WO2018175581A1 - A GENETICALLY MODIFIED MOUSE EXPRESSING HUMAN APOE4 MOUSE Trem2.p.R47H AND METHODS OF USE THEREOF - Google Patents

A GENETICALLY MODIFIED MOUSE EXPRESSING HUMAN APOE4 MOUSE Trem2.p.R47H AND METHODS OF USE THEREOF Download PDF

Info

Publication number
WO2018175581A1
WO2018175581A1 PCT/US2018/023565 US2018023565W WO2018175581A1 WO 2018175581 A1 WO2018175581 A1 WO 2018175581A1 US 2018023565 W US2018023565 W US 2018023565W WO 2018175581 A1 WO2018175581 A1 WO 2018175581A1
Authority
WO
WIPO (PCT)
Prior art keywords
mouse
compound
trem2p
apoe4p
human
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/023565
Other languages
English (en)
French (fr)
Other versions
WO2018175581A8 (en
Inventor
Gareth Howell
Michael SASNER
Gregory Carter
Bruce Lamb
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Jackson Laboratory
Indiana University Research and Technology Corp
Original Assignee
Jackson Laboratory
Indiana University Research and Technology Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN201880031011.2A priority Critical patent/CN110891417B/zh
Priority to EP18770741.9A priority patent/EP3599842B1/en
Priority to US16/496,261 priority patent/US11957115B2/en
Priority to AU2018239433A priority patent/AU2018239433B2/en
Priority to JP2019552004A priority patent/JP7623785B2/ja
Priority to CA3057289A priority patent/CA3057289A1/en
Application filed by Jackson Laboratory, Indiana University Research and Technology Corp filed Critical Jackson Laboratory
Publication of WO2018175581A1 publication Critical patent/WO2018175581A1/en
Publication of WO2018175581A8 publication Critical patent/WO2018175581A8/en
Anticipated expiration legal-status Critical
Priority to JP2023023328A priority patent/JP2023056032A/ja
Priority to US18/605,786 priority patent/US20240315220A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • A01K67/0275Genetically modified vertebrates, e.g. transgenic
    • A01K67/0278Knock-in vertebrates, e.g. humanised vertebrates
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • A01K67/0275Genetically modified vertebrates, e.g. transgenic
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/775Apolipopeptides
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G01N33/6896Neurological disorders, e.g. Alzheimer's disease
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • A01K2217/054Animals comprising random inserted nucleic acids (transgenic) inducing loss of function
    • A01K2217/056Animals comprising random inserted nucleic acids (transgenic) inducing loss of function due to mutation of coding region of the transgene (dominant negative)
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/07Animals genetically altered by homologous recombination
    • A01K2217/072Animals genetically altered by homologous recombination maintaining or altering function, i.e. knock in
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/15Animals comprising multiple alterations of the genome, by transgenesis or homologous recombination, e.g. obtained by cross-breeding
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0306Animal model for genetic diseases
    • A01K2267/0312Animal model for Alzheimer's disease
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value

Definitions

  • the present invention relates generally to genetically modified mice useful as models of hitman Alzheimer disease.
  • the present invention relates to genetically modified mic expressing human APOE4 and mouse Trem2 p,R47H and methods of use thereof.
  • AD Alzheimer's disease
  • Familial or early-onset Alzeimer's disease is caused by mutations in, or overexpression of, the amyloid precursor protein (AFP) gene or mutations in presenilm genes (PSENl or PSEN2). All of these lead to increased production of the Abeta42 peptide, which is thought to be neurotoxic, Dozens if not hundreds of mouse models that mimic aspects of familial Alzeimer's disease have been created. Many treatments have been shown to be effective i these familial Alzeimer's disease mouse models, but none have been effective when tested in clinical trials.
  • AFP amyloid precursor protein
  • PSENl or PSEN2 presenilm genes
  • Late-onset Alzheimer's disease which accounts for 95-98% of the human Alzheimer's disease patient population, does not have a simple and defined genetic etiology. Late-onset Alzheimer's disease is thought to be a multifactorial syndrome caused by a variety of genetic and environmental causes interacting with the aging process. Because of this complexity, the genetic causes are still not fully understood and no useful mouse models of late-onset Alzheimer's disease in humans have been reported to date. SUMMARY OF THE INVENTION
  • a genetically modified mouse characterized by one or more symptoms or signs associated with expression of human APOE4p and mouse Trem2p and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genome of the mouse includes: 1) a DNA sequence encoding a human APOE4 protein (APOE4p), the DNA sequence encoding A.POE4p operably linked to a promoter; and 2) a DNA sequence encoding a mouse Trem2 protein havin a mutation p,R47H (Trem2p), the DNA sequence encoding T.rem2p operably linked to a promoter, and wherein the mouse expresses human APOE4p and mouse Treni2p.
  • the mouse is homozygous for the DNA sequence encoding APOE4p and for the DNA sequence encoding Trem2p.
  • a genetically modified .mouse characterized by one or more symptoms or signs associated with expression of human APOE4p and mouse Trem2 and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genome of the mouse includes: 1) a DNA sequence encoding a human.
  • APQE4 protein APGE4p
  • the DNA sequence encoding APOE4p operably linked to a promoter and 2) a DNA sequence encoding a mouse Trem2 protein having a mutation p,R47H (Trem2p), the DNA sequence encoding Trern2p operably linked to a promoter, wherein the mouse expresses human APOE4 and mouse Trem2p, and wherein the APOE4p includes an amino acid sequence of: SEQ ID NO:l 5 or the APOE4p is encoded by the complement of a nucleic acid which hybridizes to SEQ ID NO:2 under highly stringent hybridization conditions.
  • the mouse is homozygous for the DNA sequence .encoding APOE4p and for the DNA sequence encodin Trem2p.
  • a genetically modified mouse characterized by one or more symptoms or signs associated with expression of human APOE4 and mouse Treni2p and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genome of the mouse includes: 1) a DNA sequence encoding a human APQE4 protein (APOE4p), the DNA sequence encoding APOE4p operably linked to a promoter; and 2) a DNA sequence encoding mouse Trem2 protein having a mutation p,R47H (Trem2p), the DNA sequence encoding Trem2p operably linked to a promoter, wherein the mouse expresses human APOE4p and mouse Trem2p.
  • APOE4p human APQE4 protein
  • Trem2p mouse Trem2 protein having a mutation p,R47H
  • the mouse Xrem2p includes an amino acid sequence of: SEQ ID NO; 3.
  • the mouse Trem2p is encoded by the complement of a nucleic acid which hybridizes to SEQ ID NO:4 ' under highly stringent hybridization conditions.
  • the mouse is homozygous for the DNA sequence encoding APOE4p and for the DNA sequence encoding Trem2p.
  • a genetically modified mouse characterized by one or more symptoms or signs associated with expression of human APOE4p and mouse Trem2p and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present inventio wherein the genom of the mouse includes: 1) a DNA sequence encodin a human APOE4 protein (APOE4p), the DNA sequence encoding APOB4p operably linked to a promoter; and 2) a DNA sequence encoding a mouse Trem2 protein havin a mutation p.R47H (Tren ⁇ p).
  • the mouse expresses human APOE4p and mouse Trem2p, wherein the APOE4 includes an amino acid sequence of; SEQ ID NO:l, or the APOE4p is encoded by the complement of a nucleic acid which hybridizes to SEQ ID NO:2: under highly stringent hybridization conditions, and wherein the mouse Trem2 includes an amino acid sequence of; SEQ ID NO:3, or the mouse Trem2p is encoded b the complement of a nucleic acid which hybridizes to SEQ ID NQ:4 under highly stringent hybridization conditions.
  • the mouse Is homozygous for the DNA sequence encoding APOE4 and for the DNA sequence encoding Trernlp.
  • a geneticall modified mouse characterized b one or more symptoms or signs associated with expression of human APOE4p and mouse Trem2p and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genetically modified mouse is a B6($JL) ⁇ Apoe lm! i(AP0E* ⁇ Ad ' t 7'rem2 e ' / /l mouse whose genome includes: 1) a DNA sequence encoding human APOE4 protein (APOE4p), the DNA sequence encoding APOE4p operably linked to a promoter; and 2) a DNA sequence encoding mouse Trem2 protein having a mutatio p.R47H (Trem2p).
  • a method for screening for a treatment for use in the treatment of Alzheimer's disease including administering a treatment to a .
  • the genome of the moose includes: 1) a DNA sequence encoding a human APOE4 protein (APOE4p), the DNA sequence encoding APOE4p operably linked to a promoter; and 2) a DNA sequence encoding a mouse Trem2 protein having a mutation p.R47H (Trem2p),. the DNA sequence encoding Trem2p operabl linked to a promoter, and wherein the mouse expresses human APOE4p and mouse Trem2p; and assessing an effect of the treatment on .
  • APOE4p human APOE4 protein
  • Trem2p mouse Trem2 protein having a mutation p.R47H
  • assessing an effect of the treatment includes comparing the effect of the treatment on the genetically modified mouse with a control.
  • the control includes administering the treatment to a mouse which does not express human APOE4p and mouse Trem2p and assessing an effect of the treatment on the mouse which does not express human APOE4 and mouse Trem2p,
  • the control includes administering the treatment to a wild-type C57BL 6J mouse and assessing an effect of the treatment o the wild-type C57BL 6J mouse.
  • the control includes administering the treatment to an APOE3 -expressing mouse and assessing an effect of the treatment on the APOE3 -expressing mouse.
  • a method for screening for a treatment for use in the treatment of Alzheimer's disease including administering a treatment to a geneticall modified mouse characterized by one or more symptoms or signs associated with expression of human APOE4p and mouse Trem2p and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genome of the mouse includes: 1 ) a DNA sequence encoding a human APOE4 protein (APOE4p), the D A sequence encoding APOE4p operabl linked to a promoter; and 2) a DNA sequence encoding a mouse Trem2 protein having a mutation p.R47H (Trem2p), the DNA sequence encoding Trem2p operably linked to a promoter.
  • APOE4p human APOE4 protein
  • Trem2p mouse Trem2 protein having a mutation p.R47H
  • the mouse expresses human APOE4p and mouse Trem2p, and wherein the APOE4p includes an amino acid sequence of: SEQ ID NO:!,, or the APOE4p is encoded by the complement of a nucleic acid whic hybridizes to SEQ ID N();2 under highly stringent hybridization conditions; and assessing an effect of the treatment on one or more symptoms or signs associated with expression of human APOE4 and mouse Trem2p relevant to non- familial late-onset Alzheimer's disease on the mouse.
  • the mouse is homozygous for the DNA sequence encoding APOE4 and for the DNA sequence encoding Trem2p.
  • assessing an effect of the treatment includes comparing the effect of the treatment on the genetically modified mouse with a control.
  • the control includes administering, the treatment to a mouse which does not express human APOE4p and mouse Trem2p and assessing an effect of the treatment, on the mouse which does not express human APOE4p and mouse Trem2p.
  • the control includes administering the treatment to a wild-type C57BL/6J mouse and assessing an effect of the treatment on the wild-type C57BL/6J mouse.
  • the control includes administering the treatment to an APOE3 -expressing mouse and assessing an effect of the treatment o the APOE3 ⁇ expressing mouse.
  • a method for screening for a treatment for use in the treatment of Alzheimer's disease including, administering a treatment to a genetically modified mouse characterized by one or more symptoms or signs associated with expression of human APOE4p and mouse Trem2p and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genome of the mouse includes: 1) a DMA sequence encoding a human APOE4 protein (APOE4p), the DNA sequence encoding APOE4p operably linked to a promoter; and 2) a DNA sequence encoding a mouse Trem2 protein having a mutation p,R.47H (Trem2p), the DNA sequence encoding Trem2p operably linked to a promoter, wherein the mouse expresses human APOE4p and mouse Trem2p, and wherein the mouse Trem2p includes an amino acid sequence of: SEQ ID NO;3 s o the mouse Trem2p is encoded by
  • the mouse is homozygou for the DNA sequence encoding APOE4p and for the DNA sequence encoding Trem2p.
  • assessing an effect of the treatment includes comparing the effect of the treatment on the genetically modified mouse with a control.
  • the control includes administering the treatment to a mouse which does not express human APOE4p and mouse Trem2p and assessing an effect of the treatment on the mouse which does not express human APQE4p and mouse Trem2p.
  • the control includes administering the treatment to a wild-type C57BL/6J mouse and assessing an effect of the treatment on the wild-type C57BL/63 mouse.
  • the control includes administering the treatment to an APOE3 -expressing mouse and assessing an effect of the treatment on the APOE3 -expressing mouse,
  • a method for screening for a treatment for use in the treatment of Alzheimer's disease including administering a treatment to a genetically modified mouse characterized by one or more symptoms or signs associated with expression of human APOE4p and mouse Trem2p and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genom of the mouse includes: 1 ⁇ a DNA sequence encoding a human APOE4 protein (APOE4p), the DNA sequence encoding ⁇ operabiy linked to a promoter; and 2) a DNA sequence encoding a mouse Trem2 protein having a mutation p.R47H (Treni2p), the DNA sequence encoding Trem2p operabiy linked to a promoter, wherein the mouse expresses human APOE4p and mouse Trem2p, wherein the APOE4p includes an amino acid sequence of: 8EQ ID NO: 1 , or the APOE4 is encoded by the complement of
  • the mouse Is homozygous for the DNA sequence encoding APOE4p and for the DNA sequence encoding Trem2p.
  • assessing an effect of the treatment includes comparing the effect of the treatment on the genetically modified mouse with a control.
  • the control includes administering the treatment to a mouse which does not express human APOE4 and mouse Trem2p and assessing an effect of the treatment on the mouse which does not express human APOE4p and mouse Trem2p.
  • the control includes administering the treatment to a wild-type C57BL/6J mouse and assessing an effect of the treatment on the wild-type C57BL/6J mouse.
  • the control includes administering the treatment to an APOE3 -expressing mouse and assessing an effect of the treatment on the APQE3 ⁇ expressmg mouse.
  • a method for screening for a treatment for use in the treatment of Alzheimer's disease including administering a treatment to a genetically modified mouse characterized by one or more symptoms or signs associated with expression of human APOE4p and mouse Trem2p and relevan to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein- the genetically modified mouse: is a 6( ⁇ JL)-Apoe tmls(APOi/*4 ⁇ ' 1) a DMA sequence encoding human APOE4 protein (APOE4p), the DNA sequence encoding APOE4p operabiy Linked to a promoter; and 2) a DNA sequence encoding mouse Trem2 protein havin a mutation p,R47H (Trem2p), the DNA sequence encoding Trem2p operabiy linked to a promoter, wherein the mouse is homozygous for the DNA sequence encoding APOE4p and
  • assessing an effect of the treatment includes comparing the effect of the treatment on the genetically modified mouse with a control.
  • the control includes administering the treatment to a mouse which does not expres human APOE4p and mouse Trem2p and assessing an effect of the treatment on the mouse which does not express human APOE4p and mouse Trem2p.
  • the control includes administering the treatment to a wiid-type C57BL/6J mouse and assessing an effect of the treatment on the wild-type C57BL 6J mouse.
  • the control includes administering the treatment to an APGE3 -expressing mouse and assessing an effect of the treatment on the APOE3 -expressing mouse.
  • a method for screening for compound for us ⁇ in the treatment of Alzheimer's disease including administering a compound to a genetically modified mouse characterized by one or more symptoms or signs associated with expression of human APOE4p and mouse Trem2 and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genome of the mouse includes: 1) a DNA sequence encoding, a human APOB protein (APOE4p).
  • APOE4p human APOB protein
  • the DNA sequence encoding APOE4p operably linked to a promoter and 2) a DNA sequence encoding a mouse Trem2 protein having a mutation p.R47H (Trem2p), the DNA sequence encoding Trem2p operably linked to a promoter, and wherein the mouse expresses human APOE4p and mouse Trem2p; and assessing an effect of the compound on one or more symptoms or signs associated with expression of human APOE4 and mouse Trem2p relevant to non-familial, late-onset Alzheimer's disease on the mouse.
  • Trem2p a mutation p.R47H
  • the mouse is homozygous for the DNA sequence encoding APOE4p and for the DNA sequence encoding Treni2p
  • assessing an effect of the compound includes comparin the effect of the compound on the genetically modified mouse with a control.
  • the control includes administering the .compound to a mouse whic does not express human APOE4 arid mouse Trem2 and assessing an effect of the compound on the mouse which does not express human APOE4p and mouse Trem2p.
  • the control includes administering, the compound to a wild-type C57BL 6J mouse and assessing an effect of the compound on the wild-type C57BL/6J mouse.
  • the control includes administering the compound to an APOE3 ⁇ expressing mouse and assessing an effect of the compound on the APOE3 ⁇ expressing mouse.
  • a method for screening for a compound for use in the treatment of Alzheimer's disease including administering a compound to a genetically modified mouse characterized by one or more symptoms or signs associated with expression of human APGE4p and mouse Trem2p and.
  • the genome of the mouse includes: i) a DN A seq uence encoding a human APOE4 protein (APOE4p), the DNA sequence encoding APOE4p operably linked to a promoter; and 2) a DNA sequence encoding a mouse Trem2 protem having a mutation p.R 7H (Trem2p), the DNA sequence encodin Trera2p operably linked to a promoter, wherein the mouse expresses human APOE4p and mouse Trem2p, and wherein the APOE4p includes an.
  • APOE4p DN A seq uence encoding a human APOE4 protein
  • Trem2p mouse Trem2 protem having a mutation p.R 7H
  • the mouse is homozygous fo the DNA sequence encoding APOE4p and for the DNA sequence encoding Trern2p
  • assessing an effect of the compound includes comparing the effect of the compound on the genetically modified mouse with a control
  • the control includes administering the compound to a mouse which doe not express human APOE4p and mouse Trem2p and assessing an effect of the compound on the mouse which does not express human APOE4p and mouse TrernSp, Accordmg to aspects of the present
  • a method for screening for a compound for use in the treatment of Alzheimer's disease including administering a compound to a genetically modified mouse characterized by one or more symptoms or signs associated with expression of human APOE4 and mouse Trem2p and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genome of the mouse includes: 1) a DNA sequence encoding a human APOE4 protein (APOE4p), the DNA sequence encoding APOE4p operably linked to a promoter; and 2) a DNA sequence encoding a mouse Trem2 protein having a mutation p.R47H (Trerft2p) 3 the DNA sequence encoding Trem2p operabl linked to a promoter, wherein the mouse expresses human APOB4p and mouse rem2p, and wherei the mouse Trem2p includes an amino acid sequence of: SEQ ID NO: 3, or the mouse Trem2p is encoded by the
  • the mouse is homozygous for the DNA sequence encoding APOE4p and for the DNA sequence encoding Ireni2p.
  • assessing an effect of the compound include comparing the effect of the compound on the genetically modified mouse with a control .
  • the control includes administering the compound to a mouse which does not express human APOE4 and mouse Tre lp and assessing an effect of the compound on the mouse which does not express human APOE4 and mouse Trem2p.
  • the control includes administering the compound to a wild-type C57BL/6J mouse and assessing an effect of the compound on the wild-type C57BL/6J mouse.
  • the control includes administering the compound to an APOE3-expressittg mouse and assessing an effect of the compound on the APOE3- expressing mouse.
  • a method for screening for a compound for use in the treatment of Alzheimer 's disease including administering a compound to a genetically modified mouse characterized by one or more symptoms or signs associated with expression of human AP0B4p and mouse Trem2p and relevant to non- famiiial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genome of the mouse includes: 1 ⁇ a DMA sequence encoding a human APOE4 protein (APOE4p), the DNA sequence encoding APOE4p operably linked to a promoter; and 2) a DN sequence encoding a mouse Trem2 protein having a mutation p,R47H (Trem2p), the DNA sequence encoding Trem2p operabl linked to a promoter, wherein the mouse expresses human AP0E4p and mouse Tre 2p, wherein the APOE4p includes an amino acid sequence of: SEQ ID NO:l, or the
  • the mouse is homozygous for the DNA sequence encoding APOE4p and for the DNA sequence encoding Trem2p
  • assessing an effect of the compound includes comparing the effect of the compound on the genetically modified mouse with a control.
  • the control includes admimsterrag the compound to a mouse which does not express human APOE4p and mouse Trem2p and assessing an effect of the compound on the mouse which does not express human APOE4p and mouse Treni2p.
  • the control includes administering the compound to a wild -type C57BL/6J mouse and assessing an effect of the compound on the wild-type C57BL/6J mouse.
  • the control includes axini stering the compound to an APOE3 -expressing mouse and assessing an effect of the compound on the APOE3 -expressing mouse.
  • a method for screening for a compound for use in the treatment of Alzheimer's disease including administering a compound to a genetically modified mouse characterized by one or more s ⁇ n toms or signs associated with expressio of human APOE4p and mouse Trem2p and relevant to non- familial late-onset Alzheimer's disease is provided according to aspects of the present invention wherein the genetically modified mouse is a &6($TL Apoe U(A' P&&*4 Aattff Trem2 e mj I mouse whose genome includes: 1) a DNA sequence encoding human APOE4 protein (APOE4p), the DNA sequence encoding APOE4p operably linked to a promoter; and 2) a DNA sequence encoding mouse Trem2 protein having a mutation p.R47H (Trem2p), the DNA sequence encoding Trem2 operably linked to a promoter, wherein the mouse is homozygous for the DNA sequence encoding
  • the mouse is homozygous for the DNA sequence encoding APOE4 and for the DNA sequence encoding Trem2p.
  • assessing an effect of the compound includes comparing the effect of the compound on the genetically modified mouse with a control
  • the control includes administering the compound to a mouse which does not express human APOE4p and mouse Trem2p and assessing an effect of the compound on the mouse which does not express human APOE4p and mouse Trem2p
  • the control includes administering the compound to a wild-type C57BL 6J mouse and assessing an effect of the compound on the wild-type C57BL/6 J mouse.
  • the control includes administering the compound to an APOE3 -expressing mouse and assessing an effect of the compound on the APOE3 -expressing mouse.
  • Figure 1 is a schematic diagram of a humanized ApoE4 expression construct described in detail in examples herein.
  • FIG. 2 is an image of a Western blot of brain tissue from B6(SJL) ⁇ (common name: B6J.APOE4/Trem2) mice (lanes 4-6) and control (wild-type (WT) C57BL/6J (abbreviated B6J) mice (lanes 1-3) brain tissue.
  • B6(SJL) ⁇ common name: B6J.APOE4/Trem2 mice
  • WT wild-type C57BL/6J
  • Figure 3A is a graph showing results of an assay for high density lipoprotein •(HDL) in blood samples obtained from 12 month old B6.EAPOE4/Trem2 mice and 12 month old C57BL/6J control mice,
  • Figure 3B is a graph showing results of an assay for low density lipoprotein (LDL) in blood samples obtained from 12 month old B6J.APQE4/Trem2 mice and 12 month old C57BL/6J control mice.
  • LDL low density lipoprotein
  • Figure 3C is a graph showing results of an assa for total cholesterol in blood samples obtained from 12 month old B6J.APOE4/Trem2 mice and 12 month old C57BL 6J control mice.
  • Figure 4 shows representative images of B6J.APOE4/Trem2 tissue at 7-8 months of age immunostained to show Collagen IV (Col IV) and Ftbrin(ogen) along with representative images from similar sagittal sections of brain from control C57BL/6J (abbreviated B6J) mice which were similarly immunostained.
  • Figure 5 is a. gene expression heatmap of differentially-expressed genes in B6J.APOE4/Trem2 mice compared to wild-type control B6J mice.
  • the present invention relates generally to a genetically modified mous which is a model of non-familial late-onset Alzheimer's disease and which encodes two exogenously introduced risk factors for non-familial late-onset AD in its genome, such that the mouse produces human apolipoprotein E4 (APOE4) and mouse Trem2 p.R47H proteins.
  • APOE4 human apolipoprotein E4
  • Human apolipoprotein is a polymorphic protein with three isoforms designated ApoE2. ApoE3 and ApoE4. These three isoforms differ from each other with respect to the identity of amino acids at positions 130 and 176 In the amino acid sequence of the proteins (corresponding to positions 112 and 158 in the mature APOF protein without the 18 amino acid signal peptide).
  • a oE2 is characterized by cysteine at bot 130 and 176
  • ApoE3 is characterized by cysteine at 130 and arginine at 176
  • ApoE4 is characterized by arginine at both 130 and 17-6
  • Treml triggering receptor expressed on myeloid cells 2
  • myeloid cells 2 is an immune phagocytic receptor expressed b brain microglia
  • Treml triggers phagocytosis of cell debris and regulates aspects of the inflammatory response.
  • the present invention relates to a genetically modified mouse whose genome includes a DNA sequence encoding human APOE protein and a DNA sequence encoding mouse Treml protein having the R47H point mutation.
  • a human APOE4 DNA sequence (hereinafter APOE4g) encoding human APOE4 protein (hereinafter APC)E4p o "human APOE4") is shown herein as SEQ ID NO:2.
  • An encoded APOE4p is shown herein as SEQ ID NO:l.
  • Trem2.g A mouse mutant Treml DNA sequence (hereinafter Trem2.g) encoding mouse Treml protein having the R47H point mutation (hereinafter Tremlp or "mouse Tremlp”) is shown herein as SEQ ID NO:4.
  • Tremlp an encoded Tremlp i shown herein as SEQ ID NO;3,
  • One or more genetic modifications can he introduced into a mouse genome to encode a variant of APOE4p and/or a variant of Tremlp i a genetically modified mouse according to embodiment of methods of the present invention.
  • variant refers to APOE4p or Trem2p containing one or more mutations in it amino acid sequence compared to the corresponding protein of SEQ ID NO:l or SEQ ID NO:3.
  • mutations can be one or more amino acid substitutions, additions, and/or deletions, so long as the variant of APOE4p or Tremlp retains the functional characteristics of APOE4p or Tremlp of SEQ ID NQ:1 or SEQ ID NO; 3, respectively.
  • a variant APOE4p according to embodiments of the present .invention has: at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to SEQ ID NO: ⁇ over its entire length, and has -(Arginine) and R (Arginine) as amino acids 130 and 176 of the APOE4 protein including an 18 amino acid signal peptide, shown, herein as SEQ ID NO:l , as well as retains the functional characteristics of APOE4p of SEQ ID O:L
  • a variant APOE4 according to embodiments of the present invention has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to SEQ ID NO: 15 over its entire length, and has R (Arginine) and R Arginine) as amino acids 1 12 and 158 of the APQE4 protein not including the 18 amino acid signal peptide, shown herein as SEQ ID NO: 15, as well as retains the functional characteristics of APGE4p of SEQ ID NO: 15.
  • a variant Trem2 according to embodiments of the present invention has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater identity to SEQ ID NO: 3 over its entire length and retains the functional characteristics of Trem2p of SEQ ID NO :3...
  • Mutations can be introduced using standard molecular biology techniques, such as CRISPR technology,. Alternative techniques include site-directed mutagenesis and PGR- mediated mutagenesis and the like, One of skill in the art will recognize that one or more amino acid mutations can be introduced without altering the ' functional properties of APOE4p and mouse Trem2p proteins.
  • Conservative ainino acid substitutions can be made in APOE4p and Trexn2 proteins to produce APOE4p and Trem2p variants.
  • Conservative amino acid substitutions are art recognized substitutions of one amino acid for another ammo acid having similar characteristics.
  • each amino acid ma be described as having one or more of the following characteristics: electropositive, electronegative, aliphatic, aromatic, polar, hydrophobic and hydrophilic.
  • a .conservative substitution is a substitutioa of one amino acid having a specified structural or functional characteristic for another amino acid having the same characteristic.
  • Acidic amino acids include aspartate, glutamate; basic amino acids include histidine, lysine, arginine; aliphatic amino acids include isoleucine, leucine and valine; aromatic amino acids include phenylalanine, glycine, tyrosine and tryptophan; pola amino acids include aspartate, glutamate, histidine, lysine, asparagine, glutamine, arginine, serine, threonine- and tyrosine: and hydrophobic amino acids include alanine, cysteine, phenylalanine, glycine, isoleucine, leucine, methionine, proline, valine and tryptophan; and conservative substitutions include substitution among amino acids within each group. Amino acids may also be described in terms of relative size, alanine, cysteine, aspartate, glycine, asparagine, proline, threonine, serine, valine, all typically considered to be
  • APOE4p and Trem2p variants can include synthetic amino acid analogs, amino acid derivatives and/or non-standard amino acids, illustratively including, without limitation, aipha-am obttiyrtG acid, ciiruliine, canavanine, cyanoalanine, diaminobutyric acid, diam opimelic acid, dihydrox -phenyl alaniise, djenkolic acid, homoarginine, hydroxyproline, norleucine, norvaline, 3-phosphoserme, homoserine, 5-hydroxytryptophan, l-methylhistidine, 3-methylhistidine, and ornithine,
  • nucleic acid sequences other than SEQ ID NO:2 and SEQ ID NO:4 encode APGE4p and Trenfip, respectively, and that such alternate nucleic acids may be introduced into a mouse genome to produce a geneticall modified mouse expressing APQE4p and Trem2p of the disclosure.
  • expressing and “expresses” refer to transcription of a gene to produce a coiTesponding m NA and/or translation of the n RNA to produce the corresponding protein.
  • APOE4p and Trem2p variants are encoded by nucleic acids having a high degree of identity with SEQ ID NO:2 or SEQ ID NO:4, respectively.
  • the complement of a nucleic acid encoding an APOE4p variant specificall hybridizes with SEQ ID NQ:2 encoding APOE4p under high stringency conditions.
  • the complement of a nucleic acid encoding a Trem2p variant specifically hybridizes with SEQ ID NO:4 encoding Tren 2p under high stringency conditions
  • nucleic acid refers to R A or DNA molecules having more than one nucleotide in any form including single-stranded, double-stranded, oligonucleotide or polynucleotide.
  • nucleotide sequence refers to the ordering of nucleotides in an oligonucleotide or polynucleotide in a single-stranded form of nucleic acid.
  • hybridization and “hybridizes” refer to pairing and binding of complementary nucleic acids. Hybridization occurs to varying extents betwee two. nucleic acids depending on factors such as the degree of complementarity of the nucleic acids, the melting temperature, Tm, of the nucleic acids and the stringency of hybridization conditions, as is well known in the art.
  • stringency of hybridization conditions refers to conditions of temperature, ionic strength, and composition of a hybridization medium with respect to particular common additives such as formamide and Denhard s solution.
  • Intermediate stringency conditions are exemplified by conditions under which nucleic acids having intermediate complementarity, about 50-84% complementarity, as well as those having a high degree of complementarity, hybridize.
  • low stringency hybridization conditions ar those in which nucleic acids having a low degree of complementarity hybridize
  • hybridization and “specifically hybridizes” refer to hybridization of a particular nucleic acid to a target nucleic acid without substantial hybridization to nucleic acids other than the target nucleic acid in a sample.
  • An example of high stringency hybridization conditions is hybridization of nucleic acids over about 100 nucleotides in length in a solution containing 6X SSC. 5X Denhardt's solution, 30% formamide* and 100 micrograms/ml denatured salmon sperm at 37°C overnight followed by washing in a solution of 0.3X SSC and 0.1 % SDS at 60°C for 15 minutes. SSC is 0..15M NaCi/0,015M Na citrate. Denliardt's solution is 0.02% bovine serum. albumin/0,02% FICOLL 0,02% polyvinylpyrrolidone.
  • temi ''complementary refers to Watson-Crick base pairing between nucleotides and specifically refers to nucleotides hydrogen bonded to one another with thymine o uracil residues linked to adenine residues by two hydrogen bonds and cytosine and guanine residues linked by three hydrogen bonds.
  • a nucleic acid includes a nucleotide sequence described as having a "percent complementarity" t a specified second nucleotide sequence.
  • a nucleotide sequence may have 80%, 90%, or 100% complementarity to a specified second nucleotide sequence, indicating that 8 of 10, 9 of 10 or 10 of 10 nucleotides of a sequence are complementary to the specified second nucleotide sequence.
  • the nucleotide sequence 3' -TCGA-5' is 100% complementary to the nucleotide sequence 5' ⁇ AGCT ⁇ 3 ⁇
  • the nucleotide sequence J'-TCGA- is 100% complementary to a region of the nucleotide sequence 5 ! -TTAGCTGG-3 ⁇
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic aeid sequence for optimal alignment with a second amino acid or nucleic acid sequence).
  • the amino aeid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
  • the two sequences are the same length or differ in length by no more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%. 9% or 10% of the total length of the reference sequence,
  • the determination of percent identit between two sequences can also be accomplished using a mathematical algorithm.
  • a preferred, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm, of Karlin and Altsehul, 1990, PNAS 87:2264 2268, modified as in Karlin and Altschul, 1993, PNAS, 90:5873 5877. Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul el a!,, 1990, J. Mo!, Biol. 215:4-03.
  • BLAST nucleotide searches are performed with the NBLAST nucleotide program parameters set, e.g., for score-lOO, wordlength ::: T 2 to obtain nucleotide sequenees homologous to a nucleic aeid molecules of the present invention.
  • BLAST protein searches are performed with the XBLAST program parameters set, e.g., to score 50. wordleftgtb-3 to obtain amino acid sequences homologous to a protein molecule of the present invention.
  • Gapped BLAST are utilized as described in Altschul et al, 1997, Nucleic Acids Res. 25:3389 3402.
  • PSX BLAST Is used to perform an iterated search which deteets distant relationships between molecules (Id.).
  • the default parameters of the respective programs e.g., of XBLAST and NBLAST
  • Another preferred, non- limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, 1988, CABIQS 4:11 17. Such an algorithm is incorporated in the ALIGN program, (versio 2.0) which is part of the GCG sequence alignment software package.
  • ALIGN program a P AMI 20 weight residue table, a gap length penalty of 12, and a gap penalty of 4 is used.
  • the percent identit between two sequences is determined using techniques similar to those described above, with or without allowing gaps. In calculating percent identity, typically only exact matches are counted.
  • Nucleic acids encoding APGE4p, Trem2p or a variant of either thereof can be isolated from natural sources, generated recombinant ⁇ or made b chemical synthetic techniques using well-known methodology,
  • mice Genetically modified mice
  • a genetically modified mouse is provided according to embodiments of the present invention whose genome includes a nucleic acid encoding APOE4 operably linked to a promoter, wherein the animal expresses the encoded APOE4p, and whose genome includes a nucleic acid encoding Trem2p operably linked to a promoter, wherein the animal expresses the encoded Trem2p.
  • a genetically modified mouse is provided according to embodiments of the present invention whose genome includes a nucleic acid encoding APOE4 operably linked to the endogenous mouse Apoe promoter, wherein the animal expresses the encoded APOE4p and whose genome includes a nucleic acid encoding Tren 2p operably linked to the endogenous mouse Trem2 promoter, wherein the animal expresses the encoded Trem2p.
  • An of various methods can be used to introduce a genetic modification into a mouse genome to produce a genetically modified mouse expressing. AFGE4 and Trem2p.
  • Genome editing methods for generating a genetically modified mouse whose genome includes a nucleic acid encoding APOE4p operably linked to a promoter, -wherein the animal expresses the encoded APOE p and whose genome includes a nucleic acid encoding ' Tremlp operably linked to a promoter, wherein the animal expresses the encoded Trem2p, include, but are not limited to, site directed mutagenesis, recombination-based methods and nuclease genome editing techniques.
  • Genome editing techniques can be used to modify a genomic sequence by introduction of a discrete mutation at a predetermined target site in the genome,
  • one or more nucleotides in a genomic sequence can he replaced with one or more different nucleotides using a genome editing technique so that the genomic sequence encodes a protein with a single amino acid difference, or multiple amino acid differences, compared to the unmodified genomic sequence.
  • Genome editing techniques can also he used to modify a genomic sequence by insertion of a coding sequence into the genome at a predetermined target site, "knock-in" technique,
  • target site and "target sequence” m.
  • the general context of a genetic editing technique refer to a nucleic aeid sequence that defines a portion of a chromosomal sequence to be edited.
  • a nucleic acid sequence encoding a protein can be inserted at a predetermined target site in the genome so that the genom includes a nucleic acid encoding the protein and the protein is expressed.
  • the nucleic acid sequence ca also contain a promoter to drive expression of the encoded protein or expression of the encoded protein can be driven by an endogenous promoter when the nucleic acid is inserted in a position so that it is operably linked to the endogenous promoter.
  • a point mutation is introduced into the genome of a first mouse using a genome editing technique so thai the mouse encodes Trein2p, and a nucleic acid encoding human APOE4 is inserted into the Apoe4 gene in the genome of a second mouse by a "knock-in" genome editing technique so that the genome of the second mouse contains a "humanized” APOE4 gene as show in Figure 1, containing exon 1 of the mouse Apoe4 gene and exons 2, 3 and 4 of the huma APOE4 gene,
  • the first and second mice are then bred, naturally or by artificial methods, to obtain a genetically modified mouse whose genome includes a DNA sequence encoding APOE4p and a DNA sequence encoding Trem2p.
  • a point mutation is introduced into the genome of a first mouse using CRISPR genome editing technique so that the mouse encodes Trem2p, and a nucleic aeid encoding human APGE4 is introduced into the Apoe4 gene in the genome of a second mouse b a "knock-in" CRISPR genome editing technique so that the genome of the second mous contains a "humanized” APOE4 gene as shown in Figure 1, containing' exon 1 of the mouse Apoe4 gene and exons 2, 3 and 4 of the 2:0 - human APOE4 gene.
  • the first and second mice are then bred naturally or by artificial methods to produce a genetically modified, mouse whos genome includes a DNA sequence encoding APGE4 and a DNA sequence encoding Trem2 .
  • Genomic editing is performed, for example, by methods described herein, and as detailed in J. P. Sundberg. and T. Ichiki, Eds., Genetically Engineered Mice Handbook, CRC Press; 2006; M, H. Hofker and J. van Deursen, Eds., Transgenic Mouse Methods and Protocols, Human Press. 2002; A. L. Joyner, Gene Targeting: A Practical Approach, Oxford University Press, 2000; Manipulating the Mouse Embryo: A Laboratory Manual, 3 rd edition, Cold Spring Harbor Laborator Press; December 13, 2002, ISBN-I0: 0879695919; ursad Turksen (Ed.), Embryonic stem cells: methods and protocols i Methods Mol Biol.
  • a genetic modification method such as but not limited to, a nuclease genetic editing technique, ear be used to introduce a desired DNA sequence into the genome at a predetermined target site, such as methods using homing endonuelease, integrase, meganueiease, transposon, rmclease-mediated process using a zinc finger nuclease (ZF ), a Transcription Activator-Like (TAL), a Clustered Regularly Interspaced Short Palindromic Repeats (CRI.SPR)-Cas-, or Drosophila Recombination- Associated Protein (DRAP).
  • ZF zinc finger nuclease
  • TAL Transcription Activator-Like
  • CRI.SPR Clustered Regularly Interspaced Short Palindromic Repeats
  • DRAP Drosophila Recombination- Associated Protein
  • a genetic modification method that can be used includes introducing into an ES cell, iPS cell, somatic cell, fertilized .oocyte or embryo, RNA molecules encodin a targeted TALEN, ZFN, CRlSPR or DRAP and at least one oligonucleotide, then selecting for an ES cell, iPS cell, somatic cell, fertilized oocyte or embryo with the desired genetic modification.
  • a desired nucleic acid sequence can be introduced into the genome of a mouse at a predetermined target site by a nuclease technique, such as, but not limited to, CRISPR methodology, TAL (transcription activator-like) Effector methodology, Zinc Finger- Mediated Genome Editing or DRAP to produce a genetically modified mouse provided according to embodiments of the present invention whose genome includes a nucleic acid encoding APOE4p operably linked to a promoter, wherein the animal expresses the encoded APOE4p and whose genome includes- a nucleic acid encoding Trem2p operably linked to a promoter, wherein the animal expresses the encoded Trem2p.
  • a nuclease technique such as, but not limited to, CRISPR methodology, TAL (transcription activator-like) Effector methodology, Zinc Finger- Mediated Genome Editing or DRAP
  • the terras "target site” and "target sequence” in the context of a nuclease genetic editing technique refer to a nucleic, acid sequence that defines a portion of a chromosomal sequence to be edited and to which a nuclease is engineered to recognize and bind, provided sufficient conditions for binding exist.
  • CRISPRs Clustered Regularly Interspaced Short Palindromic Repeats
  • CRISPRs are loci containing multiple short direct repeals that are found in fee genomes of approximatel 40% of sequenced bacteria and 90% of sequenced archaea and confer resistance to foreign DNA elements, see Horvath, 2010, Science, 327: 167-170; Barrangou et a 2007, Science, 315: 1709-1712; and Makarova ei al, 2011, Nature Reviews Microbiology, 9: 467-477,
  • CRISPR repeats range in size from 24 to 48 base pairs. They usuall show some dyad symmetry, implying the formation of a secondary structure such as a hairpin, but are not truly palindromic, CRISPR repeats are separated by spacers, of similar length .
  • CRISPR-associated (cas) genes are often associated with CRISPR repeat-- spacer arrays. More than, fort different Cas protein families have been described (Haft et al, 2005, PLoS Comput Biol. 1 (6): ⁇ ). Particular combinations of cas genes and repeat structures have been used to define 8 CRISPR subtypes, some of which are associated with an additional gene module encoding repeat-associated mysterious proteins (RAMPs).
  • RAMPs repeat-associated mysterious proteins
  • CRISPR systems there are diverse CRISPR systems in different organisms, and one of the simplest is the type ⁇ CRISPR. system from Streptococcus pyogenes: onl a single gene encodin the Cas9 protein and two RNAs, a mature CRISPR RNA (erllNA) and a partially complementary trans-acting RNA (tracrRNA), are necessary and sufficient for RNA-guided silencing of foreign DMAs (Gasiunas et al 2012, PNAS 109: E2579-B2586 Jinek et al, 2012, Science 337: 816-821).
  • erllNA mature CRISPR RNA
  • tracrRNA partially complementary trans-acting RNA
  • sgRNA small guid RNA
  • target DNA causes double-strand breaks (DSBs) due to the endonuclease activity of Cas9
  • Binding specificity is determined by both sgRNA-DNA base pairing and a short DNA motif (protospaeer adjacent motif [PAM] sequence: NGG) juxtaposed to the DNA complementary region (Marraffini & Sontheimer, 2010, Nature Reviews Genetics, 11 : 181-190).
  • PAM protospaeer adjacent motif
  • NGG short DNA motif juxtaposed to the DNA complementary region
  • the Cas9 CRISPR can be harnessed for site-selective RNA-guided genome editing, such as targeting insertion see for example, Carroll, 2012, Molecular Therapy 20: 1658-16605 Chang et at, 2013, Cell Research 23 : 465-472; Cho et al, 2013, Nature Biotechnol 31: 230-232; Cong et al, 2013, Science 339: 819-823; Hwang et al, 2013, Nature Biotechnol 31 : 227-229; Jiang et al, 2013, Nature Biotechnol 31 : 233-239: Mali et al, 2013, Science 339: 823-826; Qi et al, 2013, Cell 152: 1 173-1 183; Shea et al, 2013, Cell Research 23: 720-723; and Wang et al 2013, Cell 1.53: 910-918).
  • . . Wang et al. 2013, Cell 153: 910-918 describe targeted insertion using the CRJSPR Cas9 system combined with
  • Transcription activator-like (TAL) effectors or TALE transcription activator-like effector
  • TAL Transcription activator-like effector
  • TALE transcription activator-like effector
  • TAL effectors contain a centralized domain of tandem repeats, each repeat containing approximately 34 amino acids, which are key to the DNA binding specificity of these proteins, In addition, they contain a nuclear localization sequence and an acidic transcriptional activation domain, for a review see Schomack et al 2006, J. Plant Physiol, 163(3): 256-272; Scholze and Boch, 203 1 , Curr Opin Microbiol, 14:47-53,
  • TAL effectors depends on the sequences found in the tandem repeats.
  • the repeated sequence includes approximately 102 b and the repeats are typically 91-100% homologous with each other (Bonas et al, 1989, Mol Gen Genet 218: 127-136).
  • Polymofphism of the repeats is usually located at posiiions 12 and 13 and there appeal's to be a one-to-one correspondence between the i dentity of the hypervariable diresidues at positions 12 and 13 with the identity of the contiguous nucleotides in the TAL-effector's target, sequence, see Moscou and Bogdanove 2009, Science 326: 1501 ; and Boch et al 2009, Science 326:1509-1512,
  • the two hypervariable- residues are known as repeat variable diresidues (RVDs), whereby one RVD recognizes one nucleotide of DNA sequence and ensures that the DNA binding domain of each TAL-effector can target large recognition sites with high precision (15 - 3 ' Ont),
  • RVDs repeat variable diresidues
  • the code for DNA recognition of these TAL- effectors has been determined such that an 1 ID sequence al positions 12 and 13 leads t a binding to cytosine (C), NG
  • N binds to A or G
  • IG binds to T.
  • DNA binding repeats have been assembled into proteins with new combinations and numbers of repeats, to make artificial t anscription factors that are able to interact with new sequences and activate the expression of a reporter gene in pl ant cells (Boch et al. 2009, Science 326:1509-1512).
  • These DNA binding domains have been shown to have general applicability in the field of targeted genomic editing or targeted gene regulation in ail cell types, see Gaj et al. Trends in Bioteehnol, 2013, 31(7):397 ⁇ 405.
  • TAL nucleases can be constructed by combining TALs with a nuclease, e.g.
  • TALENs to cause deletions by NHEJ has been show i rat, mouse, zebrafish, Xenopus, medaka, rat and human cells, Aasai et al, 2013, Genetics s 193: 739-749; Carlson et aL, 2012, PNAS, 109: 17382-17387; Hoekemeyer et aL 2011, Nature Bioteehnol., 29: 731-734; Lei et al, 2012, PNAS, 109; 17484-17489; Moore et al., 2012, PLoS ONE, 7: e37877; Stroud et al, 2013, J. Biol. Chem., 288; 1685-1690; Sung et al, 2013, Nature Bioteehnol 31: 23-24 Wefers e al, 2013, PNAS 110: 3782-3787.
  • Other useful endonucieases may include, for example, Hfaal, Hindlii, Noil, BbvCl, EcoRi, Bg/i, and AlwI.
  • endonucieases e.g., Foki
  • Foki monomer can be fused to a TAL effector sequence that. recognizes a different DNA target sequence, and only when the two recognition sites are in close proximity do the inactive monomers come together to create a functional enzyme. By requiring DNA binding to activate the nuclease, a highl site-specific restriction enzyme can be created.
  • the TALEN may further include a nuclear localizatio signal or sequence (MLS).
  • a MLS is an amino acid sequence that facilitates targeting the TALEIS' nuclease protein into the nucleus to introduce a double stranded break at the target sequence in the chromosome.
  • Nuclear localization signals are-known in the art, see, for example, Makkerli et al. 1996, Curr Biol 6:1025-1027. NLS include the sequence PKKKRKV (SEQ ID NO: 1.6) from SV40 Large T-antigea, Ka!deron 1984.
  • RPAATKKAGQAKKK SEQ ID KG: 1 7 from nucleoplasmin, Dmgwaliet ei al, 1988, J Cell Biol., 107, 841-9. Further examples are described in McLane and Gorbett 2009, iUR B Life, 61, 697-70; Dopie et al 2012, PNAS, 109, E544-E552.
  • the cleavage domain may be obtained from any endonuclease or exonuelease.
  • Non-limiting examples of endonucleases from which a cleavage domain may be- derived include, but are not. limited to, restriction endonucleases and homing endonucleases. See, for example, 2002-2003 Catalog, New England Biolabs, Beverly, Mass.; and Belfort ei al. (1 97) Nucleic Acids es, 25:3379-3388.
  • cleave DNA e.g., SI Nuclease; mung bean nuclease: pancreatic DNase I; microeoceal nuclease; yeast HO endonuclease. See also Linn et al (eds,) Nucleases, Cold Spring Harbor Laboratory Press, 1 93, One or more -of these enzymes, o functional fragments thereof, may be used as. a source of cleavage domains.
  • ZFN zinc finger nucleases
  • Components of the ZFN-mediaied process include a zinc finger nuclease with a DNA binding domain and a cleavage domain.
  • a zinc finger nuclease with a DNA binding domain and a cleavage domain Such are described for example in Beerli ei al (2002) Nature BiotechnoL, 20:135-141: Pabo et al (2001) Ann. Rev. Biochem., 70:313-340; Isalan et al (2001 ) Nature BiotechnoL 19:656-660; Segal et al (2001) Curr Opin. BiotechnoL, 12:632-637; and Choo et al (2000) Curr Opin, Struct. Biol., 10:4.1 1-416: and U.S. Pat. Nos.
  • the zinc finger nuclease may further include a nuclear localization signal or sequence (NLS),
  • NLS nuclear localization signal or sequence
  • a NLS is an amino acid sequence that facilitates targeting the. zinc finger .nuclease protein into the nucleus to introduce a double stranded ⁇ 2S ⁇ break at the target sequence in the chromosome.
  • Nuclear localization signals are known in the art. See, for example, Makkerh et al (1996) Current Biology 6:1025-1027,
  • the cleavage domain may be obtained from any endonuclease or exonuclease.
  • NonTimitmg examples of endonucleases from which a cleavage domain may be derived include, but are not limited to, restriction endonucleases and homing endonucleases. See, for example, 2002-2003 Catalog, New England Bio labs, Beverly. Mass.; and Belfort et al (1997) Nucleic Acids Res. 25:3379-3388, Additional enzymes that cleave DNA are known (e.g., SI Nuclease mung.
  • a cleavage domain also may be derived from an enzyme or portion thereof, as described above, that requires dimerization for cleavage activity.
  • Each nuclease includes a monomer of the active enzyme dimer.
  • a single zinc finger nuclease may include both monomers to create an active enzyme diraer.
  • Restriction endonucleases .(restriction enzymes) are present in. many species and are capable of sequence-specific binding to DN A (at a recognition site), and cleaving DNA at or near the site of binding. Certain restriction enzymes (e.g., Type MS) cleave DNA at sites removed from, the recognition site and have separable binding and cleavage domains.
  • the Type IIS enzyme Foki catalyzes double stranded cleavage of DNA, at 9 nucleotides from its recognition site on one strand and 13 nucleotides from its recognition site on the other. See, for example, U.S. Fat. Nos. 5,356,802; 5,436,150 and 5,487,994; as well as Li et al (1992) PNAS 89:4275-4279; M et al (1993) PNAS 90:2764-2768; Kim et al. (1994) PNAS 91:883 887; Kim et al (1994) J. Biol. Chem. 269:31 , 978-31, 982.
  • a zinc finger nuclease may include the cleavage domain from at. least one Type IIS restriction enzyme and one or more zinc finger binding domains, which may or ma not be engineered.
  • Exemplary Type IIS restriction enzymes are described for example in International Publication WO 07/014275, the disclosure of which is incorporated by reference herein in its entirety. Additional restriction enzymes also contain separable binding and cleavage domains, and these also are contemplated by the present disclosure. See, for example, Roberts et al (2003) Nucleic Adds Res. 31: 418-420.
  • An exemplary Type IIS resirietion enzyme, whose cleavage domain is separable from the binding domain, is Fold.
  • This particular enzyme is active as a dimer (Bitmaite et at 1998, PNAS 95: 10,570-1 0,575). Accordingly, for the purposes of the present disclosure, the portion of the Foki enzyme used in a zinc finger nuclease is considered a cleavage monomer, Thus, for targeted double stranded cleavage using a Foki cleavage domain, two zinc finger nucleases, each including a Foki cleavage monomer, may fee used to reconstitute an active enzyme dimer. Alternatively, a single polypeptide molecule containing a zinc finger binding domain and two Foki cleavage monomers may also be used.
  • the cleavage domain may include one or more engineered cleavage monomers that minimize or prevent homodimerization, as described, for example, in U.S. Patent Publication Nos. 2005/0064474, 2006/0188987, and 2008/0131962, each of which is incorporated by reference herein in its entirety.
  • amino acid residues at positions 446, 447, 479, 483, 484, 486, 487, 490, 491, 496, 498, 499, 500, 531, 534, 537 and 538 of Foki are all targets for influencing dimerization of the Foki cleavage half-domains.
  • Exemplary engineered cleavage monomers of Foki that form obligate heterodimers include a pair in which a first cleavage monomer includes mutations at amino acid residue positions 490 and 538 of Foki and a second cleavage monomer that includes mutations at amino-acid residue positions 486 and 499.
  • a mutation at amino acid position 490 replaces Giu (E) with Lys (K);
  • a mutation at amino acid residue 538 replaces lie (1) with Lys ( );
  • a mutation at amino acid residue 486 replaces Gin (Q) with Glu (E);
  • a mutation at position 499 replaces He (I) with Lys ( ).
  • the engineered cleavage monomers may be prepared by mutating positions 490 from E to K and 538 fro I to K in one cleavage monomer to produce an engineered cleavage monomer designated "E490K:I538K” and b mutating positions 486 from Q to E and 499 from I to L in another cleavage monomer to produce an engineered cleavage monomer designated " ⁇ )486 ⁇ : ⁇ 499 ⁇ .
  • the above described engineered cleavag monomers are obligate heierodimer mutants in which aberrant cleavage- is minimized or abolished.
  • Engineered cleavage monomers may be prepared using a suitable method, for example, b site-directed mutagenesis of wild-type cleavage monomers (Foki) as described in U.S. Patent Publication No. 2005/0064474.
  • the zinc finger nuclease described above may be engineered to introduce a double stranded break at the targeted site of integration.
  • the double stranded break may be at the targeted site of integration, or it may be up to- L 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 100 or 1000 nucleotides away from the site of integration.
  • the double stranded break may be up to 1. 2, 3, 4, 5, 10, 15, or 20 nucleotides away from the site of integration.
  • the double stranded break may be up to 10, 15, 20, 25, 30, 35, 40, 45 or .50 ⁇ nucleotides away from the site of integration.
  • the doable stranded break may be up to 50, 100 or 1000 nucleotides away from the site of integration.
  • a nucleic acid sequence encoding a protein can be inserted at a random target site in the genome so that the genome includes a nucleic acid encoding the protein.
  • the nucleie acid sequence typically also contains a promoter to drive expression of the inserted nucleic acid,
  • a nucleic acid encoding the desired protein, APOE4p, Trem2 or both APOE4 and Trem2p is inserted into a predetermined target site in the genome othe than the Apoe4 gene or the Trem2 gene.
  • a nucleic acid encoding the desired protein, APOE4p, Trem2p or both APQE4 and Trem2p is inserted into a predetermined target site in the genome known i 5 to result i reliable expression, such as the Hprt or the Rosa26 locus.
  • a targeting construct is made using recombinant DNA. techniques and includes 5' and 3' sequences which are homologous to the targeted endogenous gene in the cell.
  • the targeting construct further includes a selectable marker such as neomycin phosphotransferase, 0 hygromycin or piiromyein, nucleic acid encoding the desired protein, APOE4p, Trem2 or both APOE4p and Tre.m2p, and optionally a polyadenylation signal.
  • the nucleic acid encoding the desired protein is either i f ame with the endogenous gene locus, or a splice acceptor site and internal ribosome entry site (IRES ) sequences can be included.
  • IRS internal ribosome entry site
  • Such a targeting construct i transfected into a desired cell type, such as but not limited to, stem cells and the cells are screened to detect the correct genomic editing event using PGR, Southern blot or sequencing analysis. Cells with the correct genomic editing event can be further analyzed for expression of the encoded protein by protein analysis, such as ELISA or Western blot analysis.
  • the nucleic acid encoding the selectable marker D can be configured to be removed by treating the stem cells with a recombinase such as Cre reeombinase or Fiippase (Flp). After recombinase treatment, the cells are analyzed for the presence of the nucleic acid encoding the desired protein.
  • Cells with the correct genomic editing event are selected and injected into ⁇ reimplantation embryos as described above. Chimeric males are selected for breeding.
  • Offspring can be analyzed for transmission of the ES ceil genome by coat color and genetic analysis, such as PGR, Southern blot or sequencing and can be tested for expression o the desired protein, such as by protein analysis (Western blot, ELISA) or other functional assays. Offspring expressing the correct proteins are intercrossed to create .mice- homozygous for the genetic modification(s).
  • Generation of a geneticall modified mouse expressing APOE4p and Trerrs2p may include injection or transiection of appropriate nucleic acids, such as one or more one or more nucleic acids encoding a desired protein and/or one or more expression constructs, such as an expression construct encoding a protein or RNA (such as cas9 or guide RNA for use in CRISPR), into a preimpiantation embryo or stem cells, such as embryonic stem (ES) cells or induced pluripotent stem (iPS) cells,
  • ES embryonic stem
  • iPS induced pluripotent stem
  • expression construct and "expression cassette” are used herein to refer to a double-stranded recombinant DNA molecule containing a desired nucleic acid coding sequence and containing one or more regulatory elements necessary or desirable for the expression of the operably linked coding sequence.
  • regulatory element refers to a nucleotide sequence which controls some aspect of the expression of nucleic acid sequences.
  • exemplary regulatory elements illustratively include an .enhancer, an internal ribosorne entry site (IRES), an intron; an origin of replication, a polyadenylation signal (pA), a promoter, a transcription termination sequence, and an upstream regulatory domain, which contribute to the replication, transcription, post-txanseriptional processing of a nucleic acid sequence.
  • IRS internal ribosorne entry site
  • pA polyadenylation signal
  • promoter a promoter
  • transcription termination sequence a transcription termination sequence
  • upstream regulatory domain which contribute to the replication, transcription, post-txanseriptional processing of a nucleic acid sequence.
  • operably linked refers to a nucleic acid in functional relationshi with a second nucleic acid.
  • a regulator element i included in an expression cassette is a promoter in particular embodiments.
  • the term "promoter” a used herein refers to a DNA sequence operably linked to a nucleic acid sequence to be transcribed such as a nucleic acid sequence encoding a desired molecule.
  • a promoter is generally positioned upstream of a nucleic acid sequence to be transcribed and provides a site for specific binding by RNA polymerase and other transcription factors.
  • a promoter is generall positioned upstream of the nucleic acid sequence transcribed to produce the desired molecule, and provides a site for specific binding by RNA polymerase and other transcription factors.
  • An included promoter can be a constitutive promoter or can provide inducible expression; and can provide ubiquitous, tissue-specific or cell-type specific expression.
  • Ubiquitous promoters that can be included in an expression construct include, but are not limited to, a 3 -phosphogly cerate kinase (PGK-1) promoter, a beta-actin promoter, a R.0SA26 promoter, a heat shock protein 70 (Hsp70) promoter, aiv EF-1 alpha gene encoding elongation factor 1 alpha (EF1) promoter, an eukaryotie initiation factor 4A (eIF-4Al) promoter, a chloramphenicol acety [transferase (CAT) promoter and a CMV (cytomegalovirus) promoter,
  • PGK-1 3 -phosphogly cerate kinase
  • beta-actin promoter
  • R.0SA26 promoter
  • Hsp70 heat shock protein 70
  • Hsp70 heat shock protein 70
  • EF-1 alpha gene encoding elongation factor 1 alpha (EF1) promoter an eukary
  • one or more enliancer sequences may be included such as, but not limited to, cytomegalovirus (CMV) early enliancer element and an SV40 enhancer element.
  • CMV cytomegalovirus
  • Additional included sequences include an intron sequence such as the beta globin intron or a generic intron, a transcription termination sequence, and an niRNA polyadenyiation (pA) sequence such as, but not limited to SV40- A, beta-globm- A and SCF-pA.
  • intron sequence such as the beta globin intron or a generic intron
  • pA niRNA polyadenyiation
  • An expression construct may include sequences necessary for amplification in bacterial cells, such as a selection marker (e.g. kananiycin or ampieillin resistance gene) and a repSicon.
  • a selection marker e.g. kananiycin or ampieillin resistance gene
  • a repSicon e.g. kananiycin or ampieillin resistance gene
  • the expression construct is optionally linearized before injection into mouse preimplantation embryos.
  • the expression construct is injected into fertilized oocytes. Fertilized oocytes are collected from superovulated females the day after mating (0.5 dpe) and injected with the expression construct. The injected oocytes are either cultured overnight or transferred directly into oviducts of 0,5-day p.c. pseudopregnant females.
  • Offspring can be tested for the presence of the desired mutation or inserted sequence by DNA analysis, such s PG , Southern blot or sequencing. Mice which are carrying the desired mutation or inserted sequence can be tested for protein expression such as for example, by ELIS A or Western blot analysis,
  • a nucleic acid or expression construct may be transfected into stein cells (ES cells or IPS cells) using well-known, methods, such as eiectroporation, calcium- phosphate precipitation and li ofection.
  • the cells are screened for the presence of the desired mutation or inserted sequence by DNA analysis, such as PGR, Southern blot or sequencing.
  • DNA analysis such as PGR, Southern blot or sequencing.
  • Cells with the desired mutation or inserted sequence by can be tested or functional expression by protein analysis, such as for example, by ELISA or Western blot analysis.
  • ES cells are grown in media optimized for the particular line.
  • ES media contains 1.5% fetal bovine serum (FBS) or synthetic or semi-synthetic equivalents, .2 rnM gmtamine, 1 n M Ma pyruvate, 0.1 mM non-essential amino acids, 50 D/mi penicillin and streptomycin, 0.1 mM 2-mercapioethanol and 1000 U/ml LIF (plus, for some ceil lines chemical inhibitors of differentiation) in Dulbecco's Modified Eagle Media (D-MEM),
  • D-MEM Dulbecco's Modified Eagle Media
  • Selected cells incorporating the desired mutation or inserted sequence can be injected into preimplantation embryos.
  • ES or IPS cell are rendered to single ceils using a mixture of trypsin and EDTA, followed by resuspension in ES media.
  • Groups of single cells are selected using a finel drawn-out glass needle (20-25 micrometer inside diameter) and introduced through the embryo's zona pellucida and into the blastocysts cavity (blastocoel) using an inverted microscope fitted with micromanipulators.
  • stem cells can be injected into early stage embryos (e.g. 2 -cell, 4-celL 8 ⁇ cell, premorula or morula). Injection may be assisted with a laser or piezo pulses drilled opening th zona pellucida. Approximately 9-10 selected stem cells (ES or IPS cells) are injected per blastocysts, or 8-celi stage embryo, 6-9 stem cells per 4-ceIl stage embryo, and about 6 stem cells per 2-celi stage embryo.
  • early stage embryos e.g. 2 -cell, 4-celL 8 ⁇ cell, premorula or morula
  • Injection may be assisted with a laser or piezo pulses drilled opening th zona pellucida.
  • ES or IPS cells are injected per blastocysts, or 8-celi stage embryo, 6-9 stem cells per 4-ceIl stage embryo, and about 6 stem cells per 2-celi stage embryo.
  • stem cells can be aggregated with morula stage embryos. All these methods are well established and can be used to produce stem cell chimeras.
  • Manipulating the Mouse Embryo A Laboratory Manual, 3 rd edition (A. Nagy, M. Gertsenstem, K. Vintersten, R.
  • Pseudopregnant embryo recipients are prepared usin methods known in the art. Briefly, fertile female mice between 6-8 weeks of age are mated with vaseeiomized or sterile males to induce a hormonal state conductive to supporting surgically introduced embryos. At 2.5 days post coitum (dpc) up to 15 of the stem, cell containing blastocysts are introduced into the uterine horn very near to the uterus-oviduct junction. For early stage embryos and morula, such embryos are either cultured in vitro into blastocysts or implanted into 0.5 dpc or 1.5 dpc pseudopregnant females according to the embryo stage into the oviduct.
  • dpc coitum
  • Chimeric pups from the implanted embryos are bom 16-20 days after the transfer depending on the embryo age at implantation. Chimeric males are selected for breeding.
  • Offspring can be analyzed for transmission of the E8 cell genome by coat color and genetic analysis, such as PCR, Southern blot or sequencing. Further the expression of the encoded protein(s) can be analyzed by protein analysis (Western blot, ELISA) or other functional assays.
  • a geneticall modified mouse of the present invention may be heterozygous or homozygous for the genetic modification.
  • a geneticall modified mouse of the present invention may be heterozygous or homozygous for the "knock-in" humanized APOE4 modification wherein the mouse expresses APOE4p and also may be heterozygous or homozygou for the mutated genomic sequence encoding Trem2 wherein the mouse expresses Trem2p.
  • Homozygous genetically modified mice expressing APOE4p can be crossed with homozygous genetically modified mice expressing Trern2p to create a congenic strain homozygous for both modifications and expressing both APOE4p and Trern2p according to embodiments.
  • Genetically modified mice of the present invention can be any of various strains.
  • a genetic modification can be introduced into the genome of an isolated mouse embryonic stem (ES) cell, a mouse induced pluripotent stem (IPS) cell, a mouse somatic cell, a fertilized mouse oocyte (zygote) or a mouse embryo in a knock-in strategy to produce a genetically modified mouse of the present invention.
  • ES mouse embryonic stem
  • IPS mouse induced pluripotent stem
  • a mouse somatic cell a fertilized mouse oocyte (zygote) or a mouse embryo in a knock-in strategy to produce a genetically modified mouse of the present invention.
  • Embodiments of the invention provide a genetically modified mouse thai includes a desired genetic modification in all or substantially all of its cells, as well as a genetically modified mouse that Includes a desired genetic modification in some, but not all its cells.
  • a genetically modified mouse according to aspects of the present invention can ineiude one or more additional genetic variants associated with Increased risk of late-onset Alzheimer disease in humans.
  • Methods for screening for putative treatments for human Alzheimer's disease are provided according to embodiments of the present invention which include: administering a putative treatment for Alzheimer's disease to a genetically modified mouse, wherein the genome of the mouse includes: 1) a DNA sequence encoding human APOE4 protein (APOE4p) operably linked to a promoter; and 2) a DNA sequence encoding mouse Trem2 protein having a mutation p,R47H (Trem2p) operably linked to a promoter, wherein the mouse expresses APOE4p and Trem2p and wherein the mouse is characterized, by one or more symptoms or signs associated, with expression of APQE4p and Trem2 relevant to non- familial late-onset Alzheimer' s disease of the present invention; and assessing an effect of the putative treatment on. the mouse.
  • APOE4p human APOE4 protein
  • Trem2p a DNA sequence encoding mouse Trem2 protein having a mutation p,R47H
  • Methods for screening for putative treatments for human Alzheimer's disease are provided according to embodiments of the present invention which ineiude: administering a putative treatment for Alzheimer's disease to a B6(Sl jpoe ,mll(4POE ⁇ Adiu T'rem2 emIAd ⁇ fJ mouse whose genome includes: 1) a DNA sequence encoding human APOE4 protein (APOE4p) operably linked to a promoter; and 2) a DNA sequence encoding mouse Trenl2 protein having a mutation p.R47H (Trem2p) operably linked to a promoter, wherein the mouse is homozygous for the DNA sequence encoding APOE4p and for the DNA sequence encoding Trem2p, and wherein the mouse expresses human APOE4 and mouse Trem2p.; and assessing an effect of the putative treatment on the mouse.
  • Methods for screening for a compound for use in the treatment of Alzheimer's disease are provided according to aspects of the present invention which include administering a com ound to a genetically modified mouse of the present invention and assessing an effect of the compound in the treatment of one or more symptoms or signs .associated with expression of human APQE4p and mouse Trem2p relevant to non-familial late-onset Alzheimer's disease. Assessing an effect of the compound in the treatment of one or more symptoms or signs associated with expression of human APOE4p and mouse Treni2p relevant to non-familial late-onset Alzheimer's disease preferably includes ⁇ comparing the result of the assessment with a suitable control, such as. but not limited to, the effect of the compound on a control, such as an APOE3-expressmg mouse or a wild-type mouse (e.g. a mouse carrying the Apoe gene).
  • a suitable control such as. but not limited to, the effect of the compound on a control, such as an APOE3-
  • Such sign and symptoms include, but are not limited to. any one o more of: 1) presence of significantly more microglia in the brai of a genetically modified mouse of the present invention compared to a control, such as an APOE3 -expressing mouse or wild-type control mouse; 2) presence of significantly more amyloid plaques in toe brain of genetically modified mouse of the present invention compared to a control, such as an APOE3- expressing mouse or wild-type control mouse; 3) presence o significantly more tau aggregates in the brain of a genetically modified mouse of the present invention compared to a control, such as an APOE3 -expressing mouse or wild-type control mouse; 4) presence of significantly more inflammation in the brain of a genetically modified mouse of the present inventio compared to a control, such as an APOE3 -expressing mouse or wiid-type control mouse; 5) presence of significantly more synaptic andifor neuronal loss in the brain of a geneticall modified mouse of the present invention compared to a control
  • a genetically modified mouse of the present invention compared to a control, such as an APOE3-expressing mouse or wild-type control mouse.
  • assessing an effect of a compound includes comparing the effect of the compound on the genetically modified mouse, wherein the genome of the mouse includes: 1) a DNA sequence encoding human APOE4 protein (APOE4p) operably linked io a promoter; and 2) a DNA sequence encoding mouse Trem ' 2 protei having a mutation p.R47H (Trem2p) operably linked t a promoter, wherein the mouse expresses APGE4p and Trem2p and wherein the mouse is characterized by one or more symptoms or signs associated with expression of APOE4p and Trem2p relevant to non-familial late-onset Alzheimer's disease of the present invention, with a control.
  • APOE4p human APOE4 protein
  • Trem2p mouse Trem ' 2 protei having a mutation p.R47H
  • assessing an effect of the compound includes comparing the effect of the compound on a Be(S JL) ⁇ Apoe ! ' n ' JfArOE* ⁇ AdluJ Trem m,AdluJ l mouse with a control,
  • a suitable control includes, for example, administering the compound to a mouse which does not express human APOE4p and mouse Treni2 and assessing an effect of the compound on the mouse.
  • a suitable control includes, fo example, administering the compound to an APGE3 ⁇ expressing mouse or wild-type control mouse.
  • a wild-type control mouse can be any mouse which does not express human APQE4p and mouse Trem2p.
  • a suitable control includes, for example, administering the compound to a wild-type C57BL/6J mouse; and assessing an effect of the compound on the wild-type C57BL/6J mouse,
  • Symptoms or signs associated with expression of human APOE4p and mouse Trem2p relevant to non- familial late-onset Alzheimer's disease can be assessed by methods well-known in the art including, but not limited to, immunoassay, nucleic acid assay, histoehemical staining, cognitive assays, in vivo imaging, physical assessment of the animals, cerebrovascular leakage assessment, and morphological assessment of tissues and/or cells .
  • immunoassays that can be used are well-known in the art and include, hut are not limited to, enzyme-jinked immunosorbent assay (Ei JS A) such as but not limited to, antigen capture ELISA, indirect ELiSA, fixed cell ELISA; immunochromatography; antigen capture; flow cytometry; immunoblot; iffimwBoprecipiitation; immunodiffxisioii competitive immunoassays, imniuttocjtochemistry; radioimmunoassay; and combinations of any of these.
  • enzyme-jinked immunosorbent assay such as but not limited to, antigen capture ELISA, indirect ELiSA, fixed cell ELISA; immunochromatography; antigen capture; flow cytometry; immunoblot; iffimwBoprecipiitation; immunodiffxisioii competitive immunoassays, imniuttocjtochemistry; radioimmunoassay; and combinations of any of these.
  • nucleic acid assays to detect a nucleic acid analyte relevant to non-familial late-onset Alzheimer's- disease in a genetically modified mouse of the present invention compared to wild-type mouse includes, but is not limited to, nucleic acid amplification techniques such as, but not limited to, PGR, RT-PCR ligation-mediated PGR and. phi-29 PGR; nucleic acid hybridizatio techniques such as, but not limited to, Northern blot.
  • Biomarker assays that can be used are well-known in the ar and include, but are not limited to, assays of ⁇ and tau species, neurofilaments, neurogranin, interieiikins, TNFa, GM-CSF, and soluble Treml in cerebrospinal fluid (CSF). blood, serum, or tissue.
  • CSF cerebrospinal fluid
  • Cognitive assays that can be used are well-known in the art and include, but are not limited to, assays of spatial memory, short-term memory, long-term memory, assays of executive function, attentions! tasks such as 3 and 5 ehoice serial reaction time tests, tests of processing speed, set shifting tests, reversal learning tasks, assays of object memory, assays of pattern recognition, assays of passive avoidance memory, assays of habituation, and assays of novel object recognition, water maze testing, fear conditioning tests, radial arm water maze testing, Y-rnaze testing, T-maze testing, and open field habituation tests.
  • Physical assessment methods of the animals that can be used are well-known in the art and include, but are not limited to, assessment of indices of frailty in a genetically modified mouse of the present invention compared to a control, such as an APOE3- expressing mouse or a wi ld-type mouse as a comparison to normal aging.
  • in vivo imagin methods that can be used are well-known in the art and include, but are not limited to, magnetic resonance imaging (MRI), computed tomography (CT) imaging, X-ray, optical imaging, and ultrasound imaging.
  • MRI magnetic resonance imaging
  • CT computed tomography
  • X-ray X-ray
  • optical imaging optical imaging
  • ultrasound imaging techniques can be used to assess one or more symptoms or signs associated with expression of human APOE4p and mouse Trern2p relevant to non-familial late-onset Alzheimer's disease including, but not limited to, amyloid or tau aggregation, abnormal blood flow, pathological neuronal loss, and abnormal glucose metabolism,
  • Assessment of inflammation can be performed by assay of one or more biomarkers of inflammation, such as, but not limited to, IL-8, IL-11, TNF-alpha, granulocyte- macrophage colony stimulating factor (GM-CSF), TGF-beta, VEGF, monocyte chemotactie factor- 1, macrophage migrator inhibitory factor, slOOB, fibrinogen,, and interferon gamma- inducible protein 10.
  • biomarkers of inflammation such as, but not limited to, IL-8, IL-11, TNF-alpha, granulocyte- macrophage colony stimulating factor (GM-CSF), TGF-beta, VEGF, monocyte chemotactie factor- 1, macrophage migrator inhibitory factor, slOOB, fibrinogen,, and interferon gamma- inducible protein 10.
  • biomarkers of inflammation such as, but not limited to, IL-8, IL-11, TNF-alpha, granulocyte-
  • Morphological assessment of tissues and/or cells can include physical examination of gross anatomy and/or microscopic examination of tissues and/or cells with or without histochemical or cytoeheinical staining of the tissues and/o cells. Morphological assessment of tissues- and/or cells can include assessment of synaptic and neuronal loss.
  • a method for screening for a compound for use in the treatment of Alzheimer's disease in an individual human subject having or suspected of having Alzheimer's disease- is provided according to aspects of the present invention which include administering a compound to a genetically modified mouse of the present invention;, .and assessing an effect of the compound ⁇ n amyloid and/or tau which are associated with expression of human APOE4p and mouse Trern2p relevant to non-familial late-onset Alzheimer's disease on the mouse.
  • assessing an effect of the compound on amyloid and/or tau includes assessing the level and/or localization of amyloid and/or tau.
  • assessin an effect of the compound on amyloid arid/or tau includes assessing amyloid and/or tau aggregates i a. genetically modified mouse of the present invention, such as assessment of aggregate size, number, location or a combination of any two. or more thereof.
  • .Cerebrovascular leakag is. a key aspect of non-familial late-onset Alzheimer's disease and it is a surprising and unexpected finding of the present invention that expression of human APOE4 and mouse Trem2p results in cerebrovascular leakage,
  • a method for screening for a compound fo use in the treatment of non-familial late-onset Alzheimer's disease in an individual human subject having or suspected of havin non-familial late-onset Alzheimer's disease is provided according, to aspects of the present invention which include administering a compound to a genetically modified mouse of the present invention; and assessing an effect of the compound on cerebrovascular leakage which is associated with expression of human AFQE4 and mouse Trem2 relevant to non-familial late-onset Alzheimer's disease in the mouse. Assessing an effect of the compound on cerebrovascular leakage includes, but is not limited to, assessment of cerebrovascular permeability.
  • cerebrovascular permeability refers to the capacity of a blood vessel wall to allow for normal movement of small molecules or substances such as water, ions, certain drags and nutrients across the blood vessel wall while acting as a barrier to movement of larger molecules and substances, such as fibrinogen, and albumin.
  • cerebrovascular leakage refers to an abnormality of blood vessels which results in leakage of larger moiecules and substances, such as fibrinogen, and albumin, through blood vessel wails.
  • a non- raiting example of an in vivo assay of cerebrovascular leakage includes intravenous injection of a labeled protein (e.g. Evans Blue-labeled albumin) and assessment of appearance of the dye-labeled protein in brain tissues, see for example, Radu et ah, An in vivo Assay to Test Blood Vessel J. Vis. Exp, 2013, (73):50062.
  • the putative treatment can he an treatment modality such as, but not limited to, administration of a compound.
  • the term "compound” as used herein is not limited and encompasses small molecule chemicals and biologicals sueh as peptides, proteins, glycoproteins, including antibodies, for example.
  • inventive compositions and methods are illustrated in the following examples. These examples are provided for illustrative purposes and are not considered limitations on the scope of inventive compositions and methods,
  • the mouse Apoe4 gene is located on chromosome 7 at 19,696,109 - 19.699,166.
  • An APQE4 gene-targeting construct was made that included 4980 bp (SEQ ID NO -.9) of mouse sequence, which defined the mouse 5' homology arm including exon 1 of mouse ApoE, 4292 bp (SEQ ID NO:10) of human APOE4 sequence including human protein coding exons 2-4 of the human gene as well as an additional 1.5 kb of flanking human sequence after the 3TJTR to incl de any potential regulator sequences.
  • FIG. 1 shows a schematic diagram of the humanized ApoE4 construct (see targeting vector E4").
  • (C (. ' ⁇ above exon 4' shows the nt present i exon 4 for arginine at p.R310 and R1 6, resepeetively, isoform £4.
  • Isoform E2 with (T T) codes for cysteine at both CI 3-0 and CI 76 » while E3 (T C) codes for eysteme at C130R and arginine at Rl 76 sites,
  • Human APOE4 exon 4 contains sequence that codes for the ApoE4 isoform of the gene and encodes the nucleotide sequence for arginine at R130 and R176, it is noted that APQE4 includes, an 18 amino add signal peptide at the N-tenninus of the protein such that APOE4 including the signal peptide is 317 amino acids and the variant amino acids which differ amon APOE2, APOE3 and APQE4 are at positions 130 and 176. In the mature APOE proteins (299 amino acids), the variant amino acids which differ among APOE2, APOE3 and APOE4 are at positions 112 and 158.
  • a Fit neo Fit selection cassette (FNF cassette, SEQ ID NO; 11) was inserted after the human sequence followed b a Ndel restriction site (for ease of Southern screening).
  • the FNF cassette Is followed by 5166 bp of mouse sequence (SEQ ID NO: 12), the V homology arm.
  • the resulting 14,438 b synthesized construct was cloned into pBIight vector using recombineerittg techniques, producing a construct called mApoEJhAPOB4_PGK-iieo_ mAPOB for gene targeting in embryonic stem cells,
  • the ApoE4 gene-targeting construct was Introduced into cultured embryonic stern (ES) cells of a C57B16 mouse strain by electroporati n. Homologous recombination produced loci that retained all normal mouse regulatory sequences (plus non-coding exott one) together with the human APOE4 protein-encoding exons 2-4. Transfected ES cells were screened by Southern blot in ensure correct targeting. Three clones were identified that were correctly targeted. ES cells containing the correctly targeted locus were introduced into C57BL/6J embryos, and the resultant chimeric mice were bred with C57BL/6J mice. Offspring carrying the modified locus in the germ- line were interbred to generate the homozygous genetically modified genome. All Ft matings produced normal litter sizes with a Mendelian distribution of the locus.
  • Hie Trem2 R47H KI allele was generated at The Jackson Laboratory by pronuciear injection of Cas9 RNA (100 ng) and a single guide sequence (50 ng) GAAGCACTGGGGGAGACGCA (SEQ ID NO:7) with 183 nt donor oiigo (40 ng) (GCCCTCAACACCACGGTGCTGCAGGGCATGGCCGGCCAGTCCTTGAGGGTGTC TGTACTTATGACGCCTTGAA ⁇
  • mice were administered a lethal dose of Ketamine/Xylazine by intraperitoneal injection, and transcardially perfused with IxPBS (phosphate buffered saline). Brain were dissected, and the right hemisphere was snap frozen for protein isolation, while the left hemisphere was fixed in 4% paraformaldehyde overnight at 4°C. The fixed hemispheres were rinsed with IxPBS, cryopratected in 10% sucrose, followed by 30% sucrose at 4°C 5 and finally embedded in OCT (optimal cutting temperature compound). Frozen brains were sectioned at 25 ym and stored at - ⁇ 8Q Q C until required. Protein was extracted with Trizol Reagent (Life Technologies, Cat#15596-01 ⁇ ) following manufacturer's guidelines, Protein pellets were resuspended in a solution of 1 : 1 8M urea and 1 % SDS.
  • IxPBS phosphate buffered saline
  • mice mouse monoclonal anti-non- pliosphoiy!ated neurofilament (1 :200, Covance) and sheep polyclonal anti-TREM2 (1:200, RD Systems), The sheep polyclonal anti ⁇ TREM2 antibody was previously verified using Trem2 deficient mice. All antibodies were diluted in PBTB (IxPBS, 1% TritonX-100 and 1% BSA) containing 10% normal goat or donkey serum.
  • PBTB IxPBS, 1% TritonX-100 and 1% BSA
  • este3 ⁇ 4 blot naly is demonstrates ⁇ m ⁇ ..h ⁇ m- &FQE#-:in 3 ⁇ 46CSiI3 ⁇ 4 ;
  • Brain extracts (-25 micrograms protein) were diluted in 2x Laemmli sample buffer (Bio-Rad 1610737) and run on a 4-20% gradient (BioRad mini-protean TGX 456- 1096) and transferred to a nitrocellulose membrane (mVitrogen ⁇ 301001).
  • FIG. 1 An antibody that is specific for the human APOE4 variant (Novus Biologicais NBP1 -49529 at 1: 100 dilution) was used to probe Western blots of about 25 micrograms of protein from C57BL/6J (abbreviated B6J) or B6J.AP0E4/Trem2 brain tissue.
  • Figure 2 is an image of a Western blot of brain tissue from B6J.APOE4/Trem2 (lanes 4-6) and control (WT (B6J); lanes 1-3) brain tissue.
  • human APOE4 protein expression wa detected only in the protein from B6J.APOE4 Trem2 mice.
  • APOE variants have been shown to differentially regulate lipoprotein and cholesterol metabolism. Although the mechanisms b which the APOE4 variant increases the risk for Alzheimer's disease is not known, these effects on altered metabolism are thought to play a role. Blood samples obtained from 12 month old B6J.APOE4/Trem2 (abbreviated APOE4 Trem2 in Figures 3 A, 3B and 3C) mice and 12 month old C57BL/6J control mice were assayed for high density lipoprotein (HDL), low density lipoprotein (LDL) and total cholesterol according to standard blood chemistry methods.
  • HDL high density lipoprotein
  • LDL low density lipoprotein
  • Plasma aliquots were profiled for the following; Total cholesterol (rng/'dL), LDL (rng/dL) 5 HDL (mg/dL)), High density lipoprotein cholesterol (HDL) was assayed using the Walco L-Type HDL-C kit (Wako 99100101) as per manufacturer's instructions, LDL was assayed using Beckman Coulter LDL -Cholesterol kit (Beckrnan. Coulter OSR6196) as per manufacturer's instructions. Total cholesterol was assayed usin the Beckman Coulter Cholesterol kit (Beckman Coulter OSR6116).
  • mice All mice were bred and housed in a 12/12 hours light/dark cycle. Eight month old mice were injected intraperitonealiy with a lethal -quantity of ketaraine/xylazine according to IACLiC approved procedures. Mice were perfused with 1 X PBS (phosphate buffered saline) and whole brains were removed. One hemisphere was fixed in 4% paraformaldehyde overnight at +4°C. FoUowing. fixation, the tissue was rinsed in IX PBS, incubated in 10% sucrose overnight at +4°C, then incubated in 30% sucrose overnight at. 4°C.
  • 1 X PBS phosphate buffered saline
  • OCT optimal cutting temperature
  • Sections were incubated overnight in Rabbit anti-fibrin (1:200) and Goat anfi-CoilV (anti-collagen IV) (1 :40) at +4 ° C in IxPBT, Slides were washed in IxPBT and incubated in the appropriate secondary antibodies at a concentration of 1 : 1000 (Donkey anti-rabbit igG 594, Donke anti-goat 488) for 2 hours at room temperature. Tissue was coimterstah ed with DAPI and mounted using Aqua-Poly mount (Polyscienee Inc). Staining was imaged .on the Zeiss Axio imager at a magnification of
  • B6J.APOE4/Trem2 mice were imrnunostained for fibrinogen (fibrin) to detect cerebrovascular leakage.
  • Representative images of B6J.APOE4 Trem2 tissue at 7-8 months of age are shown in Figure 4 along with representative images from similar sagittal sections of brain from control C57BL/6J (abbreviated B6J) mice.
  • Arrows indicate cerebrovascular leakage as indicated by fibrin immunostaming outside of blood vessels. Blood vessels are shown by inimunostaining for collagen IV (Col IV),
  • Vascular damage may be a key aspect of late-onset Alzheimer's disease pathology.
  • Some existing mouse models of familial Alzheimer's disease have demonstrated cerebral amyloid angiopathy (CAA), but B6.J.APOE4/Trem2 mice are the first model thai does not over-express familial Alzheimer's disease mutations to show vascular deficits.
  • CAA cerebral amyloid angiopathy
  • FIG. 5 is a gene expression heatma of differentially-expressed genes in B6i.APO£4/Treni2 compared to C57BL 6J, Expression values are in Log2 fold change relative to the C57BL/6J average of each gene.
  • the list of differentially-expressed genes contains multiple genes related to brain function and neurodegeneration.
  • the Gene Oniology Biological Process and Panther Pathway annotations database was queried to identify processes and pathways represented by these genes.
  • the relevant processes include, but are not limited to, the results in Table I which shows pathways and processes represented by the differentially-expressed genes in the B6J.APOE4/Treni2 strain. Notably, these interlinked processes and pathways include many highly relevant to neurodegeneration.
  • Alzheimer's disease-amyloid secretase pathway Pcskl, Mapkl 0, Mapk3 ⁇ 4 Prkcq j
  • amino acid sequence ⁇ f APOE4p is hown along with exemplary- nucleic acid sequences encoding APOE4p.
  • SEQ ID NO:2 Ex0ns 2, 3 and. 4 of the human APOE4 genomic DNA sequence encoding human.
  • APOE4p including the 18 amino acid signal, peptide
  • SEQ ID NO:4 mutated mouse genomic IMA sequence encoding Trem2p (1056 nucleotides)
  • SEQ ID NQ:6 mouse wild type genomic DNA sequence encoding Trem2 mouse wild type protein (1056 nucleotides)
  • SEQ ID NO:7 Trem2 CRISPR guide
  • SEQ ID NO:S Trem2 repair oiigo (183 nucleotides) containing a nucleotide G>A point mutation (at nucleotide 89 in this oii o sequence) for amino acid sequence change at R47H and 2 silent mutations (lysine AAG>AAA (3 ⁇ 4t nucleotide 93 i3 ⁇ 4 this oiigo sequence) and alanine GCOGCA (at nucleotide 96 in this oiigo sequence)) into the gene to prevent re- cutting of the donor sequence in homologous directed repair :
  • SEQ ID NO:9 5 ' homology arm (4980 nucleotides; bootsse Apoe4 exoa 1 and 757 nucleotides of mouse Apoe4 intron 2 sequence) included In the "humanized" mouse ApoE construct inserted into the mouse genome.
  • SEQ ID NO: 10 DNA sequence including exons 2, 3 and 4 of the human APOE4 gene and 1500 nucleotides 3'UTR of the human ⁇ 4 gene after exon 4 (4292 nucleotides) included in the "humanized' ' ' mouse ApoE construct inserted into the mouse genome.
  • CTCCCCGGCC1GCTTG1 TCTC( CCCAACCC CCTTCATCTG(MTTTGTTCTO1 " GCC ATTCAG TTGGTTTGAGCTCTCTGCTTCTCCGGTTCCCTCTGAGCTAGCTGTCCCT
  • SEQ ID ⁇ , ⁇ ⁇ a Fit PG neo Fit cassette followed by an Ndel restriction enzyme, site (CATATG) (1834 nucleotides) inserted in the "humanized" mouse ApoE construct between nucleotides 9272 and 9273 to allow for selection prior to r combinase- mediated removal of this cassette.
  • CAATG Ndel restriction enzyme, site
  • SEQ ID NO: 12 3' homology- ami (5166 nucleotides) included in the "humanized" mouse ApoE construct inserted into the mouse genome.
  • TCCAGCCAGGTGGCCCTGTC CAAGCACCTCTCTGGCCCTCTGGTGGCCCTTGCTT AATAAAOATTCTCCGAGCACATTCTGAGTCTCTGTGAGTGATTCCAATCAGCTTC AGCCTCAGITRATTGTTNTTGCCTTACCTAGCACACA TCCATGGCCCTGTCACT TCTGTAGAGGGAGGTGGTTT GCAGCAATAGAAATGAAGCCTAGGACCTAGCA
  • ATCTTATGTATAAGGTACACTGCAGCTGI CTTCAGGCGTCAGGTCCCA ' IVACAGA TGGTTQTGAGCX ⁇ ACCATGTGGTrOCTGGGAATTGAAC CAGGACT ATAGAAOAG TAGTCAGTGCTCTTAACTGCTGAGCCATCTCTCCAGCACCCAGTACAGGCTC ' r ' rC'r ATTTAGCTAlATCCACCCTTCT ' ITT'TACirCTGAAAIAGGATC ' rCAACTGATTTTCC I GCACTCCC'rCTAGCCTAGTTTGGTCTTGAATATTTGAATCTTTGTTTTTTCAAATC AATCTCTACAGGAACTGAGAAAGGCATGTACCAGT C ' ATGTGGGTCAGTTGGGCT ACTTTTCCCAACTTCCX AAGCIACCC:AC ' iGCACAGCTATGCCTTGAATCAATCAAC ATGTAAGAGACCAGGGTCGCCAGGCGGTGTTTACTTTTCTGGTTGTl ⁇ I
  • SEQ ID NO: 1 3 wild-type amino acid sequence-mouse Apoe
  • SEQ ID NO: 14 amino acid sequence-human ⁇ 3
  • ARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDN [00208] SEQ ID NO; 15; APOE4p (29 amino acids)
  • mice and methods of use described herein are presently representative of preferred embodiments, exemplary, and not intended as limitations on the scope of the invention. Changes therein and other uses will occur to those skilled in the art, Such changes and other uses can be made without departing from the scope of the invention as set forth in the claims.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Environmental Sciences (AREA)
  • Biotechnology (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Urology & Nephrology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Hematology (AREA)
  • Animal Husbandry (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Neurosurgery (AREA)
  • Microbiology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Neurology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
PCT/US2018/023565 2017-03-21 2018-03-21 A GENETICALLY MODIFIED MOUSE EXPRESSING HUMAN APOE4 MOUSE Trem2.p.R47H AND METHODS OF USE THEREOF Ceased WO2018175581A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
EP18770741.9A EP3599842B1 (en) 2017-03-21 2018-03-21 A genetically modified mouse expressing human apoe4 and mouse trem2.p.r47h and methods of use thereof
US16/496,261 US11957115B2 (en) 2017-03-21 2018-03-21 Genetically modified mouse expressing human APOE4 and mouse Trem2 p.R47H and methods of use thereof
AU2018239433A AU2018239433B2 (en) 2017-03-21 2018-03-21 A genetically modified mouse expressing human APOE4p and mouse Trem2 p.R47H and methods of use thereof
JP2019552004A JP7623785B2 (ja) 2017-03-21 2018-03-21 ヒトAPOE4およびマウスTrem2 p.R47Hを発現する遺伝子改変されたマウス、ならびにその使用の方法
CA3057289A CA3057289A1 (en) 2017-03-21 2018-03-21 A genetically modified mouse expressing human apoe4 and mouse trem2 p.r47h and methods of use thereof
CN201880031011.2A CN110891417B (zh) 2017-03-21 2018-03-21 表达人APOE4和小鼠Trem2 p.R47H的遗传修饰小鼠及其使用方法
JP2023023328A JP2023056032A (ja) 2017-03-21 2023-02-17 ヒトAPOE4およびマウスTrem2 p.R47Hを発現する遺伝子改変されたマウス、ならびにその使用の方法
US18/605,786 US20240315220A1 (en) 2017-03-21 2024-03-14 Genetically modified mouse expressing human apoe4 and mouse trem2 p.r47h and methods of use thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762474358P 2017-03-21 2017-03-21
US62/474,358 2017-03-21

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/496,261 A-371-Of-International US11957115B2 (en) 2017-03-21 2018-03-21 Genetically modified mouse expressing human APOE4 and mouse Trem2 p.R47H and methods of use thereof
US18/605,786 Division US20240315220A1 (en) 2017-03-21 2024-03-14 Genetically modified mouse expressing human apoe4 and mouse trem2 p.r47h and methods of use thereof

Publications (2)

Publication Number Publication Date
WO2018175581A1 true WO2018175581A1 (en) 2018-09-27
WO2018175581A8 WO2018175581A8 (en) 2018-11-01

Family

ID=63586166

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/023565 Ceased WO2018175581A1 (en) 2017-03-21 2018-03-21 A GENETICALLY MODIFIED MOUSE EXPRESSING HUMAN APOE4 MOUSE Trem2.p.R47H AND METHODS OF USE THEREOF

Country Status (7)

Country Link
US (2) US11957115B2 (https=)
EP (1) EP3599842B1 (https=)
JP (2) JP7623785B2 (https=)
CN (1) CN110891417B (https=)
AU (1) AU2018239433B2 (https=)
CA (1) CA3057289A1 (https=)
WO (1) WO2018175581A1 (https=)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115536734A (zh) * 2022-11-24 2022-12-30 安徽农业大学 具有肝癌细胞毒性和α-葡萄糖苷酶抑制活性的环色-丙-缬-亮-亮肽及制备方法

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JOP20190248A1 (ar) 2017-04-21 2019-10-20 Amgen Inc بروتينات ربط مولد ضد trem2 واستخداماته
US20210195879A1 (en) * 2018-06-21 2021-07-01 The Jackson Laboratory Genetically modified mouse models of alzheimer's disease
WO2023015153A2 (en) * 2021-08-02 2023-02-09 President And Fellows Of Harvard College ANTISENSE OLIGONUCLEOTIDE TARGETING APOE ε4 AND USES THEREOF
CN114731987B (zh) * 2022-05-19 2023-06-23 华芯微鱼(苏州)生物科技有限公司 颅缝早闭症小鼠模型、其构建方法及应用
CN116103292B (zh) * 2022-11-25 2024-01-30 首都医科大学宣武医院 Zdhhc21基因突变动物模型的构建方法及其应用
CN119234771A (zh) * 2024-09-13 2025-01-03 广东省人民医院 一种帕金森病认知障碍小鼠模型的构建方法与应用

Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5356802A (en) 1992-04-03 1994-10-18 The Johns Hopkins University Functional domains in flavobacterium okeanokoites (FokI) restriction endonuclease
US5436150A (en) 1992-04-03 1995-07-25 The Johns Hopkins University Functional domains in flavobacterium okeanokoities (foki) restriction endonuclease
US5487994A (en) 1992-04-03 1996-01-30 The Johns Hopkins University Insertion and deletion mutants of FokI restriction endonuclease
US6046318A (en) 1994-10-18 2000-04-04 Corvas International, Inc. Nematode-extracted serine protease inhibitors and anticoagulant proteins
US6046381A (en) * 1998-04-30 2000-04-04 The Regents Of The University Of California Apolipoprotein E transgenic mice and assay methods
EP1063298A2 (en) 1999-06-04 2000-12-27 Glaxo Group Limited Transgenic Animal Model for Alzheimer Disease
JP2001017028A (ja) 1999-05-06 2001-01-23 Mitsubishi Chemicals Corp アポeヒト化哺乳動物
US6453242B1 (en) 1999-01-12 2002-09-17 Sangamo Biosciences, Inc. Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites
US6534261B1 (en) 1999-01-12 2003-03-18 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6534643B1 (en) 1999-07-21 2003-03-18 Albert Einstein College Of Medicine Of Yeshiva University Drosophila recombination-associated protein and methods for use
US6830910B1 (en) 1999-07-21 2004-12-14 Albert Einstein College Of Medicine Of Yeshiva University Drosophila recombination-associated protein and methods for use
US20050064474A1 (en) 2003-08-08 2005-03-24 Sangamo Biosciences, Inc. Methods and compositions for targeted cleavage and recombination
US20060188987A1 (en) 2003-08-08 2006-08-24 Dmitry Guschin Targeted deletion of cellular DNA sequences
WO2007014275A2 (en) 2005-07-26 2007-02-01 Sangamo Biosciences, Inc. Targeted integration and expression of exogenous nucleic acid sequences
US7294754B2 (en) 2004-10-19 2007-11-13 Regeneron Pharmaceuticals, Inc. Method for generating an animal homozygous for a genetic modification
US20080131962A1 (en) 2006-05-25 2008-06-05 Sangamo Biosciences, Inc. Engineered cleavage half-domains
US8420782B2 (en) 2009-01-12 2013-04-16 Ulla Bonas Modular DNA-binding domains and methods of use
US8440432B2 (en) 2009-12-10 2013-05-14 Regents Of The University Of Minnesota Tal effector-mediated DNA modification
US8450107B1 (en) 2011-11-30 2013-05-28 The Broad Institute Inc. Nucleotide-specific recognition sequences for designer TAL effectors

Family Cites Families (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1206421A (zh) * 1995-11-01 1999-01-27 科斯药品公司 载脂蛋白e2和阿尔采默氏病的治疗
US6175057B1 (en) * 1997-10-08 2001-01-16 The Regents Of The University Of California Transgenic mouse model of alzheimer's disease and cerebral amyloid angiopathy
US20060167227A1 (en) * 2002-07-12 2006-07-27 Axon Neuroscience Forschungs-Und Entwicklungs Gmbh Truncated tau proteins
JP2005534710A (ja) 2002-08-07 2005-11-17 ノバルティス アクチエンゲゼルシャフト Apoe遺伝子型を基準とした痴呆を処置するための方法
EP1907566A4 (en) 2005-05-27 2008-12-10 Memory Pharm Corp VECTORS FOR TRANSGENIC MORBUS ALZHEIMER MOUSE MODEL AND USES THEREOF
JP4942081B2 (ja) 2006-06-20 2012-05-30 独立行政法人理化学研究所 アルツハイマー病モデル動物およびその用途
WO2010002982A1 (en) * 2008-07-01 2010-01-07 Cognosci, Inc. Methods of treating cancer with apoe peptides
CA2735578C (en) * 2008-08-12 2018-10-23 Zinfandel Pharmaceuticals, Inc. Method of identifying risk factors for alzheimer's disease comprising tomm40 gene variants
WO2013181618A2 (en) * 2012-05-31 2013-12-05 The Trustees Of Columbia University In The City Of New York Methods to treat alzheimer's disease using apoe inhibitors
WO2014074942A1 (en) 2012-11-08 2014-05-15 Illumina, Inc. Risk variants of alzheimer's disease
CN109641961A (zh) * 2016-07-22 2019-04-16 德国神经退行性疾病研究中心 Trem2切割调节剂及其用途
US20210195879A1 (en) 2018-06-21 2021-07-01 The Jackson Laboratory Genetically modified mouse models of alzheimer's disease
US20220099659A1 (en) 2019-01-23 2022-03-31 The Regents Of The University Of California Human Genomic Construct Reporter Cells and Mouse Models to Screen Therapeutics against Microglia-expressed Disease Associated Genes
EP4262372A4 (en) 2020-12-16 2024-11-20 The Jackson Laboratory A genetically modified immunodeficient mouse expressing human or humanized app and mutated human psen1

Patent Citations (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5436150A (en) 1992-04-03 1995-07-25 The Johns Hopkins University Functional domains in flavobacterium okeanokoities (foki) restriction endonuclease
US5487994A (en) 1992-04-03 1996-01-30 The Johns Hopkins University Insertion and deletion mutants of FokI restriction endonuclease
US5356802A (en) 1992-04-03 1994-10-18 The Johns Hopkins University Functional domains in flavobacterium okeanokoites (FokI) restriction endonuclease
US6046318A (en) 1994-10-18 2000-04-04 Corvas International, Inc. Nematode-extracted serine protease inhibitors and anticoagulant proteins
US6046381A (en) * 1998-04-30 2000-04-04 The Regents Of The University Of California Apolipoprotein E transgenic mice and assay methods
US6607882B1 (en) 1999-01-12 2003-08-19 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6453242B1 (en) 1999-01-12 2002-09-17 Sangamo Biosciences, Inc. Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites
US6534261B1 (en) 1999-01-12 2003-03-18 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
JP2001017028A (ja) 1999-05-06 2001-01-23 Mitsubishi Chemicals Corp アポeヒト化哺乳動物
EP1063298A2 (en) 1999-06-04 2000-12-27 Glaxo Group Limited Transgenic Animal Model for Alzheimer Disease
US6858716B2 (en) 1999-07-21 2005-02-22 Albert Einstein College Of Medicine Of Yeshiva University Drosophila recombination-associated protein and methods for use
US6534643B1 (en) 1999-07-21 2003-03-18 Albert Einstein College Of Medicine Of Yeshiva University Drosophila recombination-associated protein and methods for use
US6830910B1 (en) 1999-07-21 2004-12-14 Albert Einstein College Of Medicine Of Yeshiva University Drosophila recombination-associated protein and methods for use
US20050064474A1 (en) 2003-08-08 2005-03-24 Sangamo Biosciences, Inc. Methods and compositions for targeted cleavage and recombination
US20060188987A1 (en) 2003-08-08 2006-08-24 Dmitry Guschin Targeted deletion of cellular DNA sequences
US7576259B2 (en) 2004-10-19 2009-08-18 Regeneron Pharmaceuticals, Inc. Method for making genetic modifications
US7294754B2 (en) 2004-10-19 2007-11-13 Regeneron Pharmaceuticals, Inc. Method for generating an animal homozygous for a genetic modification
US7659442B2 (en) 2004-10-19 2010-02-09 Regeneron Pharmaceuticals, Inc. Method for making homozygous genetic modifications
WO2007014275A2 (en) 2005-07-26 2007-02-01 Sangamo Biosciences, Inc. Targeted integration and expression of exogenous nucleic acid sequences
US20080131962A1 (en) 2006-05-25 2008-06-05 Sangamo Biosciences, Inc. Engineered cleavage half-domains
US8420782B2 (en) 2009-01-12 2013-04-16 Ulla Bonas Modular DNA-binding domains and methods of use
US8440432B2 (en) 2009-12-10 2013-05-14 Regents Of The University Of Minnesota Tal effector-mediated DNA modification
US8440431B2 (en) 2009-12-10 2013-05-14 Regents Of The University Of Minnesota TAL effector-mediated DNA modification
US8450471B2 (en) 2009-12-10 2013-05-28 Regents Of The University Of Minnesota TAL effector-mediated DNA modification
US8450107B1 (en) 2011-11-30 2013-05-28 The Broad Institute Inc. Nucleotide-specific recognition sequences for designer TAL effectors
US20130137161A1 (en) 2011-11-30 2013-05-30 Massachusetts Institute Of Technology Nucleotide-Specific Recognition Sequences For Designer TAL Effectors
US20130137174A1 (en) 2011-11-30 2013-05-30 Feng Zhang Nucleotide-specific recognition sequences for designer tal effectors

Non-Patent Citations (83)

* Cited by examiner, † Cited by third party
Title
"Building Better Mouse Models for Late-Onset Alzheimer’s", ALZFORUM, 20 January 2017 (2017-01-20), pages 1 - 8, XP055543957, Retrieved from the Internet <URL:https://www.alzforum.org/news/research-news/building-better-mouse-models-late-onset-alzheimers> *
"CRISPR-Cas: A Laboratory Manual", 2016
"Current Protocols", 2002, WILEY, article "Short Protocols in Molecular Biology"
A. NAGYM. GERTSENSTEINK. VINTERSTENR. BEHRINGER ET AL.: "Manipulating the Mouse Embryo: A Laboratory Manual", vol. 110, 2002, COLD SPRING HARBOR LABORATORY PRESS, article "Manipulating the Mouse Embryo: A Laboratory Manual", pages: 815 - 821
ABBOUD, S. L. ET AL., J. HISTOCHEM & CYTOCHEM., vol. 51, no. 7, 2003, pages 941 - 949
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403
ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 3402 - 3388
ANSAI ET AL., GENETICS, vol. 193, 2013, pages 739 - 749
B. ALBERTS ET AL.: "Embryonic stem cells: methods and protocols in Methods in Molecular Biology", vol. 185, 2002, HUMANA PRESS
B.K.C. LO: "Methods in Molecular Biology", 2004, HUMANA PRESS, article "Oligonucleotide Synthesis: Methods and Applications"
BARRANGOU ET AL., SCIENCE, vol. 318, 2007, pages 1709 - 1712
BEERLI, NATURE BIOTECHNOL., vol. 185, 2002, pages 135 - 141
BITINAITE ET AL., PNAS, vol. 95, 1998, pages 10,570 - 10,575
BONAS ET AL., MOL GEN GENET, vol. 218, 1989, pages 127 - 136
BU ET AL., NATURE REVIEWS NEUROSCIENCE, vol. 10, 2009, pages 333 - 344
BUEHR, M, GENESIS OF EMBRYONIC STEM CELLS. PHILOSOPHICAL TRANSACTIONS OF THE ROYAL SOCIETY B: BIOLOGICAL SCIENCES, vol. 358, 2003, pages 1397 - 1402
C.W. DIEFFENBACH ET AL.: "PCR Primer: A Laboratory Manual", 2003, COLD SPRING HARBOR LABORATORY PRESS
CARROLL, MOLECULAR THERAPY, vol. 20, 2012, pages 1658 - 1660
CHANG ET AL., CELL RESEARCH, vol. 23, 2013, pages 720 - 723
CHOO ET AL., CURR OPIN. STRUCT. BIOL., vol. 10, 2000, pages 411 - 416
CHRISTIAN ET AL., GENETICS, vol. 186, 2010, pages 451 - 459
CUI ET AL., NATURE BIOTECHNOL., vol. 29, 2011, pages 64 - 68
D.L. NELSONM.M. COX: "DNA Amplification: Current Technologies and Applications", 2004, W.H. FREEMAN & COMPANY
DATABASE DATABASE GenBank [O] 9 November 1994 (1994-11-09), XP055543961, Database accession no. AAB59397.1 *
DATABASE DATABASE NCBI [O] 16 September 2016 (2016-09-16), XP055543967, Database accession no. NP_001259007.1 *
DELTCHEVA ET AL., NATURE, vol. 471, 2011, pages 602 - 607
DIBATTISTA ET AL., EXP. NEUROL., vol. 280, 2016, pages 97 - 105
DINGWALLET ET AL., J CELL BIOL., vol. 107, 1988, pages 841 - 9
E.HARLOWD. LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS
F. BREITLINGS. DUBEL: "Recombinant Antibodies", 1999, JOHN WILEY & SONS
GAJ ET AL., TRENDS IN BIOTECHNOL, vol. 31, no. 7, 2013, pages 397 - 405
GASIUNAS ET AL., PNAS, vol. 109, 2012, pages 17484 - 17489
GOSLING, J. P.: "Imunoassays: A Practical Approach, Practical Approach Series", 2005, OXFORD UNIVERSITY PRESS
H. ZOLA: "Basics: From Background to Bench", 2000, BIOS SCIENTIFIC PUBLISHERS, article "Monoclonal Antibodies: Preparation and Use of Monoclonal Antibodies and Engineered Antibody Derivatives"
HAFT ET AL., PLOS COMPUT BIOL, vol. 1, no. 6, 2005, pages 60
HAUSCHILD ET AL., PNAS, vol. 108, 2011, pages 12013 - 12017
HOCKEMEYER ET AL., NATURE BIOTECHNOL, vol. 29, 2011, pages 731 - 734
HORVATH, SCIENCE, vol. 327, 2010, pages 167 - 170
HUANG ET AL., CELL, vol. 168, 2017, pages 1 - 15
ISALAN ET AL., NATURE BIOTECHNOL., vol. 19, 2001, pages 656 - 660
J. SAMBROOKD.W. RUSSELL: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
JIANG ET AL., NATURE BIOTECHNOL, vol. 31, 2013, pages 233 - 239
JINEK ET AL., SCIENCE, vol. 337, 2012, pages 816 - 821
KIM ET AL., J. BIOL. CHEM., vol. 269, no. 31, 1994, pages 978 - 31,982
KIM ET AL., PNAS, vol. 91, 1994, pages 883 - 887
KIM ET AL., PNAS, vol. 93, 1996, pages 1156 - 1160
KRAUS ET AL., GENESIS, vol. 48, 2010, pages 394 - 399
LI ET AL., NUCLEIC ACIDS RES, vol. 39, 2011, pages 6315 - 6325
LI ET AL., PNAS, vol. 89, 1992, pages 4275 - 4279
LI ET AL., PNAS, vol. 90, 1993, pages 2764 - 2768
MAJUMDER, M ET AL., BLOOD, vol. 87, no. 8, 1996, pages 3203 - 3211
MAKAROVA ET AL., NATURE REVIEWS MICROBIOLOGY, vol. 9, 2011, pages 467 - 477
MAKKERH ET AL., CURR BIOL., vol. 6, 1996, pages 1025 - 1027
MAKKERH ET AL., CURRENT BIOLOGY, vol. 6, 1996, pages 1025 - 1027
MALI ET AL., SCIENCE, vol. 339, 2013, pages 823 - 826
MARRAFFINISONTHEIMER, NATURE REVIEWS GENETICS, vol. 11, 2010, pages 181 - 190
MCBURNEY, M. W. ET AL., DEVEL. DYNAMICS, vol. 200, 1994, pages 278 - 293
MCLANECORBETT, ILTBMB LIFE, vol. 61, 2009, pages 697 - 70
MEYER ET AL., PNAS USA, vol. 107, no. 34, 2010, pages 15022 - 15026
MILLER ET AL., NAT BIOTECHNOL, vol. 29, 2011, pages 143 - 148
MOORE ET AL., PLOS ONE, vol. 7, 2012, pages 37877
MOSCOUBOGDANOVE, SCIENCE, vol. 326, 2009, pages 1509 - 1512
MYERSMILLER, CABIOS, vol. 4, 1988, pages 11 17
ORLANDO ET AL., NUCLEIC ACIDS RES., vol. 38, 2010, pages 152
ORMEROD, M. G.: "Flow Cytometry: a practical approach", 2000, OXFORD UNIVERSITY PRESS
PABO ET AL., ANN. REV. BIOCHEM., vol. 70, 2001, pages 313 - 340
PORTEUSCARROLL, NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 967 - 973
RADU ET AL.: "J. Vis. Exp.", vol. 73, 2013, article "Assay to Test Blood Vessel Permeability", pages: 50062
ROBERTS ET AL., NUCLEIC ACIDS RES., vol. 31, 2003, pages 418 - 420
SCHOLZEBOCH, CURR OPIN MICROBIOL, vol. 14, 2011, pages 47 - 53
SCHORNACK ET AL., J. PLANT PHYSIOL., vol. 163, no. 3, 2006, pages 256 - 272
SCHORPP ET AL., NUCL. ACIDS RES., vol. 24, no. 9, 1996, pages 1787 - 1788
SEGAL ET AL., CURR OPIN. BIOTECHNOL, vol. 12, 2001, pages 632 - 637
SERA ET AL., BIOCHEMISTRY, vol. 41, 2002, pages 7074 - 7081
STROUD ET AL., J. BIOL. CHEM., vol. 288, 2013, pages 1685 - 1690
TAMBINI ET AL., EMBO REPORTS, vol. 17, 2016, pages 27 - 36
TENG JIANG ET AL.: "Upregulation of TREM2 Ameliorates Neuropathology and Rescues Spatial Cognitive Impairment in a Transgenic Mouse Model of AlzheimerDisease", NEUROPSYCHOPHARMACOLOGY, vol. 39, 2014, pages 2949 - 2962, XP055543947 *
TREMML ET AL., CURRENT PROTOCOLS IN STEM CELL BIOLOGY, 2008
WANG ET AL., CELL, vol. 153, 1984, pages 499 - 509
WANG ET AL., CELL, vol. 153, 2013, pages 1173 - 1183
WEFERS ET AL., PNAS, vol. 110, 2013, pages 3782 - 3787
WILD, D: "Science", 2005, ELSEVIER, article "The Immunoassay Handbook"
YU -WEN ALVIN HUANG ET AL.: "ApoE2, ApoE3 and ApoE4 Differentially Stimulate APP Transcription and Abeta Secretion", CELL, vol. 168, no. 3, 26 January 2017 (2017-01-26), pages 427 - 441, XP029897816 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115536734A (zh) * 2022-11-24 2022-12-30 安徽农业大学 具有肝癌细胞毒性和α-葡萄糖苷酶抑制活性的环色-丙-缬-亮-亮肽及制备方法
CN115536734B (zh) * 2022-11-24 2024-04-30 安徽农业大学 具有肝癌细胞毒性和α-葡萄糖苷酶抑制活性的环色-丙-缬-亮-亮肽及制备方法

Also Published As

Publication number Publication date
EP3599842A1 (en) 2020-02-05
AU2018239433B2 (en) 2024-02-01
CN110891417A (zh) 2020-03-17
EP3599842A4 (en) 2020-12-30
CA3057289A1 (en) 2018-09-27
CN110891417B (zh) 2023-05-23
JP7623785B2 (ja) 2025-01-29
US20240315220A1 (en) 2024-09-26
WO2018175581A8 (en) 2018-11-01
JP2023056032A (ja) 2023-04-18
US11957115B2 (en) 2024-04-16
JP2020515248A (ja) 2020-05-28
US20200022343A1 (en) 2020-01-23
AU2018239433A1 (en) 2019-10-10
EP3599842B1 (en) 2024-08-07

Similar Documents

Publication Publication Date Title
US20240315220A1 (en) Genetically modified mouse expressing human apoe4 and mouse trem2 p.r47h and methods of use thereof
US20250228219A1 (en) Genetically modified mouse models of alzheimer’s disease
CN111936628B (zh) 阿尔茨海默病动物模型及其应用
JP2017517250A (ja) 標的エンドヌクレアーゼを用いる哺乳類ゲノムのエピジェネティック修飾
JP7699749B2 (ja) エクソンヒト化マウス
EP3507375A1 (en) Genetically modified non-human animal with human or chimeric ctla-4
Emmer et al. Murine Surf4 is essential for early embryonic development
EP3504328A1 (en) Host cell protein modification
WO2005054463A1 (ja) レトロトランスポゾンを用いた哺乳動物のゲノム改変技術の開発
JP7222075B2 (ja) C3糸球体症のモデルとしての補体因子h遺伝子ノックアウトラット
Tsai et al. Genetic Variants of Phospholipase C-γ2 Confer Altered Microglial Phenotypes and Differential Risk for Alzheimer’s Disease
Zhou et al. CRISPR/Cas9-mediated knockin of IRES-tdTomato at Ins2 locus reveals no RFP-positive cells in mouse islets
CN109843047B (zh) 涉及经遗传修饰的免疫缺陷型非人类动物中改善的人类红血细胞存活的方法和组合物
WO2025131079A1 (en) Genetically modified non-human animal with human or chimeric inhbe
Ruppert The role of MID1, MID2, and PAX6 during neuronal differentiation and migration in the embryonic mouse neocortex
Knüwer Generation of transgenic mice for the investigation of ceramide metabolism
CN121718574A (zh) 一种tmprss6基因修饰的非人动物
CN119799785A (zh) 一种pcsk9基因修饰的非人动物
Young Generation of gene disrupted mice to further elucidate the reproductive mechanisms of male factor fertility

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18770741

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3057289

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019552004

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018239433

Country of ref document: AU

Date of ref document: 20180321

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018770741

Country of ref document: EP

Effective date: 20191021