the first target protein in the sample may be indicative that a higher or lower dose of ADC is required.
  • a high expression level of the first target protein may indicate that a higher dose of ADC would be suitable.
  • a high expression level of the first target protein may indicate the need for administration of another agent in addition to the ADC.
  • a high expression level of the first target protein may indicate a more aggressive therapy.
  • the dosage of the secondary agent is determined by the expression of a second target protein observed in a sample obtained from the subject.
  • the level or localisation of expression of the second target protein in the sample may be indicative that a higher or lower dose of secondary agent is required.
  • a high expression level of the second target protein may indicate that a higher dose of secondary agent would be suitable.
  • a high expression level of the second target protein may indicate the need for administration of another agent in addition to the secondary agent.
  • administration of the secondary agent in conjunction with a chemotherapeutic agent may indicate a more aggressive therapy.
  • the dosage of the anti-CD20 agent is determined by the expression of CD20 observed in a sample obtained from the subject.
  • the level or localisation of expression of CD20 in the sample may be indicative that a higher or lower dose of anti- CD20 agent is required.
  • a high expression level of CD20 may indicate that a higher dose of anti-CD20 agent would be suitable.
  • a high expression level of CD20 may indicate the need for administration of another agent in addition to the anti-CD20 agent.
  • a high expression level of CD20 may indicate a more aggressive therapy.
  • the dosage level is determined by the expression of a first target protein on neoplastic cells in a sample obtained from the subject.
  • the target neoplasm is composed of, or comprises, neoplastic cells expressing the first target protein.
  • the dosage level is determined by the expression of a first target protein on cells associated with the target neoplasm.
  • the target neoplasm may be a solid tumour composed of, or comprising, neoplastic cells that express the first target protein.
  • the target neoplasm may be a solid tumour composed of, or comprising, neoplastic cells that do not express the first target protein.
  • the cells expressing the first target protein may be neoplastic or non-neoplastic cells associated with the target neoplasm.
  • Administration can be effected in one dose, continuously or intermittently (e.g., in divided doses at appropriate intervals) throughout the course of treatment. Methods of determining the most effective means and dosage of administration are well known to those of skill in the art and will vary with the formulation used for therapy, the purpose of the therapy, the target cell(s) being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician, veterinarian, or clinician.
  • each active compound is in the range of about 100 ng to about 25 mg (more typically about 1 g to about 10 mg) per kilogram body weight of the subject per day.
  • the active compound is a salt, an ester, an amide, a prodrug, or the like
  • the amount administered is calculated on the basis of the parent compound and so the actual weight to be used is increased proportionately.
  • each active compound is administered to a human subject according to the following dosage regime: about 100 mg, 3 times daily.
  • each active compound is administered to a human subject according to the following dosage regime: about 150 mg, 2 times daily.
  • each active compound is administered to a human subject according to the following dosage regime: about 200 mg, 2 times daily.
  • each conjugate compound is administered to a human subject according to the following dosage regime: about 50 or about 75 mg, 3 or 4 times daily. In one embodiment, each conjugate compound is administered to a human subject according to the following dosage regime: about 100 or about 125 mg, 2 times daily.
  • the dosage amounts described above may apply to the conjugate (including the PBD moiety and the linker to the antibody) or to the effective amount of PBD compound provided, for example the amount of compound that is releasable after cleavage of the linker.
  • the first target protein is preferably CD19 or CD22.
  • the ADC may comprise an anti-CD19 antibody or an anti-CD22 antibody.
  • the anti-CD19 antibody may be RB4v1 .2 antibody.
  • the anti-CD22 antibody may be EMabC220.
  • the ADC may comprise a drug which is a PBD dimer.
  • the ADC may be an anti-CD19-ADC. and in particular, ADCX19.
  • the ADC may be an anti-CD22-ADC, and in particular, ADCX22.
  • the ADC may be an ADC disclosed in WO2014/0571 17 or WO2014/057122.
  • the secondary agent may be Fludarabine or Cytarabine.
  • the anti-CD20 agent may be an anti-CD20 antibody or antibody-conjugate.
  • Suitable anti- CD20 antibodies or antibody-conjugates include rituximab, obinutuzumab, Ibritumomab tiuxetan, tositumomab, Ofatumumab, Ocaratuzumab, Ocrelizumab, and Veltuzumab.
  • the anti-CD20 agent is rituximab.
  • antibody herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), intact antibodies (also described as “full-length” antibodies) and antibody fragments, so long as they exhibit the desired biological activity, for example, the ability to bind a first target protein (Miller et al (2003) Jour, of Immunology 170:4854- 4861 ).
  • Antibodies may be murine, human, humanized, chimeric, or derived from other species such as rabbit, goat, sheep, horse or camel.
  • An antibody is a protein generated by the immune system that is capable of recognizing and binding to a specific antigen.
  • a target antigen generally has numerous binding sites, also called epitopes, recognized by Complementarity Determining Regions (CDRs) on multiple antibodies.
  • CDRs Complementarity Determining Regions
  • An antibody may comprise a full-length immunoglobulin molecule or an immunologically active portion of a full-length immunoglobulin molecule, i.e., a molecule that contains an antigen binding site that immunospecifically binds an antigen of a target of interest or part thereof, such targets including but not limited to, cancer cell or cells that produce autoimmune antibodies associated with an autoimmune disease.
  • the immunoglobulin can be of any type (e.g. IgG, IgE, IgM, IgD, and IgA), class (e.g. lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2) or subclass, or allotype (e.g.
  • human G1 m1 , G1 m2, G1 m3, non-G1 m1 [that, is any allotype other than G1 m1 ], G1 m17, G2m23, G3m21 , G3m28, G3m1 1 , G3m5, G3m13, G3m14, G3m10, G3m15, G3m16, G3m6, G3m24, G3m26, G3m27, A2m1 , A2m2, Km1 , Km2 and Km3) of immunoglobulin molecule.
  • the immunoglobulins can be derived from any species, including human, murine, or rabbit origin.
  • Antibody fragments comprise a portion of a full length antibody, generally the antigen binding or variable region thereof.
  • Examples of antibody fragments include Fab, Fab', F(ab')2, and scFv fragments; diabodies; linear antibodies; fragments produced by a Fab expression library, anti-idiotypic (anti-Id) antibodies, CDR (complementary determining region), and epitope-binding fragments of any of the above which immunospecifically bind to cancer cell antigens, viral antigens or microbial antigens, single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e.
  • Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations which include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies.
  • the modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present disclosure may be made by the hybridoma method first described by Kohler et a/(1975) Nature 256:495, or may be made by recombinant DNA methods (see, US 4816567).
  • the monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al (1991 ) Nature, 352:624- 628; Marks et al (1991 ) J. Mol. Biol., 222:581 -597 or from transgenic mice carrying a fully human immunoglobulin system (Lonberg (2008) Curr. Opinion 20(4):450-459).
  • the monoclonal antibodies herein specifically include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (US 4816567; and Morrison et al (1984) Proc. Natl. Acad. Sci. USA, 81 :6851 -6855).
  • Chimeric antibodies include "primatized” antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g. Old World Monkey or Ape) and human constant region sequences.
  • An “intact antibody” herein is one comprising VL and VH domains, as well as a light chain constant domain (CL) and heavy chain constant domains, CH1 , CH2 and CH3.
  • the constant domains may be native sequence constant domains (e.g. human native sequence constant domains) or amino acid sequence variant thereof.
  • the intact antibody may have one or more "effector functions" which refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody. Examples of antibody effector functions include C1 q binding; complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; and down regulation of cell surface receptors such as B cell receptor and BCR.
  • intact antibodies can be assigned to different "classes.” There are five major classes of intact antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into “subclasses” (isotypes), e.g., lgG1 , lgG2, lgG3, lgG4, IgA, and lgA2.
  • the heavy-chain constant domains that correspond to the different classes of antibodies are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known. Brief Description of the Figures
  • the disclosure includes the combination of the aspects and preferred features described except where such a combination is clearly impermissible or expressly avoided.
  • a method for treating a disorder in an individual comprising:
  • a method for treating a disorder in an individual comprising administering to the individual an effective amount of:
  • the treatment comprises administering ADCxl 9, optionally in combination with a secondary agent, before an anti-CD20 agent, simultaneous with an anti-CD20 agent, or after an anti-CD20 agent.
  • the treatment further comprises administering a chemotherapeutic agent.
  • non-Hodgkin's Lymphoma including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B-cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome-positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • DLBCL diffuse large B-cell lymphoma
  • FL follicular lymphoma
  • MCL Mantle Cell lymphoma
  • CLL chronic lymphatic lymphoma
  • MZBL Marginal Zone B-cell lymphoma
  • leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lympho
  • the solid tumour is pancreatic cancer, breast cancer, colorectal cancer, gastric and oesophageal cancer, leukemia and lymphoma, melanoma, non-small cell lung cancer, ovarian cancer, hepatocellular carcinoma, renal cell carcinoma, or head and neck cancer.
  • ADCx19 optionally in combination with a secondary agent, in the manufacture of a medicament for treating a disorder in an individual, wherein the treatment comprises the method of any one of paragraphs 4 to 21.
  • a kit comprising:
  • a first medicament comprising ADCx19
  • a second medicament comprising a secondary agent
  • a package insert comprising instructions for administration of the first medicament according to the method of any one or paragraphs 4 to 21.
  • a third medicament comprising an anti-CD20 agent.
  • the secondary agent is a Bruton's Tyrosine Kinase inhibitor (BTKi).
  • Bruton's Tyrosine Kinase inhibitor is selected from Ibrutinib (Imbruvica), Acalabrutinib/ACP- 196, ONO/GS-4059, Spebrutinib/AVL-292/CC-292, HM71224 (Poseltinib) and BGB-31 1 1 (Zanubrutinib).
  • composition, method, use, or kit according to paragraph 32 wherein the PD1 antagonist is selected from pembrolizumab, nivolumab, MEDI0680, PDR001 (spartalizumab), Camrelizumab, AUNP12, Pidilizumab Cemiplimab (REGN-2810), AMP-224, BGB-A317 (Tisleizumab), and BGB-108.
  • the PD1 antagonist is selected from pembrolizumab, nivolumab, MEDI0680, PDR001 (spartalizumab), Camrelizumab, AUNP12, Pidilizumab Cemiplimab (REGN-2810), AMP-224, BGB-A317 (Tisleizumab), and BGB-108.
  • composition, method, use, or kit according to any one of paragraphs 1 to 29, wherein the secondary agent is a PD-L1 antagonist.
  • compositions, method, use, or kit according to paragraph 34 wherein the PD-L1 antagonist is selected from atezolizumab (Tecentriq), BMS-936559/MDX-1 105, durvalumab/MEDI4736, and MSB0010718C (Avelumab).
  • the secondary agent is a GITR (Glucocorticoid-lnduced TNFR-Related protein) agonist.
  • GITR Glucocorticoid-lnduced TNFR-Related protein
  • composition, method, use, or kit according to paragraph 38 wherein the OX40 agonist is selected from MEDI0562, MEDI6383, MOXR0916, RG7888, OX40mAb24, INCAGN1949, GSK3174998, and PF-04518600.
  • the OX40 agonist is selected from MEDI0562, MEDI6383, MOXR0916, RG7888, OX40mAb24, INCAGN1949, GSK3174998, and PF-04518600.
  • the CTLA-4 antagonist is selected from ipilimumab and Tremelimumab.
  • composition, method, use, or kit according to any one of paragraphs 1 to 29, wherein the secondary agent is a hypomethylating agent.
  • hypomethylating agent is selected from 5-azacytidine (azacitidine) and 5-aza-2'- deoxycytidine (decitabine).
  • composition, method, use, or kit according to any one of paragraphs 1 to 29, wherein the secondary agent is an agent that upregulates HER2 expression.
  • composition, method, use, or kit according to paragraph 46, wherein the agent that upregulates HER2 expression is selected from gemcitabine and tamoxifen.
  • compositions, method, use, or kit according to any preceding paragraph wherein the anti-CD20 agent is rituximab.
  • anti-CD20 agent is selected from obinutuzumab, Ibritumomab tiuxetan, tositumomab, Ofatumumab, Ocaratuzumab, Ocrelizumab, and Veltuzumab.
  • a method for treating a disorder in an individual comprising:
  • a method for treating a disorder in an individual comprising administering to the individual an effective amount of:
  • non-Hodgkin's Lymphoma including diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, (FL), Mantle Cell lymphoma (MCL), chronic lymphatic lymphoma (CLL), and Marginal Zone B-cell lymphoma (MZBL), and leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lymphoblastic Leukaemia (ALL) such as Philadelphia chromosome-positive ALL (Ph+ALL) or Philadelphia chromosome-negative ALL (Ph-ALL).
  • DLBCL diffuse large B-cell lymphoma
  • FL follicular lymphoma
  • MCL Mantle Cell lymphoma
  • CLL chronic lymphatic lymphoma
  • MZBL Marginal Zone B-cell lymphoma
  • leukemias such as Hairy cell leukemia (HCL), Hairy cell leukemia variant (HCL-v), and Acute Lympho
  • the solid tumour is pancreatic cancer, breast cancer, colorectal cancer, gastric and oesophageal cancer, leukemia and lymphoma, melanoma, non-small cell lung cancer, ovarian cancer, hepatocellular carcinoma, renal cell carcinoma, or head and neck cancer.
  • ADCx22 optionally in combination with a secondary agent, for use in a method of treatment according to any one of paragraphs 4x to 21 x.
  • a composition comprising ADCx22, optionally in combination with a secondary agent, for use in a method of treatment according to any one of paragraphs 4x to 21x.
  • an anti-CD20 agent for use in a method of treatment according to any one of paragraphs 5x to 21 x.
  • a composition comprising an anti-CD20 agent, for use in a method of treatment according to any one of paragraphs 5x to 21x. 26x.
  • a kit comprising:
  • a first medicament comprising ADCx22
  • a second medicament comprising a secondary agent
  • a package insert comprising instructions for administration of the first medicament according to the method of any one or paragraphs 4x to 21 x.
  • a third medicament comprising an anti-CD20 agent.
  • the secondary agent is a Bruton's Tyrosine Kinase inhibitor (BTKi).
  • the secondary agent is a Bruton's Tyrosine Kinase inhibitor (BTKi).
  • the Bruton's Tyrosine Kinase inhibitor (BTKi) is selected from Ibrutinib (Imbruvica), Acalabrutinib/ACP- 196, ONO/GS-4059, Spebrutinib/AVL-292/CC-292, HM71224 (Poseltinib) and BGB-31 1 1 (Zanubrutinib).
  • the secondary agent is a PD1 antagonist.
  • the PD1 antagonist is selected from pembrolizumab, nivolumab, MEDI0680, PDR001 (spartalizumab), Camrelizumab, AUNP12, Pidilizumab Cemiplimab (REGN-2810), AMP-224, BGB-A317 (Tisleizumab), and BGB-108.
  • the secondary agent is a PD-L1 antagonist.
  • the PD-L1 antagonist is selected from atezolizumab (Tecentriq), BMS-936559/MDX-1 105, durvalumab/MEDI4736, and MSB0010718C (Avelumab).
  • 36x A composition, method, use, or kit according to any one of paragraphs 1 x to 29x, wherein the secondary agent is a GITR (Glucocorticoid-lnduced TNFR-Related protein) agonist.
  • GITR Glucocorticoid-lnduced TNFR-Related protein
  • GITR Glucocorticoid-lnduced TNFR-Related protein
  • compositions, method, use, or kit according to paragraph 38x wherein the 0X40 agonist is selected from MEDI0562, MEDI6383, MOXR0916, RG7888, OX40mAb24, INCAGN1949, GSK3174998, and PF-04518600.
  • the secondary agent is a CTLA-4 antagonist.
  • CTLA- 4 antagonist is selected from ipilimumab and Tremelimumab.
  • the hypomethylating agent is selected from 5-azacytidine (azacitidine) and 5-aza-2'- deoxycytidine (decitabine).
  • the anti-CD20 agent is rituximab.
  • the anti-CD20 agent is selected from obinutuzumab, Ibritumomab tiuxetan, tositumomab, Ofatumumab, Ocaratuzumab, Ocrelizumab, and Veltuzumab.
  • a method for treating cancer in an individual comprising administering to the individual an effective amount of ADCX19, a secondary agent, and optionally an anti- CD20 agent.
  • a first composition comprising ADCX19 for use in a method of treating cancer in an individual, wherein the treatment comprises administration of the first composition in combination with a second composition comprising a secondary agent, and optionally in combination with a third composition comprising an anti-CD20 agent.
  • a first composition comprising a secondary agent for use in a method of treating a disorder in an individual, wherein the treatment comprises administration of the first composition in combination with a second composition comprising ADCX19, and optionally in combination with a third composition comprising an anti-CD20 agent.
  • ADCX19 in the manufacture of a medicament for treating cancer in an individual, wherein the medicament comprises ADCX19, and wherein the treatment comprises administration of the medicament in combination with a composition comprising a secondary agent, and optionally in further combination with an anti-CD20 agent.
  • a secondary agent in the manufacture of a medicament for treating cancer in an individual, wherein the treatment comprises administration of the medicament in combination with a composition comprising ADCX19, and optionally in further combination with a compostion comprising an anti-CD20 agent.
  • a kit comprising:
  • a first medicament comprising ADCX19;
  • a second medicament comprising a secondary agent
  • a third medicament comprising an anti-CD20 agent
  • a package insert comprising instructions for administration of the first medicament to an individual in combination with the second medicament, and optionally the third medicament if present, for the treatment of cancer.
  • a pharmaceutical composition comprising ADCX19, a secondary agent, and optionally an anti-CD20 agent.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of the composition of paragraph 9.
  • composition of paragraph 9 for use in a method of treating cancer in an individual.
  • 12a The use of the composition of paragraph 9 in the manufacture of a medicament for treating cancer in an individual.
  • kits comprising the composition of paragraph 9 and a set of instructions for administration of the medicament to an individual for the treatment of cancer.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Microbiology (AREA)
  • Toxicology (AREA)
  • Biotechnology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Pathology (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
PCT/EP2018/060215 2017-04-20 2018-04-20 Combination therapy Ceased WO2018193105A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
EA202092513A EA202092513A1 (ru) 2018-04-05 2018-04-20 Комбинированная терапия
KR1020197033821A KR20190137151A (ko) 2017-04-20 2018-04-20 병용 요법
BR112019021822-0A BR112019021822A2 (pt) 2017-04-20 2018-04-20 Terapia de combinação
AU2018253951A AU2018253951A1 (en) 2017-04-20 2018-04-20 Combination therapy
JP2019556889A JP2020517640A (ja) 2017-04-20 2018-04-20 併用療法
CA3057749A CA3057749A1 (en) 2017-04-20 2018-04-20 Combination therapy
EP18721976.1A EP3612839A1 (en) 2017-04-20 2018-04-20 Combination therapy
CN201880038974.5A CN110869765A (zh) 2017-04-20 2018-04-20 组合疗法
US16/605,701 US20200405879A1 (en) 2017-04-20 2018-04-20 Combination therapy
MX2019012462A MX2019012462A (es) 2017-04-20 2018-04-20 Terapia combinada.
US17/819,185 US20230149556A1 (en) 2017-04-20 2022-08-11 Combination therapy

Applications Claiming Priority (20)

Application Number Priority Date Filing Date Title
GBGB1706261.3A GB201706261D0 (en) 2017-04-20 2017-04-20 Combination therapy
GB1706253.0 2017-04-20
GBGB1706258.9A GB201706258D0 (en) 2017-04-20 2017-04-20 Combination therapy
GB1706260.5 2017-04-20
GB1706258.9 2017-04-20
GBGB1706257.1A GB201706257D0 (en) 2017-04-20 2017-04-20 Combination therapy
GB1706256.3 2017-04-20
GBGB1706260.5A GB201706260D0 (en) 2017-04-20 2017-04-20 Combination therapy
GBGB1706259.7A GB201706259D0 (en) 2017-04-20 2017-04-20 Combination therapy
GB1706254.8 2017-04-20
GB1706257.1 2017-04-20
GB1706261.3 2017-04-20
GBGB1706254.8A GB201706254D0 (en) 2017-04-20 2017-04-20 Combination therapy
GBGB1706253.0A GB201706253D0 (en) 2017-04-20 2017-04-20 Combination therapy
GBGB1706256.3A GB201706256D0 (en) 2017-04-20 2017-04-20 Combination therapy
GB1706259.7 2017-04-20
GB1802947.0 2018-02-23
GBGB1802947.0A GB201802947D0 (en) 2018-02-23 2018-02-23 Combination therapy
GB1805660.6 2018-04-05
GBGB1805660.6A GB201805660D0 (en) 2018-04-05 2018-04-05 Combination Therapy

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/605,701 A-371-Of-International US20200405879A1 (en) 2017-04-20 2018-04-20 Combination therapy
US17/819,185 Division US20230149556A1 (en) 2017-04-20 2022-08-11 Combination therapy

Publications (1)

Publication Number Publication Date
WO2018193105A1 true WO2018193105A1 (en) 2018-10-25

Family

ID=62111031

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2018/060215 Ceased WO2018193105A1 (en) 2017-04-20 2018-04-20 Combination therapy

Country Status (10)

Country Link
US (2) US20200405879A1 (https=)
EP (1) EP3612839A1 (https=)
JP (1) JP2020517640A (https=)
KR (1) KR20190137151A (https=)
CN (1) CN110869765A (https=)
AU (1) AU2018253951A1 (https=)
BR (1) BR112019021822A2 (https=)
CA (1) CA3057749A1 (https=)
MX (1) MX2019012462A (https=)
WO (1) WO2018193105A1 (https=)

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110128551A (zh) * 2019-06-05 2019-08-16 上海科弈药业科技有限公司 一种针对cd19+肿瘤的多功能融合蛋白及其应用
WO2020043878A1 (en) * 2018-08-31 2020-03-05 Adc Therapeutics Sa Combination therapy
EP3500299A4 (en) * 2016-08-19 2020-03-25 Beigene, Ltd. USE OF A COMBINATION WITH A BTK INHIBITOR TO TREAT CANCER
WO2020109251A1 (en) * 2018-11-29 2020-06-04 Adc Therapeutics Sa Dosage regime
WO2020249528A1 (en) * 2019-06-10 2020-12-17 Adc Therapeutics Sa Combination therapy comprising an anti-cd19 antibody drug conjugate and a pi3k inhibitor or a secondary agent
US10927117B2 (en) 2016-08-16 2021-02-23 Beigene Switzerland Gmbh Crystalline form of (S)-7-(1-acryloylpiperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetra-hydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US11142528B2 (en) 2013-04-25 2021-10-12 Beigene Switzerland Gmbh Substituted pyrazolo[1,5-a]pyrimidines as Bruton's tyrosine kinase modulators
US11186637B2 (en) 2013-09-13 2021-11-30 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutics and diagnostics
US20220117938A1 (en) * 2019-01-18 2022-04-21 Dracen Pharmaceuticals, Inc. Combinaton therapy with a don prodrug and an immune checkpoint inhibitor
US11377449B2 (en) 2017-08-12 2022-07-05 Beigene, Ltd. BTK inhibitors with improved dual selectivity
JP2022535276A (ja) * 2019-06-07 2022-08-05 アーデーセー セラピューティクス ソシエテ アノニム ピロロベンゾジアゼピン-抗体複合体
US11512132B2 (en) 2014-07-03 2022-11-29 Beigene, Ltd. Anti-PD-L1 antibodies and their use as therapeutics and diagnostics
US11534431B2 (en) 2016-07-05 2022-12-27 Beigene Switzerland Gmbh Combination of a PD-1 antagonist and a RAF inhibitor for treating cancer
WO2023274974A1 (en) 2021-06-29 2023-01-05 Adc Therapeutics Sa Combination therapy using antibody-drug conjugates
US11555038B2 (en) 2017-01-25 2023-01-17 Beigene, Ltd. Crystalline forms of (S)-7-(1-(but-2-ynoyl)piperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US11597768B2 (en) 2017-06-26 2023-03-07 Beigene, Ltd. Immunotherapy for hepatocellular carcinoma
US11786531B1 (en) 2022-06-08 2023-10-17 Beigene Switzerland Gmbh Methods of treating B-cell proliferative disorder
US11786529B2 (en) 2017-11-29 2023-10-17 Beigene Switzerland Gmbh Treatment of indolent or aggressive B-cell lymphomas using a combination comprising BTK inhibitors
RU2822394C1 (ru) * 2019-09-03 2024-07-04 Интра-Селлулар Терапиз, Инк. Способы лечения
EP4410314A1 (en) * 2023-02-02 2024-08-07 ADC Therapeutics SA Combination therapy comprising anti-cd22 antibody-drug conjugate and irak1 inhibitor
US12233069B2 (en) 2019-06-10 2025-02-25 Beigene Switzerland Gmbh Oral solid tablet comprising Bruton's Tyrosine Kinase inhibitor and preparation method therefor

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX2020010523A (es) 2017-02-27 2021-02-09 Third Pole Inc Sistemas y metodos para generar oxido nitrico.
EP3969016A4 (en) 2019-05-15 2023-08-16 Third Pole, Inc. ARCHITECTURES FOR THE PRODUCTION OF NITROUS OXIDE
AU2020343329C1 (en) 2019-09-03 2026-02-12 Intra-Cellular Therapies, Inc. Methods of treatment
US11691879B2 (en) 2020-01-11 2023-07-04 Third Pole, Inc. Systems and methods for nitric oxide generation with humidity control
US20210395905A1 (en) 2020-06-18 2021-12-23 Third Pole, Inc. Systems and methods for preventing and treating infections with nitric oxide
GB202011993D0 (en) 2020-07-31 2020-09-16 Adc Therapeutics Sa ANTI-IL 13Ra2 antibodies
WO2022082072A1 (en) 2020-10-16 2022-04-21 Third Pole, Inc. Nitric oxide generation process controls
MX2023012699A (es) * 2021-04-30 2023-11-21 Hoffmann La Roche Dosificacion para el tratamiento con anticuerpo biespecifico anti-cd20/anti-cd3.
US11975139B2 (en) 2021-09-23 2024-05-07 Third Pole, Inc. Systems and methods for delivering nitric oxide
US12569628B2 (en) 2022-04-14 2026-03-10 Third Pole, Inc. Delivery of medicinal gas in a liquid medium
WO2025249980A1 (ko) * 2024-05-31 2025-12-04 (주)노보메디슨 림프종의 예방 또는 치료를 위한 포셀티닙의 병용투여 요법

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2524929A1 (en) * 2011-05-17 2012-11-21 Sanofi Use of anti-CD19 maytansinoid immunoconjugate antibody for the treatment of CD19+ B-cell malignancies syptoms
EP2550975A1 (en) * 2011-07-29 2013-01-30 Sanofi Combination therapy for the treatment of CD19+ B-cell malignancies symptoms comprising an anti-CD19 maytansinoid immunoconjugate and rituximab
WO2014177617A1 (en) * 2013-05-02 2014-11-06 F. Hoffmann-La Roche Ag Combination therapy of an afucosylated cd20 antibody with a cd22 antibody-drug conjugate

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DK2906298T3 (en) * 2012-10-12 2018-12-17 Adc Therapeutics Sa Pyrrolobenzodiazepine-antibody conjugates
CN104837502B (zh) * 2012-10-12 2018-08-10 麦迪穆有限责任公司 吡咯并苯并二氮杂卓及其结合物
EP3054985B1 (en) * 2013-10-11 2018-12-26 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
GB201506399D0 (en) * 2015-04-15 2015-05-27 Berkel Patricius H C Van And Howard Philip W Site-specific antibody-drug conjugates

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2524929A1 (en) * 2011-05-17 2012-11-21 Sanofi Use of anti-CD19 maytansinoid immunoconjugate antibody for the treatment of CD19+ B-cell malignancies syptoms
EP2550975A1 (en) * 2011-07-29 2013-01-30 Sanofi Combination therapy for the treatment of CD19+ B-cell malignancies symptoms comprising an anti-CD19 maytansinoid immunoconjugate and rituximab
WO2014177617A1 (en) * 2013-05-02 2014-11-06 F. Hoffmann-La Roche Ag Combination therapy of an afucosylated cd20 antibody with a cd22 antibody-drug conjugate

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
BERTRAND COIFFIER ET AL: "A phase II, single-arm, multicentre study of coltuximab ravtansine (SAR3419) and rituximab in patients with relapsed or refractory diffuse large B-cell lymphoma", BRITISH JOURNAL OF HAEMATOLOGY, vol. 173, no. 5, 1 June 2016 (2016-06-01), GB, pages 722 - 730, XP055495740, ISSN: 0007-1048, DOI: 10.1111/bjh.13992 *
LINLIN JIANG ET AL: "A novel antibody-drug conjugate anti-CD19(Fab)-LDM in the treatment of B-cell non-Hodgkin lymphoma xenografts with enhanced anticancer activity", JOURNAL OF DRUG TARGETING, vol. 24, no. 1, 2 January 2016 (2016-01-02), GB, pages 47 - 57, XP055495741, ISSN: 1061-186X, DOI: 10.3109/1061186X.2015.1055568 *
V. BLANC ET AL: "SAR3419: An Anti-CD19-Maytansinoid Immunoconjugate for the Treatment of B-Cell Malignancies", CLINICAL CANCER RESEARCH, vol. 17, no. 20, 14 October 2011 (2011-10-14), pages 6448 - 6458, XP055012063, ISSN: 1078-0432, DOI: 10.1158/1078-0432.CCR-11-0485 *

Cited By (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11142528B2 (en) 2013-04-25 2021-10-12 Beigene Switzerland Gmbh Substituted pyrazolo[1,5-a]pyrimidines as Bruton's tyrosine kinase modulators
US11673951B2 (en) 2013-09-13 2023-06-13 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutics and diagnostics
US11186637B2 (en) 2013-09-13 2021-11-30 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutics and diagnostics
US11512132B2 (en) 2014-07-03 2022-11-29 Beigene, Ltd. Anti-PD-L1 antibodies and their use as therapeutics and diagnostics
US11534431B2 (en) 2016-07-05 2022-12-27 Beigene Switzerland Gmbh Combination of a PD-1 antagonist and a RAF inhibitor for treating cancer
US11970500B1 (en) 2016-08-16 2024-04-30 Beigene Switzerland Gmbh Crystalline form of (s)-7-(1-acryloylpiperidin-4-yl)- 2-(4-phenoxyphenyl)-4,5,6,7-tetra- hydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US10927117B2 (en) 2016-08-16 2021-02-23 Beigene Switzerland Gmbh Crystalline form of (S)-7-(1-acryloylpiperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetra-hydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US11999743B2 (en) 2016-08-16 2024-06-04 Beigene Switzerland Gmbh Crystalline form of (S)-7-(1-acryloylpiperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetra-hydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US11591340B2 (en) 2016-08-16 2023-02-28 Beigene Switzerland Gmbh Crystalline form of (S)-7-(1-acryloylpiperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetra- hydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US11884674B2 (en) 2016-08-16 2024-01-30 Beigene Switzerland Gmbh Crystalline form of (S)-7-(1-acryloylpiperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetra- hydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US11851437B2 (en) 2016-08-16 2023-12-26 Beigene Switzerland Gmbh Crystalline form of (S)-7-(1-acryloylpiperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetra-hydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US11814389B2 (en) 2016-08-16 2023-11-14 Beigene Switzerland Gmbh Crystalline form of (S)-7-(1-acryloylpiperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetra-hydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US12103931B2 (en) 2016-08-16 2024-10-01 Beigene Switzerland Gmbh Crystalline form of (S)-7-(1-acryloylpiperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetra-hydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US11701357B2 (en) 2016-08-19 2023-07-18 Beigene Switzerland Gmbh Treatment of B cell cancers using a combination comprising Btk inhibitors
EP4353747A3 (en) * 2016-08-19 2024-06-26 BeiGene Switzerland GmbH Combination of zanubrutinib with an anti-cd20 or an anti-pd-1 antibody for use in treating cancer
EP3500299A4 (en) * 2016-08-19 2020-03-25 Beigene, Ltd. USE OF A COMBINATION WITH A BTK INHIBITOR TO TREAT CANCER
US11555038B2 (en) 2017-01-25 2023-01-17 Beigene, Ltd. Crystalline forms of (S)-7-(1-(but-2-ynoyl)piperidin-4-yl)-2-(4-phenoxyphenyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide, preparation, and uses thereof
US11597768B2 (en) 2017-06-26 2023-03-07 Beigene, Ltd. Immunotherapy for hepatocellular carcinoma
US11377449B2 (en) 2017-08-12 2022-07-05 Beigene, Ltd. BTK inhibitors with improved dual selectivity
US11786529B2 (en) 2017-11-29 2023-10-17 Beigene Switzerland Gmbh Treatment of indolent or aggressive B-cell lymphomas using a combination comprising BTK inhibitors
IL280968B2 (en) * 2018-08-31 2025-10-01 Adc Therapeutics Sa An anti-CD19 conjugated antibody for use in the treatment of a proliferative disorder in combination with Ventocalx and a pharmaceutical preparation containing the anti-CD19 conjugated antibody and Ventocalx.
IL280968B1 (en) * 2018-08-31 2025-06-01 Adc Therapeutics Sa An anti-CD19 ADC for use in treating a proliferative disorder in combination with Venetoclax and a pharmaceutical composition comprising the anti-CD19 ADC and the Venetoclax.
WO2020043878A1 (en) * 2018-08-31 2020-03-05 Adc Therapeutics Sa Combination therapy
WO2020109251A1 (en) * 2018-11-29 2020-06-04 Adc Therapeutics Sa Dosage regime
US20220117938A1 (en) * 2019-01-18 2022-04-21 Dracen Pharmaceuticals, Inc. Combinaton therapy with a don prodrug and an immune checkpoint inhibitor
CN110128551A (zh) * 2019-06-05 2019-08-16 上海科弈药业科技有限公司 一种针对cd19+肿瘤的多功能融合蛋白及其应用
JP7260677B2 (ja) 2019-06-07 2023-04-18 アーデーセー セラピューティクス ソシエテ アノニム ピロロベンゾジアゼピン-抗体複合体
US11484606B2 (en) 2019-06-07 2022-11-01 Adc Therapeutics Sa Pyrrolobenzodiazepine-antibody conjugates
JP2022535276A (ja) * 2019-06-07 2022-08-05 アーデーセー セラピューティクス ソシエテ アノニム ピロロベンゾジアゼピン-抗体複合体
WO2020249528A1 (en) * 2019-06-10 2020-12-17 Adc Therapeutics Sa Combination therapy comprising an anti-cd19 antibody drug conjugate and a pi3k inhibitor or a secondary agent
US12233069B2 (en) 2019-06-10 2025-02-25 Beigene Switzerland Gmbh Oral solid tablet comprising Bruton's Tyrosine Kinase inhibitor and preparation method therefor
IL288716B2 (en) * 2019-06-10 2026-04-01 Adc Therapeutics Sa Combination therapy that combines an anti-CD19 antibody drug with a PI3K inhibitor or a secondary factor
IL288716B1 (en) * 2019-06-10 2025-12-01 Adc Therapeutics Sa Combination therapy that combines an anti-CD19 antibody drug with a PI3K inhibitor or a secondary factor
CN114302745A (zh) * 2019-06-10 2022-04-08 Adc治疗有限公司 包含抗cd19抗体药物缀合物以及pi3k抑制剂或第二剂的组合疗法
JP2022535609A (ja) * 2019-06-10 2022-08-09 アーデーセー セラピューティクス ソシエテ アノニム 抗cd19抗体薬物複合体とpi3k阻害剤又は二次薬剤を含む併用治療
JP7740994B2 (ja) 2019-06-10 2025-09-17 アーデーセー セラピューティクス ソシエテ アノニム 抗cd19抗体薬物複合体とpi3k阻害剤又は二次薬剤を含む併用治療
RU2822394C1 (ru) * 2019-09-03 2024-07-04 Интра-Селлулар Терапиз, Инк. Способы лечения
WO2023274974A1 (en) 2021-06-29 2023-01-05 Adc Therapeutics Sa Combination therapy using antibody-drug conjugates
US11896596B2 (en) 2022-06-08 2024-02-13 Beigene Switzerland Gmbh Methods of treating B-cell proliferative disorder
US11786531B1 (en) 2022-06-08 2023-10-17 Beigene Switzerland Gmbh Methods of treating B-cell proliferative disorder
US11911386B2 (en) 2022-06-08 2024-02-27 Beigene Switzerland Gmbh Methods of treating B-cell proliferative disorder
WO2024160862A1 (en) * 2023-02-02 2024-08-08 Adc Therapeutics Sa Combination therapy comprising anti-cd22 antibody-drug conjugate and irak1 inhibitor
EP4410314A1 (en) * 2023-02-02 2024-08-07 ADC Therapeutics SA Combination therapy comprising anti-cd22 antibody-drug conjugate and irak1 inhibitor

Also Published As

Publication number Publication date
CA3057749A1 (en) 2018-10-25
US20230149556A1 (en) 2023-05-18
CN110869765A (zh) 2020-03-06
BR112019021822A2 (pt) 2020-05-26
EP3612839A1 (en) 2020-02-26
US20200405879A1 (en) 2020-12-31
AU2018253951A1 (en) 2019-09-19
KR20190137151A (ko) 2019-12-10
MX2019012462A (es) 2020-07-27
JP2020517640A (ja) 2020-06-18

Similar Documents

Publication Publication Date Title
US20230149556A1 (en) Combination therapy
US11596696B2 (en) Combination therapy with an anti-CD25 antibody-drug conjugate
JP2020517640A5 (https=)
US20200129638A1 (en) Combination therapy with an anti-psma antibody-drug conjugate
JP2020517629A5 (https=)
KR20220020332A (ko) 항-cd19 항체 약물 접합체 및 pi3k 억제제 또는 2차 제제를 포함하는 조합 요법
EP3843748B1 (en) Combination therapy
US20230132256A1 (en) Combination therapy
US20230099010A1 (en) Combination therapy
WO2022074033A1 (en) Combination therapy
EA046551B1 (ru) Комбинированная терапия

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18721976

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2018253951

Country of ref document: AU

Date of ref document: 20180420

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3057749

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019556889

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019021822

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20197033821

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018721976

Country of ref document: EP

Effective date: 20191120

ENP Entry into the national phase

Ref document number: 112019021822

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20191017