WO2018148566A1 - Proteins binding bcma, nkg2d and cd16 - Google Patents
Proteins binding bcma, nkg2d and cd16 Download PDFInfo
- Publication number
- WO2018148566A1 WO2018148566A1 PCT/US2018/017653 US2018017653W WO2018148566A1 WO 2018148566 A1 WO2018148566 A1 WO 2018148566A1 US 2018017653 W US2018017653 W US 2018017653W WO 2018148566 A1 WO2018148566 A1 WO 2018148566A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antigen
- amino acid
- chain variable
- variable domain
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/283—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2851—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/624—Disulfide-stabilized antibody (dsFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/64—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/66—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a swap of domains, e.g. CH3-CH2, VH-CL or VL-CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/32—Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- the invention relates to multi-specific binding proteins that bind to B-cell maturation antigen (BCMA), the NKG2D receptor, and CD16.
- BCMA B-cell maturation antigen
- Cancer continues to be a significant health problem despite the substantial research efforts and scientific advances reported in the literature for treating this disease.
- Blood and bone marrow cancers are frequently diagnosed cancer types, including multiple myelomas, leukemia, and lymphomas.
- Current treatment options for these cancers are not effective for all patients and/or can have substantial adverse side effects.
- Other types of cancer also remain challenging to treat using existing therapeutic options.
- Cancer immunotherapies are desirable because they are highly specific and can facilitate destruction of cancer cells using the patient' s own immune system. Fusion proteins such as bi-specific T-cell engagers are cancer immunotherapies described in the literature that bind to tumor cells and T-cells to facilitate destruction of tumor cells. Antibodies that bind to certain tumor-associated antigens and to certain immune cells have been described in the literature. See, for example WO 2016/134371 and WO 2015/095412.
- NK cells Natural killer cells are a component of the innate immune system and make up approximately 15% of circulating lymphocytes. NK cells infiltrate virtually all tissues and were originally characterized by their ability to kill tumor cells effectively without the need for prior sensitization. Activated NK cells kill target cells by means similar to cytotoxic T cells - i.e. , via cytolytic granules that contain perforin and granzymes as well as via death receptor pathways. Activated NK cells also secrete inflammatory cytokines such as IFN- gamma and chemokines that promote the recruitment of other leukocytes to the target tissue.
- cytotoxic T cells i.e. , via cytolytic granules that contain perforin and granzymes as well as via death receptor pathways.
- Activated NK cells also secrete inflammatory cytokines such as IFN- gamma and chemokines that promote the recruitment of other leukocytes to the target tissue.
- NK cells respond to signals through a variety of activating and inhibitory receptors on their surface. For example, when NK cells encounter healthy self-cells, their activity is inhibited through activation of the killer-cell immunoglobulin-like receptors (KIRs). Alternatively, when NK cells encounter foreign cells or cancer cells, they are activated via their activating receptors (e.g. NKG2D, NCRs, DNAM1). NK cells are also activated by the constant region of some immunoglobulins through CD 16 receptors on their surface. The overall sensitivity of NK cells to activation depends on the sum of stimulatory and inhibitory signals.
- KIRs killer-cell immunoglobulin-like receptors
- BCMA is a transmembrane protein belonging to the TNF-receptor superfamily. It specifically binds to the tumor necrosis factor (ligand) superfamily, member 13b
- BCMA (TNFSF13B/TALL-1/B AFF) , leading to NF- ⁇ and MAPK8/JNK activation. Its expression is restricted to the B-cell lineage and has been shown to be important for B cell development and autoimmune response. BCMA also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. BCMA is implicated in a variety of cancers, such as multiple myeloma, lymphoma and leukemia. The present invention provides certain advantages to improve treatments for BCMA-expressing cancers. SUMMARY
- the invention provides multi-specific binding proteins that bind to BCMA on a cancer cell and the NKG2D receptor and CD16 receptor on natural killer cells.
- Such proteins can engage more than one kind of NK activating receptor, and may block the binding of natural ligands to NKG2D.
- the proteins can agonize NK cells in humans, and in other species such as rodents and cynomolgus monkeys.
- one aspect of the invention provides a protein that incorporates a first antigen-binding site that binds NKG2D; a second antigen-binding site that binds to BCMA; and an antibody Fc domain, a portion thereof sufficient to bind CD16, or a third antigen-binding site that binds CD 16.
- the antigen-binding sites may each incorporate an antibody heavy chain variable domain and an antibody light chain variable domain (e.g. arranged as in an antibody, or fused together to from an scFv), or one or more of the antigen- binding sites may be a single domain antibody, such as a VHH antibody like a camelid antibody or a V NAR antibody like those found in cartilaginous fish.
- the first antigen-binding site that binds to NKG2D can incorporate a heavy chain variable domain related to SEQ ID NO:l, such as by having an amino acid sequence at least 90%, at least 95%, or 100% identical to SEQ ID NO: l, and/or incorporating amino acid sequences identical to the CDRl (SEQ ID NO:64), CDR2 (SEQ ID NO:65), and CDR3 (SEQ ID NO:66) sequences of SEQ ID NO: l.
- the first antigen-binding site can incorporate a heavy chain variable domain related to SEQ ID NO:41 and a light chain variable domain related to SEQ ID NO:42.
- the heavy chain variable domain of the first antigen-binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:41, and/or incorporate amino acid sequences identical to the CDRl (SEQ ID NO:67), CDR2 (SEQ ID NO:68), and CDR3 (SEQ ID NO:69) sequences of SEQ ID NO:41.
- the light chain variable domain of the second antigen-binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:42, and/or incorporate amino acid sequences identical to the CDRl (SEQ ID NO:70), CDR2 (SEQ ID NO:71), and CDR3 (SEQ ID NO:72) sequences of SEQ ID NO:42.
- the first antigen- binding site can incorporate a heavy chain variable domain related to SEQ ID NO:43 and a light chain variable domain related to SEQ ID NO:44.
- the heavy chain variable domain of the first antigen-binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:43, and/or incorporate amino acid sequences identical to the CDRl (SEQ ID NO:73), CDR2 (SEQ ID NO:74), and CDR3 (SEQ ID NO:75) sequences of SEQ ID NO:43.
- the light chain variable domain of the second antigen-binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:44, and/or incorporate amino acid sequences identical to the CDRl (SEQ ID NO:76), CDR2 (SEQ ID NO:77), and CDR3 (SEQ ID NO:78) sequences of SEQ ID NO:44.
- the first antigen-binding site can incorporate a heavy chain variable domain related to SEQ ID NO:45 and a light chain variable domain related to SEQ ID NO:46, such as by having amino acid sequences at least 90%, at least 95%, or 100% identical to SEQ ID NO:45 and SEQ ID NO:46 respectively.
- the first antigen- binding site can incorporate a heavy chain variable domain related to SEQ ID NO:47 and a light chain variable domain related to SEQ ID NO:48, such as by having amino acid sequences at least 90%, at least 95%, or 100% identical to SEQ ID NO:47 and SEQ ID NO:48 respectively.
- the second antigen-binding site can optionally incorporate a heavy chain variable domain related to SEQ ID NO:49 and a light chain variable domain related to SEQ ID NO:53 or SEQ ID NO:54.
- the heavy chain variable domain of the second antigen- binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:49, and/or incorporate amino acid sequences identical to the CDR1 (SEQ ID NO:50), CDR2 (SEQ ID NO:51), and CDR3 (SEQ ID NO:52) sequences of SEQ ID NO:49.
- the light chain variable domain of the second antigen-binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:53 and/or incorporate amino acid sequences identical to the CDR1 (SEQ ID NO:55), CDR2 (SEQ ID NO:56), and CDR3 (SEQ ID NO:57) sequences of SEQ ID NO:53.
- the light chain variable domain of the second antigen-binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:54 and/or incorporate amino acid sequences identical to the CDR1 (SEQ ID NO:55), CDR2 (SEQ ID NO:56), and CDR3 (SEQ ID NO:58) sequences of SEQ ID NO:54.
- the second antigen-binding site can incorporate a heavy chain variable domain related to SEQ ID NO:59 and a light chain variable domain related to SEQ ID NO: 60.
- the heavy chain variable domain of the second antigen-binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:59, and/or incorporate amino acid sequences identical to the CDR1 (SEQ ID NO:79), CDR2 (SEQ ID NO:80), and CDR3 (SEQ ID NO:81) sequences of SEQ ID NO:59.
- the light chain variable domain of the second antigen-binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:60, and/or incorporate amino acid sequences identical to the CDR1 (SEQ ID NO:82), CDR2 (SEQ ID NO:83), and CDR3 (SEQ ID NO:84) sequences of SEQ ID NO: 60.
- the second antigen-binding site can incorporate a heavy chain variable domain related to SEQ ID NO:61 and a light chain variable domain related to SEQ ID NO:62.
- the heavy chain variable domain of the second antigen-binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:61, and/or incorporate amino acid sequences identical to the CDR1 (SEQ ID NO:85), CDR2 (SEQ ID NO:86), and CDR3 (SEQ ID NO:87) sequences of SEQ ID NO:61.
- the light chain variable domain of the second antigen-binding site can be at least 90%, at least 95%, or 100% identical to SEQ ID NO:62, and/or incorporate amino acid sequences identical to the CDR1 (SEQ ID NO:88), CDR2 (SEQ ID NO:89), and CDR3 (SEQ ID NO:90) sequences of SEQ ID NO: 62.
- the second antigen-binding site incorporates a light chain variable domain having an amino acid sequence identical to the amino acid sequence of the light chain variable domain present in the first antigen-binding site.
- the protein incorporates a portion of an antibody Fc domain sufficient to bind CD 16, wherein the antibody Fc domain comprises hinge and CH2 domains, and/or amino acid sequences at least 90% identical to amino acid sequence 234-332 of a human IgG antibody.
- Formulations containing one of these proteins; cells containing one or more nucleic acids expressing these proteins, and methods of enhancing tumor cell death using these proteins are also provided.
- Another aspect of the invention provides a method of treating cancer in a patient.
- the method comprises administering to a patient in need thereof a therapeutically effective amount of the multi- specific binding protein described herein.
- Exemplary cancers for treatment using the multi- specific binding proteins include, for example, multiple myeloma, acute myelomonocytic leukemia, T cell lymphoma, acute monocytic leukemia, and follicular lymphoma.
- FIG. 1 is a representation of a heterodimeric, multi-specific antibody.
- NKG2D- binding domain right arm
- tumor antigen-binding domain left arm
- the light chains that are common are represented with the same shade or pattern in the drawing.
- FIG. 2 is a representation of a heterodimeric, multi-specific antibody. NKG2D- binding domain - scFv (right arm); tumor antigen-binding domain (left arm).
- FIG. 3 is a representation of a TriNKET in the Triomab form, which is a trifunctional, bispecific antibody that maintains an IgG-like shape.
- This chimera consists of two half antibodies, each with one light and one heavy chain, that originate from two parental antibodies.
- Triomab form may be an heterodimeric construct containing 1 ⁇ 2 of rat antibody and 1 ⁇ 2 of mouse antibody.
- FIG. 4 is a representation of a TriNKET in the KiH Common Light Chain (LC) form, which involves the knobs-into-holes (KIHs) technology.
- KiH is a heterodimer containing 2 Fabs binding to target 1 and 2, and an Fc stabilized by heterodimerization mutations.
- TriNKET in the KiH format may be an heterodimeric construct with 2 fabs binding to target 1 and target 2, containing two different heavy chains and a common light chain that pairs with both heavy chains.
- FIG. 5 is a representation of a TriNKET in the dual-variable domain
- DVD-IgTM immunoglobulin
- DVD-IgTM is an homodimeric construct where variable domain targeting antigen 2 is fused to the N terminus of variable domain of Fab targeting antigen 1 Construct contains normal Fc.
- FIG. 6 is a representation of a TriNKET in the Orthogonal Fab interface (Ortho- Fab) form, which is an heterodimeric construct that contains 2 Fabs binding to target 1 and target 2 fused to Fc. LC-HC pairing is ensured by orthogonal interface. Heterodimerization is ensured by mutations in the Fc-
- FIG. 7 is a representation of a TrinKET in the 2 in-1 Ig format.
- FIG. 8 is a representation of a TriNKET in the ES form, which is an
- heterodimeric construct containing two different Fabs binding to target 1 and target 2 fused to the Fc- Heterodimerization is ensured by electrostatic steering mutations in the Fc.
- FIG. 9 is a representation of a TriNKET in the Fab Arm Exchange form:
- Fab Arm Exchange form (cFae) is a heterodimer containing 2 Fabs binding to target 1 and 2, and an Fc stabilized by heterodimerization mutations.
- FIG. 10 is a representation of a TriNKET in the SEED Body form, which is an heterodimer containing 2 Fabs binding to target 1 and 2, and an Fc stabilized by
- FIG. 11 is a representation of a TriNKET in the LuZ-Y form, in which leucine zipper is used to induce heterodimerization of two different HCs.
- LuZ-Y form is a heterodimer containing two different scFabs binding to target 1 and 2, fused to Fc-
- FIG. 12 is a representation of a TriNKET in the Cov-X-Body form.
- FIGs. 13A-13B are representations of TriNKETs in the ⁇ -Body forms, which are an heterodimeric constructs with two different Fabs fused to Fc stabilized by
- FIG. 13A is an exemplary representation of one form of a ⁇ -Body
- FIG. 13B is an exemplary representation of another ⁇ -Body.
- FIG. 14 are line graphs demonstrating the binding affinity of NKG2D-binding domains (listed as clones) to human recombinant NKG2D in an ELISA assay.
- FIG. 15 are line graphs demonstrating the binding affinity of NKG2D-binding domains (listed as clones) to cynomolgus recombinant NKG2D in an ELISA assay.
- FIG. 16 are line graphs demonstrating the binding affinity of NKG2D-binding domains (listed as clones) to mouse recombinant NKG2D in an ELISA assay.
- FIG. 17 are bar graphs demonstrating the binding of NKG2D-binding domains (listed as clones) to EL4 cells expressing human NKG2D by flow cytometry showing mean fluorescence intensity (MFI) fold over background.
- FIG. 18 are bar graphs demonstrating the binding of NKG2D-binding domains (listed as clones) to EL4 cells expressing mouse NKG2D by flow cytometry showing mean fluorescence intensity (MFI) fold over background.
- FIG. 19 are line graphs demonstrating specific binding affinity of NKG2D- binding domains (listed as clones) to recombinant human NKG2D-Fc by competing with natural ligand ULBP-6.
- FIG. 20 are line graphs demonstrating specific binding affinity of NKG2D- binding domains (listed as clones) to recombinant human NKG2D-Fc by competing with natural ligand MICA.
- FIG. 21 are line graphs demonstrating specific binding affinity of NKG2D- binding domains (listed as clones) to recombinant mouse NKG2D-Fc by competing with natural ligand Rae-1 delta.
- FIG. 22 are bar graphs showing activation of human NKG2D by NKG2D-binding domains (listed as clones) by quantifying the percentage of TNF-alpha positive cells, which express human NKG2D-CD3 zeta fusion proteins.
- FIG. 23 are bar graphs showing activation of mouse NKG2D by NKG2D-binding domains (listed as clones) by quantifying the percentage of TNF-alpha positive cells, which express mouse NKG2D-CD3 zeta fusion proteins.
- FIG. 24 are bar graphs showing activation of human NK cells by NKG2D- binding domains (listed as clones).
- FIG. 25 are bar graphs showing activation of human NK cells by NKG2D- binding domains (listed as clones).
- FIG. 26 are bar graphs showing activation of mouse NK cells by NKG2D-binding domains (listed as clones).
- FIG. 27 are bar graphs showing activation of mouse NK cells by NKG2D-binding domains (listed as clones).
- FIG. 28 are bar graphs showing the cytotoxic effect of NKG2D-binding domains (listed as clones) on tumor cells.
- FIG. 29 are bar graphs showing the melting temperature of NKG2D-binding domains (listed as clones) measured by differential scanning fluorimetry.
- FIG. 30 are line graphs showing binding profile of BCMA-targeting TriNKETs to NKG2D expressed on EL4 cells.
- FIG. 31 are line graphs showing binding profile of BCMA-targeting TriNKETs to BCMA expressed on MM. IS human myeloma cells.
- FIG. 32 are bar graphs showing human NK activation in culture with BCMA- positive MM. IS human myeloma cells.
- FIG. 33 are line graphs showing that BCMA targeting TriNKETs with different
- NKG2D-binding domains enhance human NK cell lysis of KMS12-PE myeloma cells.
- FIGs. 34A-34C are bar graphs of synergistic activation of NK cells using CD 16 and NKG2D.
- FIG. 34A demonstrates levels of CD107a;
- FIG. 34B demonstrates levels of IFNy;
- FIG. 34C demonstrates levels of CD107a and IFNy.
- FIG. 35 is an Oasc-Fab heterodimeric construct that includes Fab binding to target 1 and scFab binding to target 2 fused to Fc. Heterodimerization is ensured by mutations in the F c .
- FIG. 36 is a DuetMab, which is an heterodimeric construct containing two different Fabs binding to antigens 1 and 2, and Fc stabilized by heterodimerization mutations.
- Fab 1 and 2 contain differential S-S bridges that ensure correct light chain (LC) and heavy chain (HC) pairing.
- FIG. 37 is a CrossmAb, which is an heterodimeric construct with two different Fabs binding to targets 1 and 2 fused to Fc stabilized by heterodimerization.
- CL and CHI domains and VH and VL domains are switched, e.g. , CHI is fused in-line with VL, while CL is fused in-line with VH.
- FIG. 38 is a Fit-Ig, which is an homodimeric constructs where Fab binding to antigen 2 is fused to the N terminus of HC of Fab that binds to antigen 1.
- the construct contains wild-type Fc.
- FIG. 39 is a graph showing that TriNKETs enhance human NK cell lysis of KMS12-PE myeloma cells.
- the invention provides multi-specific binding proteins that bind BCMA on a cancer cell and the NKG2D receptor and CD 16 receptor on natural killer cells to activate the natural killer cell, pharmaceutical compositions comprising such multi-specific binding proteins, and therapeutic methods using such multi-specific proteins and pharmaceutical compositions, including for the treatment of cancer.
- multi-specific binding proteins that bind BCMA on a cancer cell and the NKG2D receptor and CD 16 receptor on natural killer cells to activate the natural killer cell
- pharmaceutical compositions comprising such multi-specific binding proteins
- therapeutic methods using such multi-specific proteins and pharmaceutical compositions including for the treatment of cancer.
- the term "antigen-binding site” refers to the part of the immunoglobulin molecule that participates in antigen-binding.
- the antigen-binding site is formed by amino acid residues of the N-terminal variable ("V") regions of the heavy ("H") and light (“L”) chains.
- V N-terminal variable
- H heavy
- L light
- Three highly divergent stretches within the V regions of the heavy and light chains are referred to as “hypervariable regions" which are interposed between more conserved flanking stretches known as “framework regions,” or "FRs".
- FR refers to amino acid sequences which are naturally found between and adjacent to hypervariable regions in immunoglobulins.
- the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen- binding surface.
- the antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as "complementarity-determining regions," or "CDRs.”
- CDRs complementarity-determining regions
- the antigen-binding site is formed by a single antibody chain providing a "single domain antibody.”
- Antigen-binding sites can exist in an intact antibody, in an antigen-binding fragment of an antibody that retains the antigen- binding surface, or in a recombinant polypeptide such as an scFv, using a peptide linker to connect the heavy chain variable domain to the light chain variable domain in a single polypeptide.
- tumor associated antigen means any antigen including but not limited to a protein, glycoprotein, ganglioside, carbohydrate, lipid that is associated with cancer. Such antigen can be expressed on malignant cells or in the tumor
- microenvironment such as on tumor-associated blood vessels, extracellular matrix, mesenchymal stroma, or immune infiltrates.
- the terms "subject” and “patient” refer to an organism to be treated by the methods and compositions described herein. Such organisms preferably include, but are not limited to, mammals (e.g. , murines, simians, equines, bovines, porcines, canines, felines, and the like), and more preferably include humans.
- the term "effective amount” refers to the amount of a compound
- An effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
- treating includes any effect, e.g. , lessening, reducing, modulating, ameliorating or eliminating, that results in the improvement of the condition, disease, disorder, and the like, or ameliorating a symptom thereof.
- composition refers to the combination of an active agent with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vivo or ex vivo.
- the term "pharmaceutically acceptable carrier” refers to any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions (e.g. , such as an oil/water or water/oil emulsions), and various types of wetting agents.
- the compositions also can include stabilizers and preservatives.
- stabilizers and adjuvants see e.g. , Martin, Remington's Pharmaceutical Sciences, 15th Ed., Mack Publ. Co., Easton, PA [1975].
- the term "pharmaceutically acceptable salt” refers to any pharmaceutically acceptable salt (e.g. , acid or base) of a compound of the present invention which, upon administration to a subject, is capable of providing a compound of this invention or an active metabolite or residue thereof.
- salts of the compounds of the present invention may be derived from inorganic or organic acids and bases.
- Exemplary acids include, but are not limited to, hydrochloric, hydrobromic, sulfuric, nitric, perchloric, fumaric, maleic, phosphoric, glycolic, lactic, salicylic, succinic, toluene-p- sulfonic, tartaric, acetic, citric, methanesulfonic, ethanesulfonic, formic, benzoic, malonic, naphthalene-2-sulfonic, benzenesulfonic acid, and the like.
- Other acids such as oxalic, while not in themselves pharmaceutically acceptable, may be employed in the preparation of salts useful as intermediates in obtaining the compounds of the invention and their pharmaceutically acceptable acid addition salts.
- Exemplary bases include, but are not limited to, alkali metal (e.g. , sodium) hydroxides, alkaline earth metal (e.g. , magnesium) hydroxides, ammonia, and compounds of formula NW 4 + , wherein W is Ci_ 4 alkyl, and the like.
- alkali metal e.g. , sodium
- alkaline earth metal e.g. , magnesium
- W is Ci_ 4 alkyl
- Exemplary salts include, but are not limited to: acetate, adipate, alginate, aspartate, benzoate, benzenesulfonate, bisulfate, butyrate, citrate, camphorate,
- salts include anions of the compounds of the present invention compounded with a suitable cation such as Na + , NH 4 + , and NW 4 + (wherein W
- salts of the compounds of the present invention are contemplated as being pharmaceutically acceptable.
- salts of acids and bases that are non-pharmaceutically acceptable may also find use, for example, in the preparation or purification of a pharmaceutically acceptable compound.
- compositions are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions of the present invention that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present invention that consist essentially of, or consist of, the recited processing steps.
- compositions specifying a percentage are by weight unless otherwise specified. Further, if a variable is not accompanied by a definition, then the previous definition of the variable controls.
- the invention provides multi-specific binding proteins that bind BCMA on a cancer cell and the NKG2D receptor and CD 16 receptor on natural killer cells to activate the natural killer cell.
- the multi-specific binding proteins are useful in the pharmaceutical compositions and therapeutic methods described herein. Binding of the multi-specific binding protein to the NKG2D receptor and CD 16 receptor on natural killer cell enhances the activity of the natural killer cell toward destruction of a cancer cell. Binding of the multi-specific binding protein to BCMA on a cancer cell brings the cancer cell into proximity to the natural killer cell, which facilitates direct and indirect destruction of the cancer cell by the natural killer cell. Further description of exemplary multi- specific binding proteins is provided below.
- the first component of the multi-specific binding proteins binds to NKG2D receptor-expressing cells, which can include but are not limited to NK cells, ⁇ T
- the multi-specific binding proteins may block natural ligands, such as ULBP6 and MICA, from binding to NKG2D.
- the second component of the multi- specific binding proteins binds to BCMA- expressing cells, which can include but are not limited to multiple myeloma, acute myelomonocytic leukemia, T cell lymphoma, acute monocytic leukemia, and follicular lymphoma.
- the third component for the multi-specific binding proteins binds to cells expressing CD 16, an Fc receptor on the surface of leukocytes including natural killer cells, macrophages, neutrophils, eosinophils, mast cells, and follicular dendritic cells.
- the multi-specific binding proteins can take several formats as shown in but not limited to the examples below.
- One format is a heterodimeric, multi-specific antibody that includes a first immunoglobulin heavy chain, a second immunoglobulin heavy chain and an immunoglobulin light chain.
- the first immunoglobulin heavy chain includes a first Fc (hinge- CH2-CH3) domain, a first variable heavy chain domain and an optional first CHI heavy chain domain.
- the immunoglobulin light chain includes a variable light chain domain and a constant light chain domain; together with the first immunoglobulin heavy chain, the immunoglobulin light chain forms an antigen-binding site that binds NKG2D.
- the second immunoglobulin heavy chain comprises a second Fc (hinge-CH2-CH3) domain, a second variable heavy chain domain and a second CHI heavy chain domain that may pair with an immunoglobulin light chain identical to the one that pairs with the first immunoglobulin heavy chain, except that when immunoglobulin light chain is paired with the second immunoglobulin heavy chain, the resulting antigen-binding site binds to BCMA.
- the first Fc domain and second Fc domain together are able to bind to CD16 (FIG.l).
- Another exemplary format involves a heterodimeric, multi- specific antibody that includes a first immunoglobulin heavy chain, an immunoglobulin light chain and a second immunoglobulin heavy chain.
- the first immunoglobulin heavy chain includes a first Fc (hinge-CH2-CH3) domain fused via either a linker or an antibody hinge to a single chain Fv (scFv) that binds NKG2D.
- scFv single chain Fv
- linkers could be used for linking the scFv to the first Fc domain or within the scFv itself.
- the scFv can incorporate mutations that enable the formation of a disulfide bond to stabilize the overall scFv structure.
- the scFv can also incorporate mutations to modify the isoelectric point of the overall first immunoglobulin heavy chain and/or to enable more facile downstream purification.
- the second immunoglobulin heavy chain includes a first Fc (hinge-CH2-CH3) domain fused via either
- immunoglobulin heavy chain includes a second Fc (hinge-CH2-CH3) domain and a second variable heavy chain domain and a second optional CHI heavy chain domain.
- the immunoglobulin light chain includes a variable light chain domain and a constant light chain domain.
- the second immunoglobulin heavy chain pairs with the immunoglobulin light chain and binds to BCMA.
- the first Fc domain and the second Fc domain together are able to bind to CD16 (FIG. 2).
- One or more additional binding motifs may be fused to the C-terminus of the constant region CH3 domain, optionally via a linker sequence.
- the antigen-binding site could be a single-chain or disulfide- stabilized variable region (scFv) or could form a tetravalent or trivalent molecule.
- the multi-specific binding protein is in the Triomab form, which is a trifunctional, bispecific antibody that maintains an IgG-like shape.
- This chimera consists of two half antibodies, each with one light and one heavy chain, that originate from two parental antibodies.
- the multi-specific binding protein is the KiH Common Light Chain (LC) form, which involves the knobs-into-holes (KIHs) technology.
- the KIH involves engineering CH3 domains to create either a "knob” or a "hole” in each heavy chain to promote heterodimerization.
- the concept behind the "Knobs-into-Holes (KiH)" Fc technology was to introduce a "knob” in one CH3 domain (CH3A) by substitution of a small residue with a bulky one (i.e., T366WCH3A in EU numbering).
- a complementary "hole” surface was created on the other CH3 domain (CH3B) by replacing the closest neighboring residues to the knob with smaller ones (i.e. ,
- T366S/L368A/Y407VCH3B The "hole" mutation was optimized by structured-guided phage library screening (Atwell S, Ridgway JB, Wells JA, Carter P. Stable heterodimers from remodeling the domain interface of a homodimer using a phage display library. J Mol Biol (1997) 270(l):26-35). X-ray crystal structures of KiH Fc variants (Elliott JM, Ultsch M, Lee J, Tong R, Takeda K, Spiess C, et al. , Antiparallel conformation of knob and hole aglycosylated half-antibody homodimers is mediated by a CH2-CH3 hydrophobic interaction.
- the multi-specific binding protein is in the dual-variable domain immunoglobulin (DVD-IgTM) form, which combines the target binding domains of two monoclonal antibodies via flexible naturally occurring linkers, and yields a tetravalent IgG - like molecule.
- DVD-IgTM dual-variable domain immunoglobulin
- the multi-specific binding protein is in the Orthogonal Fab interface (Ortho-Fab) form.
- Ortho-Fab IgG approach Lewis SM, Wu X, Pustilnik A, Sereno A, Huang F, Rick HL, et al. Generation of bispecific IgG antibodies by structure- based design of an orthogonal Fab interface. Nat. Biotechnol. (2014) 32(2): 191-8
- structure- based regional design introduces complementary mutations at the LC and HCVH-CHI interface in only one Fab, without any changes being made to the other Fab.
- the multi-specific binding protein is in the 2 in-1 Ig format.
- the multi-specific binding protein is in the ES form, which is an heterodimeric construct containing two different Fabs binding to targets 1 and target 2 fused to the Fc- Heterodimerization is ensured by electrostatic steering mutations in the Fc.
- the multi- specific binding protein is in the ⁇ -Body form, which is an heterodimeric constructs with two different Fabs fused to Fc stabilized by heterodimerization mutations: Fabl targeting antigen 1 contains kappa LC, while second Fab targeting antigen 2 contains lambda LC.
- FIG. 13A is an exemplary representation of one form of a ⁇ -Body;
- FIG. 13B is an exemplary representation of another ⁇ -Body.
- the multi-specific binding protein is in Fab Arm Exchange form (antibodies that exchange Fab arms by swapping a heavy chain and attached light chain (half-molecule) with a heavy-light chain pair from another molecule, which results in bispecific antibodies). In some embodiments, the multi-specific binding protein is in the
- SEED Body form The strand-exchange engineered domain (SEED) platform was designed to generate asymmetric and bispecific antibody-like molecules, a capability that expands therapeutic applications of natural antibodies. This protein engineered platform is based on exchanging structurally related sequences of immunoglobulin within the conserved CH3 domains.
- SEED design allows efficient generation of AG/GA heterodimers, while disfavoring homodimerization of AG and GA SEED CH3 domains.
- the multi- specific binding protein is in the LuZ-Y form, in which leucine zipper is used to induce heterodimerization of two different HCs. (Wranik, BJ. et al., /. Biol. Chem. (2012), 287:43331-9).
- the multi-specific binding protein is in the Cov-X-Body form.
- CovX-Bodies two different peptides are joined together using a branched azetidinone linker and fused to the scaffold antibody under mild conditions in a site-specific manner. Whereas the pharmacophores are responsible for functional activities, the antibody scaffold imparts long half-life and Ig-like distribution.
- the pharmacophores can be chemically optimized or replaced with other pharmacophores to generate optimized or unique bispecific antibodies. (Doppalapudi VR et al. , PNAS (2010), 107(52);22611-22616).
- the multi-specific binding protein is in an Oasc-Fab heterodimeric form that includes Fab binding to target 1, and scFab binding to target 2 fused to Fc. Heterodimerization is ensured by mutations in the Fc-
- the multi-specific binding protein is in a DuetMab form, which is an heterodimeric construct containing two different Fabs binding to antigens 1 and 2, and Fc stabilized by heterodimerization mutations.
- Fab 1 and 2 contain differential S-S bridges that ensure correct LC and HC pairing.
- the multi-specific binding protein is in a CrossmAb form, which is an heterodimeric construct with two different Fabs binding to targets 1 and 2, fused to Fc stabilized by heterodimerization.
- CL and CHI domains and VH and VL domains are switched, e.g. , CHI is fused in-line with VL, while CL is fused in-line with VH.
- the multi-specific binding protein is in a Fit-Ig form, which is an homodimeric constructs where Fab binding to antigen 2 is fused to the N terminus of HC of Fab that binds to antigen 1.
- the construct contains wild-type Fc.
- Table 1 lists peptide sequences of heavy chain variable domains and light chain variable domains that, in combination, can bind to NKG2D. Table 1
- CDR1 (SEQ ID NO: 105) - FTFSSYAMS CDR1 (SEQ ID NO: 108) - CDR2 (SEQ ID NO: 106) - RASQGIDSWLA
- AISGSGGSTYYADSVKG CDR2 (SEQ ID NO: 109) - AASSLQS CDR3 (SEQ ID NO: 107) - CDR3 (SEQ ID NO: 110) - AKDGGYYDSGAGDY QQGVSYPRT
- CDR1 (SEQ ID NO: 111) - FTFSSYSMN CDR1 (SEQ ID NO: 114) - CDR2 (SEQ ID NO: 112) - RASQGISSWLA
- a heavy chain variable domain defined by SEQ ID NO:45 can be paired with a light chain variable domain defined by SEQ ID NO:46 to form an antigen- binding site that can bind to NKG2D, as illustrated in US 9,273,136.
- QVQLVESGGGLVKPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIRYDGS NKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDRGLGDGTYFDYW GQGTTVTVSS (SEQ ID NO:45)
- a heavy chain variable domain defined by SEQ ID NO:47 can be paired with light chain variable domain defined by SEQ ID NO: 48 to form an antigen- binding site that can bind to NKG2D, as illustrated in US 7,879,985.
- Table 2 lists peptide sequences of heavy chain variable domains and light chain variable domains that, in combination, can bind to BCMA.
- CDR2 (SEQ ID NO: 80) - CDR2 (SEQ ID NO:83) - WINTETREPAYAYDFR LASNVQT CDR3 (SEQ ID NO:81) - CDR3 (SEQ ID NO:84) - DYSYAMDY LQSRTIPRT
- CDR1 (SEQ ID NO: 85) - NYWMH SASQDISNYLN CDR2 (SEQ ID NO: 86) - CDR2 (SEQ ID NO:89) - ATYRGHSDTYYNQKFKG YTSNLHS CDR3 (SEQ ID NO: 87) - CDR3 (SEQ ID NO:90) - GAIYNGYDVLDN QQYRKLPWT
- TLTISRVEAGDEAVYYCQVWDS IS VDTS KNQFS LKLS S VT A ADTA SSDHVVFGGGTKLTVL (SEQ ID VYYCARHDGATAGLFDYWGQG NO: 124)
- TLVTVSS (SEQ ID NO: 123)
- CDR2 DDSDRPS (SEQ ID NO: 125)
- CDR3 QVWDSSSDHVV (SEQ ID (SEQ ID NO: 126)
- CDR2 SASTRAT (SEQ ID NO: 132)
- CDR2 SASTRAT (SEQ ID NO: 132)
- CDR2 SASTRAT (SEQ ID NO: 132)
- novel antigen-binding sites that can bind to BCMA can be identified by screening for binding to the amino acid sequence defined by SEQ ID NO: 63.
- CD 16 binding is mediated by the hinge region and the CH2 domain.
- the interaction with CD16 is primarily focused on amino acid residues Asp 265 - Glu 269, Asn 297 - Thr 299, Ala 327 - He 332, Leu 234 - Ser 239, and carbohydrate residue N-acetyl-D-glucosamine in the CH2 domain (see,
- mutations can be selected to enhance or reduce the binding affinity to CD 16, such as by using phage- displayed libraries or yeast surface-displayed cDNA libraries, or can be designed based on the known three-dimensional structure of the interaction.
- the assembly of heterodimeric antibody heavy chains can be accomplished by expressing two different antibody heavy chain sequences in the same cell, which may lead to the assembly of homodimers of each antibody heavy chain as well as assembly of
- heterodimers Promoting the preferential assembly of heterodimers can be accomplished by incorporating different mutations in the CH3 domain of each antibody heavy chain constant region as shown in US13/494870, US16/028850, US11/533709, US12/875015,
- an amino acid substitution in the first polypeptide replaces the original amino acid with a larger amino acid, selected from arginine (R), phenylalanine (F), tyrosine (Y) or tryptophan (W), and at least one amino acid substitution in the second polypeptide replaces the original amino acid(s) with a smaller amino acid(s), chosen from alanine (A), serine (S), threonine (T), or valine (V), such that the larger amino acid substitution (a protuberance) fits into the surface of the smaller amino acid substitutions (a cavity).
- one polypeptide can incorporate a T366W substitution, and the other can incorporate three substitutions including T366S, L368A, and Y407V.
- An antibody heavy chain variable domain of the invention can optionally be coupled to an amino acid sequence at least 90% identical to an antibody constant region, such as an IgG constant region including hinge, CH2 and CH3 domains with or without CHI domain.
- an antibody constant region such as an IgG constant region including hinge, CH2 and CH3 domains with or without CHI domain.
- the amino acid sequence of the constant region is at least 90% identical to a human antibody constant region, such as an human IgGl constant region, an IgG2 constant region, IgG3 constant region, or IgG4 constant region.
- the amino acid sequence of the constant region is at least 90% identical to an antibody constant region from another mammal, such as rabbit, dog, cat, mouse, or horse.
- One or more mutations can be incorporated into the constant region as compared to human IgGl constant region, for example at Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411 and/or K439.
- substitutions include, for example, Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, T350V, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366L, T366M, T366K, T366W, T366S, L368E, L368A, L368D, K370S, N390D, N390E, K392L, K392M, K392V, K392F, K392D, K392E, T394F, T394W, D399R, D399K, D399V, S400K,
- mutations that can be incorporated into the CHI of a human IgGl constant region may be at amino acid V125, F126, P127, T135, T139, A140, F170, P171, and/or V173.
- mutations that can be incorporated into the CK of a human IgGl constant region may be at amino acid E123, Fl 16, S176, V163, S174, and/or T164.
- Amino acid substitutions could be selected from the following sets of substitutions shown in Table 3.
- amino acid substitutions could be selected from the following sets of substitutions shown in Table 4.
- amino acid substitutions could be selected from the following set of substitutions shown in Table 5.
- At least one amino acid substitution in each polypeptide chain could be selected from Table 6.
- At least one amino acid substitution could be selected from the following set of substitutions in Table 7, where the position(s) indicated in the First
- Polypeptide column is replaced by any known negatively-charged amino acid, and the position(s) indicated in the Second Polypeptide Column is replaced by any known positively- charged amino acid.
- At least one amino acid substitution could be selected from the following set of in Table 8, where the position(s) indicated in the First Polypeptide column replaced by any known positively-charged amino acid, and the position(s) indicated in the Second Polypeptide Column is replaced by any known negatively-charged amino acid.
- Table 8
- the structural stability of a heteromultimer protein may be increased by introducing S354C on either of the first or second polypeptide chain, and Y349C on the opposing polypeptide chain, which forms an artificial disulfide bridge within the interface of the two polypeptides.
- the multispecific proteins described above can be made using recombinant DNA technology well known to a skilled person in the art.
- a first nucleic acid sequence encoding the first immunoglobulin heavy chain can be cloned into a first expression vector
- a second nucleic acid sequence encoding the second immunoglobulin heavy chain can be cloned into a second expression vector
- a third nucleic acid sequence encoding the immunoglobulin light chain can be cloned into a third expression vector
- the first, second, and third expression vectors can be stably transfected together into host cells to produce the multimeric proteins.
- Clones can be cultured under conditions suitable for bio-reactor scale-up and maintained expression of the multi-specific protein.
- the multispecific proteins can be isolated and purified using methods known in the art including centrifugation, depth filtration, cell lysis, homogenization, freeze-thawing, affinity purification, gel filtration, ion exchange chromatography, hydrophobic interaction exchange chromatography, and mixed-mode chromatography. II. Characteristics of TriNKETs
- TriNKETs described herein which include an NKG2D- binding domain and a binding domain for a tumor associated antigen, bind to cells expressing human NKG2D.
- TriNKETs, which include an NKG2D-binding domain and a binding domain for a tumor associated antigen bind to the tumor associated antigen at a comparable level to that of a monoclonal antibody having the same tumor associated antigen-binding domain.
- TriNKETs described herein are more effective in reducing tumor growth and killing cancer cells.
- TriNKETs described herein which include an NKG2D- binding domain and a binding domain for tumor associated antigen, activate primary human NK cells when culturing with tumor cells expressing the antigen. NK cell activation is marked by the increase in CD 107a degranulation and IFNy cytokine production.
- TriNKETs show superior activation of human NK cells in the presence of tumor cells expressing the antigen.
- TriNKETs of the present disclosure having a BCMA-binding domain have a superior activation of human NK cells in the presence of BCMA-expressing cancer cells.
- TriNKETs described herein which include an NKG2D- binding domain and a binding domain for a tumor associated antigen, enhance the activity of rested and IL-2-activated human NK cells in the presence of tumor cells expressing the antigen. Rested NK cells showed less background IFNy production and CD 107a
- IL-2-activated NK cells show a greater change in IFNy production and CD 107a degranulation compared to IL-2-activated NK cells.
- IL-2-activated NK cells show a greater percentage of cells becoming IFNy+; CD107a+ after stimulation with TriNKETs.
- TriNKETs described herein which include an NKG2D- binding domain and a binding domain for tumor associated antigen BCMA, enhance the cytotoxic activity of rested and IL-2-activated human NK cells in the presence of tumor cells expressing the antigen. Furthermore, TriNKETs (e.g.
- TriNKETs offer advantage against tumor cells expressing medium and low
- a therapy including TriNKETs can be superior to an anti-BCMA monoclonal antibody therapy.
- TriNKETs described herein e.g. , A40-TriNKET, A44-TriNKET, A49-TriNKET, C26-TriNKET, F04- TriNKET, F43-TriNKET, F47-TriNKET, and F63-TriNKET
- FcR Fc receptor
- Monoclonal antibodies exert their effects on tumor growth through multiple mechanisms including ADCC, CDC, phagocytosis, and signal blockade amongst others.
- CD 16 has the lowest affinity for IgG Fc;
- FcyRI (CD64) is the high-affinity FcR, which binds about 1000 times more strongly to IgG Fc than CD 16.
- CD64 is normally expressed on many hematopoietic lineages such as the myeloid lineage, and can be expressed on tumors derived from these cell types, such as acute myeloid leukemia (AML).
- TriNKETs through targeting two activating receptors on the surface of NK cells, can overcome the detrimental effect of CD64 expression (either on tumor or tumor microenvironment) on monoclonal antibody therapy. Regardless of CD64 expression on the tumor cells, TriNKETs are able to mediate human NK cell responses against all tumor cells, because dual targeting of two activating receptors on NK cells provides stronger specific binding to NK cells.
- TriNKETs described herein e.g. , A40-TriNKET, A44- TriNKET, A49-TriNKET, C26-TriNKET, F04-TriNKET, F43 -TriNKET, F47-TriNKET, and F63-TriNKET
- TriNKETs described herein which include a binding domain for tumor associated antigen BCMA
- Natural killer cells and CD8 T cells are both able to directly lyse tumor cells, although the mechanisms through which NK cells and CD 8 T cell recognize normal self from tumor cells differ.
- NK cells The activity of NK cells is regulated by the balance of signals from activating (NCRs, NKG2D, CD16, etc.) and inhibitory (KIRs, NKG2A, etc.) receptors.
- the balance of these activating and inhibitory signals allow NK cells to determine healthy self-cells from stressed, virally infected, or transformed self-cells. This 'built-in' mechanism of self-tolerance will help protect normal heathy tissue from NK cell responses.
- the self- tolerance of NK cells will allow TriNKETs to target antigens expressed both on self and tumor without off tumor side effects, or with an increased therapeutic window.
- T cells require recognition of a specific peptide presented by MHC molecules for activation and effector functions.
- T cells have been the primary target of immunotherapy, and many strategies have been developed to redirect T cell responses against the tumor.
- T cell bispecifics, checkpoint inhibitors, and CAR-T cells have all been approved by the FDA, but often suffer from dose-limiting toxicities.
- T cell bispecifics and CAR-T cells work around the TCR-MHC recognition system by using binding domains to target antigens on the surface of tumor cells, and using engineered signaling domains to transduce the activation signals into the effector cell. Although effective at eliciting an anti-tumor immune response these therapies are often coupled with cytokine release syndrome (CRS), and on-target off-tumor side effects.
- CRS cytokine release syndrome
- TriNKETs are unique in this context as they will not Override' the natural systems of NK cell activation and inhibition. Instead, TriNKETs are designed to sway the balance, and provide additional activation signals to the NK cells, while maintaining NK tolerance to healthy self.
- TriNKETs described herein including an NKG2D- binding domain e.g. , A40-TriNKET, A44-TriNKET, A49-TriNKET, C26-TriNKET, F04- TriNKET, F43-TriNKET, F47-TriNKET, and F63-TriNKET and a binding domain for tumor associated antigen BCMA delay progression of the tumor more effectively than monoclonal antibodies that include the same tumor antigen-binding domain.
- TriNKETs including an NKG2D-binding domain and tumor antigen BCMA-binding domain are more effective against cancer metastases than monoclonal antibodies that include the anti- BCMA-binding domain.
- the invention provides methods for treating cancer using a multi- specific binding protein described herein and/or a pharmaceutical composition described herein.
- the methods may be used to treat a variety of cancers which express BCMA by administering to a patient in need thereof a therapeutically effective amount of a multi- specific binding protein described herein.
- the therapeutic method can be characterized according to the cancer to be treated.
- the cancers are blood or bone marrow derived.
- T-cell lymphomas can include precursor T-lymphoblastic lymphoma, peripheral T-cell lymphoma, cutaneous T-cell lymphoma, angioimmunoblastic T-cell lymphoma, extranodal natural killer/T-cell lymphoma, enteropathy type T-cell lymphoma, subcutaneous panniculitis -like T-cell lymphoma, anaplastic large cell lymphoma, or peripheral T-cell lymphoma.
- the cancer is a B-cell lymphoma, such as a diffuse large B-cell lymphoma, primary mediastinal B-cell lymphoma, follicular lymphoma, small lymphocytic lymphoma, mantle cell lymphoma, marginal zone B-cell lymphoma, extranodal marginal zone B-cell lymphoma, nodal marginal zone B-cell lymphoma, splenic marginal zone B-cell lymphoma, Burkitt lymphoma, lymphoplasmacytic lymphoma, hairy cell leukemia, or primary central nervous system (CNS) lymphoma.
- B-cell lymphoma such as a diffuse large B-cell lymphoma, primary mediastinal B-cell lymphoma, follicular lymphoma, small lymphocytic lymphoma, mantle cell lymphoma, marginal zone B-cell lymphoma, extranodal marginal zone B-cell lymphoma, nodal marginal
- the cancer is a solid tumor, such as brain cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, colorectal cancer, endometrial cancer, esophageal cancer, leukemia, lung cancer, liver cancer, melanoma, ovarian cancer, pancreatic cancer, prostate cancer, rectal cancer, renal cancer, stomach cancer, testicular cancer, or uterine cancer.
- the cancer is a vascularized tumor, squamous cell carcinoma, adenocarcinoma, small cell carcinoma, melanoma, glioma, neuroblastoma, sarcoma (e.g.
- an angiosarcoma or chondrosarcoma larynx cancer, parotid cancer, bilary tract cancer, thyroid cancer, acral lentiginous melanoma, actinic keratoses, acute lymphocytic leukemia, acute myeloid leukemia, adenoid cycstic carcinoma, adenomas, adenosarcoma, adenosquamous carcinoma, anal canal cancer, anal cancer, anorectum cancer, astrocytic tumor, bartholin gland carcinoma, basal cell carcinoma, biliary cancer, bone cancer, bone marrow cancer, bronchial cancer, bronchial gland carcinoma, carcinoid, cholangiocarcinoma, chondosarcoma, choriod plexus papilloma/carcinoma, chronic lymphocytic leukemia, chronic myeloid leukemia, clear cell carcinoma, connective tissue cancer, cystadenoma,
- endometrioid adenocarcinoma endothelial cell cancer, ependymal cancer, epithelial cell cancer, Ewing's sarcoma, eye and orbit cancer, female genital cancer, focal nodular hyperplasia, gallbladder cancer, gastric antrum cancer, gastric fundus cancer, gastrinoma, glioblastoma, glucagonoma, heart cancer, hemangiblastomas, hemangioendothelioma, hemangiomas, hepatic adenoma, hepatic adenomatosis, hepatobiliary cancer, hepatocellular carcinoma, Hodgkin's disease, ileum cancer, insulinoma, intaepithelial neoplasia, interepithelial squamous cell neoplasia, intrahepatic bile duct cancer, invasive squamous cell carcinoma, jejunum cancer, joint cancer, Ka
- the cancer to be treated can be characterized according to the presence of a particular antigen expressed on the surface of the cancer cell.
- the cancer cell can expresses one or more of the following in addition to BCMA: CD2, CD 19, CD20, CD30, CD38, CD40, CD52, CD70, EGFR/ERBB1, IGF1R, HER3/ERBB3,
- HER4/ERBB4 MUC1, cMET, SLAMF7, PSCA, MICA, MICB, TRAILR1, TRAILR2, MAGE- A3, B7.1, B7.2, CTLA4, and PD1.
- Multi-specific binding proteins described herein be used in combination with additional therapeutic agents to treat the cancer.
- Exemplary therapeutic agents that may be used as part of a combination therapy in treating cancer, include, for example, radiation, mitomycin, tretinoin, ribomustin, gemcitabine, vincristine, etoposide, cladribine, mitobronitol, methotrexate, doxorubicin, carboquone, pentostatin, nitracrine, zinostatin, cetrorelix, letrozole, raltitrexed, daunorubicin, fadrozole, fotemustine, thymalfasin, sobuzoxane, nedaplatin, cytarabine, bicalutamide, vinorelbine, vesnarinone, aminoglutethimide, amsacrine, proglumide, elliptinium acetate, ketanserin, doxifluridine, etretinate, isotretinoin, str
- An additional class of agents that may be used as part of a combination therapy in treating cancer is immune checkpoint inhibitors.
- exemplary immune checkpoint inhibitors include agents that inhibit one or more of (i) cytotoxic T -lymphocyte-associated antigen 4 (CTLA4), (ii) programmed cell death protein 1 (PD1), (iii) PDL1, (iv) LAG3, (v) B7-H3, (vi) B7-H4, and (vii) TIM3.
- CTLA4 inhibitor ipilimumab has been approved by the United States Food and Drug Administration for treating melanoma.
- agents that may be used as part of a combination therapy in treating cancer are monoclonal antibody agents that target non-checkpoint targets (e.g., herceptin) and non-cytotoxic agents (e.g., tyrosine-kinase inhibitors).
- non-checkpoint targets e.g., herceptin
- non-cytotoxic agents e.g., tyrosine-kinase inhibitors
- anti-cancer agents include, for example: (i) an inhibitor selected from an ALK Inhibitor, an ATR Inhibitor, an A2A Antagonist, a Base Excision Repair Inhibitor, a Bcr-Abl Tyrosine Kinase Inhibitor, a Bruton's Tyrosine Kinase Inhibitor, a CDC7 Inhibitor, a CHK1 Inhibitor, a Cyclin-Dependent Kinase Inhibitor, a DNA-PK
- Inhibitor an Inhibitor of both DNA-PK and mTOR, a DNMT1 Inhibitor, a DNMT1 Inhibitor plus 2-chloro-deoxyadenosine, an HDAC Inhibitor, a Hedgehog Signaling Pathway Inhibitor, an IDO Inhibitor, a JAK Inhibitor, a mTOR Inhibitor, a MEK Inhibitor, a MELK Inhibitor, a MTH1 Inhibitor, a PARP Inhibitor, a Phosphoinositide 3 -Kinase Inhibitor, an Inhibitor of both PARP1 and DHODH, a Proteasome Inhibitor, a Topoisomerase-II Inhibitor, a Tyrosine Kinase Inhibitor, a VEGFR Inhibitor, and a WEEl Inhibitor; (ii) an agonist of OX40, CD137, CD
- Proteins of the invention can also be used as an adjunct to surgical removal of the primary lesion.
- the amount of multi-specific binding protein and additional therapeutic agent and the relative timing of administration may be selected in order to achieve a desired combined therapeutic effect.
- the therapeutic agents in the combination, or a pharmaceutical composition or compositions comprising the therapeutic agents may be administered in any order such as, for example, sequentially, concurrently, together, simultaneously and the like.
- a multi-specific binding protein may be administered during a time when the additional therapeutic agent(s) exerts its prophylactic or therapeutic effect, or vice versa.
- compositions that contain a therapeutically effective amount of a protein described herein.
- the composition can be formulated for use in a variety of drug delivery systems.
- One or more physiologically acceptable excipients or carriers can also be included in the composition for proper formulation.
- Suitable formulations for use in the present disclosure are found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, Pa., 17th ed., 1985.
- Langer Science 249: 1527-1533, 1990).
- the intravenous drug delivery formulation of the present disclosure may be contained in a bag, a pen, or a syringe.
- the bag may be connected to a channel comprising a tube and/or a needle.
- the formulation may be a lyophilized formulation or a liquid formulation.
- the formulation may freeze-dried (lyophilized) and contained in about 12-60 vials.
- the formulation may be freeze-dried and 45 mg of the freeze-dried formulation may be contained in one vial.
- the about 40 mg - about 100 mg of freeze- dried formulation may be contained in one vial.
- freeze dried formulation from 12, 27, or 45 vials are combined to obtained a therapeutic dose of the protein in the intravenous drug formulation.
- the formulation may be a liquid formulation and stored as about 250 mg/vial to about 1000 mg/vial. In certain embodiments, the formulation may be a liquid formulation and stored as about 600 mg/vial. In certain embodiments, the formulation may be a liquid formulation and stored as about 250 mg/vial.
- This present disclosure could exist in a liquid aqueous pharmaceutical formulation including a therapeutically effective amount of the protein in a buffered solution forming a formulation.
- compositions may be sterilized by conventional sterilization techniques, or may be sterile filtered.
- the resulting aqueous solutions may be packaged for use as-is, or lyophilized, the lyophilized preparation being combined with a sterile aqueous carrier prior to administration.
- the pH of the preparations typically will be between 3 and 11, more preferably between 5 and 9 or between 6 and 8, and most preferably between 7 and 8, such as 7 to 7.5.
- the resulting compositions in solid form may be packaged in multiple single dose units, each containing a fixed amount of the above-mentioned agent or agents.
- the composition in solid form can also be packaged in a container for a flexible quantity.
- the present disclosure provides a formulation with an extended shelf life including the protein of the present disclosure, in combination with mannitol, citric acid monohydrate, sodium citrate, disodium phosphate dihydrate, sodium dihydrogen phosphate dihydrate, sodium chloride, polysorbate 80, water, and sodium hydroxide.
- an aqueous formulation is prepared including the protein of the present disclosure in a pH-buffered solution.
- the buffer of this invention may have a pH ranging from about 4 to about 8, e.g. , from about 4.5 to about 6.0, or from about 4.8 to about 5.5, or may have a pH of about 5.0 to about 5.2. Ranges intermediate to the above recited pH's are also intended to be part of this disclosure. For example, ranges of values using a combination of any of the above recited values as upper and/or lower limits are intended to be included. Examples of buffers that will control the pH within this range include acetate (e.g. sodium acetate), succinate (such as sodium succinate), gluconate, histidine, citrate and other organic acid buffers.
- the formulation includes a buffer system which contains citrate and phosphate to maintain the pH in a range of about 4 to about 8.
- the pH range may be from about 4.5 to about 6.0, or from about pH 4.8 to about 5.5, or in a pH range of about 5.0 to about 5.2.
- the buffer system includes citric acid monohydrate, sodium citrate, disodium phosphate dihydrate, and/or sodium dihydrogen phosphate dihydrate.
- the buffer system includes about 1.3 mg/ml of citric acid (e.g. , 1.305 mg/ml), about 0.3 mg/ml of sodium citrate (e.g.
- the buffer system includes 1- 1.5 mg/ml of citric acid, 0.25 to 0.5 mg/ml of sodium citrate, 1.25 to 1.75 mg/ml of disodium phosphate dihydrate, 0.7 to 1.1 mg/ml of sodium dihydrogen phosphate dihydrate, and 6.0 to 6.4 mg/ml of sodium chloride.
- the pH of the formulation is adjusted with sodium hydroxide.
- a polyol which acts as a tonicifier and may stabilize the antibody, may also be included in the formulation.
- the polyol is added to the formulation in an amount which may vary with respect to the desired isotonicity of the formulation.
- the aqueous formulation may be isotonic.
- the amount of polyol added may also be altered with respect to the molecular weight of the polyol. For example, a lower amount of a
- the polyol which may be used in the formulation as a tonicity agent is mannitol.
- the mannitol concentration may be about 5 to about 20 mg/ml.
- the concentration of mannitol may be about 7.5 to 15 mg/ml.
- the concentration of mannitol may be about 10-14 mg/ml.
- the concentration of mannitol may be about 12 mg/ml.
- the polyol sorbitol may be included in the formulation.
- a detergent or surfactant may also be added to the formulation.
- exemplary detergents include nonionic detergents such as polysorbates (e.g. polysorbates 20, 80 etc.) or poloxamers (e.g. , poloxamer 188).
- the amount of detergent added is such that it reduces aggregation of the formulated antibody and/or minimizes the formation of particulates in the formulation and/or reduces adsorption.
- the formulation may include a surfactant which is a polysorbate.
- the formulation may contain the detergent polysorbate 80 or Tween 80. Tween 80 is a term used to describe polyoxyethylene (20) sorbitanmonooleate (see Fiedler, Lexikon der Hifsstoffe, Editio Cantor Verlag
- the formulation may contain between about 0.1 mg/mL and about 10 mg/mL of polysorbate 80, or between about 0.5 mg/mL and about 5 mg/mL. In certain embodiments, about 0.1% polysorbate 80 may be added in the formulation.
- the protein product of the present disclosure is formulated as a liquid formulation.
- the liquid formulation may be presented at a 10 mg/mL concentration in either a USP / Ph Eur type I 50R vial closed with a rubber stopper and sealed with an aluminum crimp seal closure.
- the stopper may be made of elastomer complying with USP and Ph Eur.
- vials may be filled with 61.2 mL of the protein product solution in order to allow an extractable volume of 60 mL.
- the liquid formulation may be diluted with 0.9% saline solution.
- the liquid formulation of the disclosure may be prepared as a 10 mg/mL concentration solution in combination with a sugar at stabilizing levels.
- the liquid formulation may be prepared in an aqueous carrier.
- a stabilizer may be added in an amount no greater than that which may result in a viscosity undesirable or unsuitable for intravenous administration.
- the sugar may be disaccharides, e.g. , sucrose.
- the liquid formulation may also include one or more of a buffering agent, a surfactant, and a preservative.
- the pH of the liquid formulation may be set by addition of a pharmaceutically acceptable acid and/or base.
- the pH of the liquid formulation may be set by addition of a pharmaceutically acceptable acid and/or base.
- pharmaceutically acceptable acid may be hydrochloric acid.
- the base may be sodium hydroxide.
- deamidation is a common product variant of peptides and proteins that may occur during fermentation, harvest/cell clarification, purification, drug substance/drug product storage and during sample analysis.
- Deamidation is the loss of NH 3 from a protein forming a succinimide intermediate that can undergo hydrolysis.
- the succinimide intermediate results in a 17 u mass decrease of the parent peptide.
- the subsequent hydrolysis results in an 18 u mass increase.
- Isolation of the succinimide intermediate is difficult due to instability under aqueous conditions. As such, deamidation is typically detectable as 1 u mass increase. Deamidation of an asparagine results in either aspartic or isoaspartic acid.
- the parameters affecting the rate of deamidation include pH, temperature, solvent dielectric constant, ionic strength, primary sequence, local polypeptide conformation and tertiary structure.
- the amino acid residues adjacent to Asn in the peptide chain affect deamidation rates. Gly and Ser following an Asn in protein sequences results in a higher susceptibility to deamidation.
- the liquid formulation of the present disclosure may be preserved under conditions of pH and humidity to prevent deamination of the protein product.
- the aqueous carrier of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation.
- Illustrative carriers include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
- a preservative may be optionally added to the formulations herein to reduce bacterial action.
- the addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
- Intravenous (IV) formulations may be the preferred administration route in particular instances, such as when a patient is in the hospital after transplantation receiving all drugs via the IV route.
- the liquid formulation is diluted with 0.9% Sodium Chloride solution before administration.
- the diluted drug product for injection is isotonic and suitable for administration by intravenous infusion.
- a salt or buffer components may be added in an amount of 10 mM - 200 mM.
- the salts and/or buffers are pharmaceutically acceptable and are derived from various known acids (inorganic and organic) with "base forming" metals or amines.
- the buffer may be phosphate buffer.
- the buffer may be glycinate, carbonate, citrate buffers, in which case, sodium, potassium or ammonium ions can serve as counterion.
- a preservative may be optionally added to the formulations herein to reduce bacterial action.
- the addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
- the aqueous carrier of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation.
- Illustrative carriers include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
- This present disclosure could exist in a lyophilized formulation including the proteins and a lyoprotectant.
- the lyoprotectant may be sugar, e.g. , disaccharides.
- the lycoprotectant may be sucrose or maltose.
- the lyophilized formulation may also include one or more of a buffering agent, a surfactant, a bulking agent, and/or a preservative.
- the amount of sucrose or maltose useful for stabilization of the lyophilized drug product may be in a weight ratio of at least 1:2 protein to sucrose or maltose.
- the protein to sucrose or maltose weight ratio may be of from 1 :2 to 1:5.
- the pH of the formulation, prior to lyophilization may be set by addition of a pharmaceutically acceptable acid and/or base.
- the pharmaceutically acceptable acid may be hydrochloric acid.
- the pharmaceutically acceptable base may be sodium hydroxide.
- the pH of the solution containing the protein of the present disclosure may be adjusted between 6 to 8.
- the pH range for the lyophilized drug product may be from 7 to 8.
- a salt or buffer components may be added in an amount of 10 mM - 200 mM.
- the salts and/or buffers are pharmaceutically acceptable and are derived from various known acids (inorganic and organic) with "base forming" metals or amines.
- the buffer may be phosphate buffer.
- the buffer may be glycinate, carbonate, citrate buffers, in which case, sodium, potassium or ammonium ions can serve as counterion.
- a “bulking agent” may be added.
- a “bulking agent” is a compound which adds mass to a lyophilized mixture and contributes to the physical structure of the lyophilized cake (e.g. , facilitates the production of an essentially uniform lyophilized cake which maintains an open pore structure).
- Illustrative bulking agents include mannitol, glycine, polyethylene glycol and sorbitol. The lyophilized formulations of the present invention may contain such bulking agents.
- a preservative may be optionally added to the formulations herein to reduce bacterial action.
- the addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
- the lyophilized drug product may be constituted with an aqueous carrier.
- the aqueous carrier of interest herein is one which is pharmaceutically acceptable (e.g. , safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation, after lyophilization.
- Illustrative diluents include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
- the lyophilized drug product of the current disclosure is reconstituted with either Sterile Water for Injection, USP (SWFI) or 0.9% Sodium Chloride Injection, USP.
- SWFI Sterile Water for Injection
- USP 0.9% Sodium Chloride Injection
- the lyophilized protein product of the instant disclosure is constituted to about 4.5 mL water for injection and diluted with 0.9% saline solution (sodium chloride solution).
- the specific dose can be a uniform dose for each patient, for example, 50-5000 mg of protein.
- a patient's dose can be tailored to the approximate body weight or surface area of the patient.
- Other factors in determining the appropriate dosage can include the disease or condition to be treated or prevented, the severity of the disease, the route of administration, and the age, sex and medical condition of the patient. Further refinement of the calculations necessary to determine the appropriate dosage for treatment is routinely made by those skilled in the art, especially in light of the dosage information and assays disclosed herein.
- the dosage can also be determined through the use of known assays for determining dosages used in conjunction with appropriate dose-response data. An individual patient's dosage can be adjusted as the progress of the disease is monitored.
- Blood levels of the targetable construct or complex in a patient can be measured to see if the dosage needs to be adjusted to reach or maintain an effective concentration.
- Pharmacogenomics may be used to determine which targetable constructs and/or complexes, and dosages thereof, are most likely to be effective for a given individual (Schmitz et al., Clinica Chimica Acta 308: 43-53, 2001 ; Steimer et al., Clinica Chimica Acta 308: 33-41, 2001).
- dosages based on body weight are from about 0.01 ⁇ g to about 100 mg per kg of body weight, such as about 0.01 ⁇ g to about 100 mg/kg of body weight, about 0.01 ⁇ g to about 50 mg/kg of body weight, about 0.01 ⁇ g to about 10 mg/kg of body weight, about 0.01 ⁇ g to about 1 mg/kg of body weight, about 0.01 ⁇ g to about 100 ⁇ g/kg of body weight, about 0.01 ⁇ g to about 50 ⁇ g/kg of body weight, about 0.01 ⁇ g to about 10 ⁇ g/kg of body weight, about 0.01 ⁇ g to about 1 ⁇ g/kg of body weight, about 0.01 ⁇ g to about 0.1 ⁇ g/kg of body weight, about 0.1 ⁇ g to about 100 mg/kg of body weight, about 0.1 ⁇ g to about 50 mg/kg of body weight, about 0.1 ⁇ g to about 10 mg/kg of body weight, about 0.1 ⁇ g to about 1 mg/kg of body weight, about 0.01 ⁇ g to about
- Doses may be given once or more times daily, weekly, monthly or yearly, or even once every 2 to 20 years. Persons of ordinary skill in the art can easily estimate repetition rates for dosing based on measured residence times and concentrations of the targetable construct or complex in bodily fluids or tissues.
- Administration of the present invention could be intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, intrapleural, intrathecal, intracavitary, by perfusion through a catheter or by direct intralesional injection. This may be administered once or more times daily, once or more times weekly, once or more times monthly, and once or more times annually.
- NKG2D-binding domains bind to purified recombinant NKG2D
- ectodomains were fused with nucleic acid sequences encoding human IgGl Fc domains and introduced into mammalian cells to be expressed. After purification, NKG2D-Fc fusion proteins were adsorbed to wells of microplates. After blocking the wells with bovine serum albumin to prevent non-specific binding, NKG2D-binding domains were titrated and added to the wells pre-adsorbed with NKG2D-Fc fusion proteins. Primary antibody binding was detected using a secondary antibody which was conjugated to horseradish peroxidase and specifically recognizes a human kappa light chain to avoid Fc cross-reactivity.
- TMB 3, 3', 5,5'- Tetramethylbenzidine (TMB), a substrate for horseradish peroxidase, was added to the wells to visualize the binding signal, whose absorbance was measured at 450 nM and corrected at 540 nM.
- the isotype control showed minimal binding to recombinant NKG2D-Fc proteins, while the positive control bound strongest to the recombinant antigens.
- NKG2D-binding domains produced by all clones demonstrated binding across human (FIG. 14), mouse (FIG. 16), and cynomolgus (FIG. 15) recombinant NKG2D-Fc proteins, although with varying affinities from clone to clone.
- NKG2D-binding domains bind to cells expressing NKG2D
- EL4 mouse lymphoma cell lines were engineered to express human or mouse
- NKG2D - CD3 zeta signaling domain chimeric antigen receptors.
- An NKG2D-binding clone, an isotype control or a positive control was used at a 100 nM concentration to stain extracellular NKG2D expressed on the EL4 cells.
- the antibody binding was detected using fluorophore conjugated anti-human IgG secondary antibodies.
- Cells were analyzed by flow cytometry, and fold-over-background (FOB) was calculated using the mean fluorescence intensity (MFI) of NKG2D-expressing cells compared to parental EL4 cells.
- MFI mean fluorescence intensity
- NKG2D-binding domains produced by all clones bound to EL4 cells expressing human and mouse NKG2D.
- Positive control antibodies selected from SEQ ID NO:45-48, or anti-mouse NKG2D clones MI-6 and CX-5 available at eBioscience gave the best FOB binding signal.
- the NKG2D binding affinity for each clone was similar between cells expressing human NKG2D (FIG. 17) and mouse NKG2D (FIG. 18).
- Example 2 NKG2D-binding domains block natural ligand binding to NKG2D
- NKG2D-Fc-biotin was added to wells followed by NKG2D-binding domains. After incubation and washing, NKG2D-Fc-biotin that remained bound to MICA-Fc coated wells was detected using streptavidin-HRP and TMB substrate. Absorbance was measured at 450 nM and corrected at 540 nM. After subtracting background, specific binding of NKG2D- binding domains to the NKG2D-Fc proteins was calculated from the percentage of NKG2D- Fc-biotin that was blocked from binding to the MICA-Fc coated wells. The positive control antibody (selected from SEQ ID NO:45-48) and various NKG2D-binding domains blocked MICA binding to NKG2D, while isotype control showed little competition with MICA (FIG. 20).
- Nucleic acid sequences of human and mouse NKG2D were fused to nucleic acid sequences encoding a CD3 zeta signaling domain to obtain chimeric antigen receptor (CAR) constructs.
- the NKG2D-CAR constructs were then cloned into a retrovirus vector using Gibson assembly and transfected into expi293 cells for retrovirus production.
- EL4 cells were infected with viruses containing NKG2D-CAR together with 8 ⁇ g/mL polybrene. 24 hours after infection, the expression levels of NKG2D-CAR in the EL4 cells were analyzed by flow cytometry, and clones which express high levels of the NKG2D-CAR on the cell surface were selected.
- NKG2D-binding domains activate NKG2D
- Intracellular TNF-alpha production an indicator for NKG2D activation, was assayed by flow cytometry. The percentage of TNF-alpha positive cells was normalized to the cells treated with the positive control. All NKG2D-binding domains activated both human NKG2D (FIG. 22) and mouse (FIG. 23) NKG2D.
- Example 4 - NKG2D-binding domains activate NK cells
- PBMCs Peripheral blood mononuclear cells
- NK cells CD3 ⁇ CD56 +
- Isolated NK cells were then cultured in media containing 100 ng/niL IL-2 for 24-48 hours before they were transferred to the wells of a microplate to which the NKG2D-binding domains were adsorbed, and cultured in the media containing fluorophore-conjugated anti-CD107a antibody, brefeldin-A, and monensin.
- NK cells were assayed by flow cytometry using fluorophore-conjugated antibodies against CD3, CD56 and IFN-gamma.
- CD107a and IFN-gamma staining were analyzed in CD3 ⁇ CD56 + cells to assess NK cell activation.
- the increase in CD107a/IFN- gamma double-positive cells is indicative of better NK cell activation through engagement of two activating receptors rather than one receptor.
- NKG2D-binding domains and the positive control (selected from SEQ ID NO:45-48) showed a higher percentage of NK cells becoming CD107a + and IFN-gamma + than the isotype control (FIG. 24 & FIG. 25 represent data from two independent experiments, each using a different donor's PBMC for NK cell preparation).
- Spleens were obtained from C57B1/6 mice and crushed through a 70 ⁇ cell strainer to obtain single cell suspension.
- Cells were pelleted and resuspended in ACK lysis buffer (purchased from Thermo Fisher Scientific #A1049201; 155mM ammonium chloride, lOmM potassium bicarbonate, O.OlmM EDTA) to remove red blood cells.
- the remaining cells were cultured with 100 ng/mL hIL-2 for 72 hours before being harvested and prepared for NK cell isolation.
- NK cells (CD3 NK1.1 ) were then isolated from spleen cells using a negative depletion technique with magnetic beads with typically >90% purity.
- NK cells were cultured in media containing 100 ng/mL mIL-15 for 48 hours before they were transferred to the wells of a microplate to which the NKG2D-binding domains were adsorbed, and cultured in the media containing fluorophore-conjugated anti-CD 107a antibody, brefeldin-A, and monensin. Following culture in NKG2D-binding domain-coated wells, NK cells were assayed by flow cytometry using fluorophore-conjugated antibodies against CD3, NK1.1 and IFN-gamma. CD107a and IFN-gamma staining were analyzed in CD3 " NK1.1 + cells to assess NK cell activation.
- CD107a/IFN-gamma double- positive cells is indicative of better NK cell activation through engagement of two activating receptors rather than one receptor.
- NKG2D-binding domains and the positive control selected from anti-mouse NKG2D clones MI-6 and CX-5 available at eBioscience
- FIG. 26 & FIG. 27 represent data from two independent experiments, each using a different mouse for NK cell preparation).
- Example 5 NKG2D-binding domains enable cytotoxicity of target tumor cells
- NK cells Human and mouse primary NK cell activation assays demonstrate increased cytotoxicity markers on NK cells after incubation with NKG2D-binding domains. To address whether this translates into increased tumor cell lysis, a cell-based assay was utilized where each NKG2D-binding domain was developed into a monospecific antibody. The Fc region was used as one targeting arm, while the Fab region (NKG2D -binding domain) acted as another targeting arm to activate NK cells. THP-1 cells, which are of human origin and express high levels of Fc receptors, were used as a tumor target and a Perkin Elmer DELFIA Cytotoxicity Kit was used.
- THP-1 cells were labeled with BATDA reagent, and resuspended at 10 5 /mL in culture media. Labeled THP-1 cells were then combined with NKG2D antibodies and isolated mouse NK cells in wells of a microtiter plate at 37°C for 3 hours. After incubation, 20 ⁇ of the culture supernatant was removed, mixed with 200 ⁇ of Europium solution and incubated with shaking for 15 minutes in the dark. Fluorescence was measured over time by a PheraStar plate reader equipped with a time-resolved fluorescence module (Excitation 337nm, Emission 620nm) and specific lysis was calculated according to the kit instructions.
- EL4 mouse lymphoma cell lines were engineered to express human NKG2D.
- Trispecific binding proteins TriNKETs that each contain an NKG2D-binding domain, a tumor-associated antigen-binding domain (BCMA-binding domain), and an Fc domain that binds to CD 16 as shown in FIG. 1, were tested for their affinity to extracellular NKG2D expressed on EL4 cells.
- the binding of the multi-specific binding proteins to NKG2D was detected using fluorophore-conjugated anti-human IgG secondary antibodies.
- Cells were analyzed by flow cytometry, and fold-over-background (FOB) was calculated using the mean fluorescence intensity (MFI) of NKG2D-expressing cells compared to parental EL4 cells.
- MFI mean fluorescence intensity
- TriNKETs tested include BCMA-TriNKET-C26 (ADI-28226 and a BCMA- binding domain), BCMA-TriNKET-F04 (ADI-29404 and a BCMA-binding domain),
- BCMA-TriNKET-F43 (ADI-29443 and a BCMA-binding domain)
- BCMA-TriNKET- F47 (ADI-29447 and a BCMA-binding domain).
- the BCMA-binding domain used in the tested molecules was composed of a heavy chain variable domain and light chain variable domain as listed below.
- Example 8 Multi-specific binding proteins bind to human tumor antigens
- Trispecific binding proteins bind to BCMA
- MM MM.
- IS human myeloma cells expressing BCMA were used to assay the binding of TriNKETs to the tumor associated antigen BCMA.
- TriNKETs were diluted, and were incubated with the respective cells.
- TriNKETs and optionally the parental anti-BCMA monoclonal antibody (EM-801) were incubated with the cells, and the binding was detected using fluorophore-conjugated anti-human IgG secondary antibodies.
- Cells were analyzed by flow cytometry, and fold-over-background (FOB) was calculated using the mean
- C26-TriNKET-BCMA, F04-TriNKET-BCMA, F43-TriNKET-BCMA, and F47- TriNKET-BCMA show comparable levels of binding to BCMA expressed on MM. IS cells as compared with EM-801 (FIG. 31).
- Example 9 Multi-specific binding proteins activate NK cells
- Primary human NK cells are activated by TriNKETs in co-culture with target expressing human cancer cell lines
- TriNKET-BMCA, F47-TriNKET-BMCA, and F63-TriNKET-BMCA showed increased NK cell activity (FIG. 32).
- Example 10 Trispecific binding proteins enable cytotoxicity of target cancer cells
- PBMCs Peripheral blood mononuclear cells
- NK cells CD3 ⁇ CD56 +
- Isolated NK cells were cultured in media containing lOOng/mL IL-2 for activation or rested overnight without cytokine.
- IL-2-activated or rested NK cells were used the following day in cytotoxicity assays.
- NK cells were harvested from culture, cells were washed, and were resuspended at 10 5 -2.0xl0 6 /mL in culture media depending on the desired E:T ratio. 50 ⁇ of NK cells was added to each well of the plate to make a total of 200 ⁇ culture volume. The plate was incubated at 37 °C with 5%C02 for 2-3 hours before developing the assay.
- FIG. 39 shows TriNKET-mediated lysis of BCMA-positive KMS12-PE myeloma cells by rested human NK effector cells.
- Two TriNKETs cFAE-A49.801 and cFAE-A49.901 using the same NKG2D-binding domain (A49), but different BCMA targeting domains were tested for efficacy in vitro.
- Both TriNKETs enhanced NK cell lysis of KMS12-PE cells to a similar extent, but TriNKETs using the EM-901 targeting domain provided increased potency (FIG. 39).
- FIG. 33 shows cytotoxic activity of several TriNKETs using different NKG2D- binding domains (A40, A44, A49, C26, and F47), but the same BCMA targeting domain.
- PBMCs Peripheral blood mononuclear cells
- NK cells were purified from PBMCs using negative magnetic beads (StemCell # 17955). NK cells were >90% CD3 " CD56 + as determined by flow cytometry. Cells were then expanded 48 hours in media containing 100 ng/niL hIL-2 (Peprotech #200-02) before use in activation assays.
- Antibodies were coated onto a 96- well flat-bottom plate at a concentration of 2 ⁇ g/ml (anti-CD 16, Biolegend # 302013) and 5 ⁇ g/mL (anti-NKG2D, R&D #MAB 139) in 100 ⁇ sterile PBS overnight at 4 °C followed by washing the wells thoroughly to remove excess antibody.
- IL-2-activated NK cells were resuspended at 5xl0 5 cells/ml in culture media supplemented with 100 ng/niL hIL2 and 1 ⁇ g/mL APC-conjugated anti- CD107a mAb (Biolegend # 328619). lxlO 5 cells/well were then added onto antibody coated plates.
- Monensin (Biolegend # 420701) were added at a final dilution of 1: 1000 and 1 :270 respectively. Plated cells were incubated for 4 hours at 37 °C in 5% CO 2 .
- IFN- ⁇ NK cells were labeled with anti-CD3 (Biolegend #300452) and anti-CD56 mAb (Biolegend # 318328) and subsequently fixed and permeabilized and labeled with anti- IFN- ⁇ mAb (Biolegend # 506507).
- NK cells were analyzed for expression of CD 107a and IFN- ⁇ by flow cytometry after gating on live CD56 + CD3 " cells.
- FIGs. 34A-3C To investigate the relative potency of receptor combination, crosslinking of NKG2D or CD16 and co-cros slinking of both receptors by plate-bound stimulation was performed. As shown in Figure 34 (FIGs. 34A-3C), combined stimulation of CD16 and NKG2D resulted in highly elevated levels of CD 107a (degranulation) (FIG. 3 A) and/or IFN- ⁇ production (FIG. 34B). Dotted lines represent an additive effect of individual stimulations of each receptor.
- FIG. 34A demonstrates levels of CD107a
- FIG. 34B demonstrates levels of IFNy
- FIG. 34C demonstrates levels of CD107a.
- Data shown in FIGs. 34A-34C are representative of five independent experiments using five different healthy donors.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3054642A CA3054642A1 (en) | 2017-02-10 | 2018-02-09 | Proteins binding bcma, nkg2d and cd16 |
| CN201880021558.4A CN110461361A (zh) | 2017-02-10 | 2018-02-09 | 结合bcma、nkg2d和cd16的蛋白 |
| BR112019016424A BR112019016424A2 (pt) | 2017-02-10 | 2018-02-09 | proteínas de ligação a bcma, nkg2d e cd16 |
| MYPI2019004552A MY205850A (en) | 2017-02-10 | 2018-02-09 | Proteins binding bcma, nkg2d and cd16 |
| AU2018219348A AU2018219348A1 (en) | 2017-02-10 | 2018-02-09 | Proteins binding BCMA, NKG2D and CD16 |
| US16/484,936 US20190375838A1 (en) | 2017-02-10 | 2018-02-09 | Proteins binding bcma, nkg2d and cd16 |
| EP18750616.7A EP3579876A4 (en) | 2017-02-10 | 2018-02-09 | PROTEINS BINDING BCMA, NKG2D AND CD16 |
| JP2019543761A JP7257323B2 (ja) | 2017-02-10 | 2018-02-09 | Bcma、nkg2d及びcd16と結合するタンパク質 |
| SG11201907253VA SG11201907253VA (en) | 2017-02-10 | 2018-02-09 | Proteins binding bcma, nkg2d and cd16 |
| RU2019127910A RU2805254C2 (ru) | 2017-02-10 | 2018-02-09 | Белки, связывающие всма, nkg2d и cd16 |
| KR1020247004861A KR20240078657A (ko) | 2017-02-10 | 2018-02-09 | Bcma, nkg2d 및 cd16에 결합하는 단백질 |
| KR1020197026174A KR20190115469A (ko) | 2017-02-10 | 2018-02-09 | Bcma, nkg2d 및 cd16에 결합하는 단백질 |
| MX2019009566A MX2019009566A (es) | 2017-02-10 | 2018-02-09 | Proteinas de union a bcma, nkg2d y cd16. |
| IL268567A IL268567A (en) | 2017-02-10 | 2019-08-07 | BCMA, NKG2D and CD16 binding proteins |
| JP2022196214A JP2023029988A (ja) | 2017-02-10 | 2022-12-08 | Bcma、nkg2d及びcd16と結合するタンパク質 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762457780P | 2017-02-10 | 2017-02-10 | |
| US62/457,780 | 2017-02-10 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018148566A1 true WO2018148566A1 (en) | 2018-08-16 |
Family
ID=63107848
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/017653 Ceased WO2018148566A1 (en) | 2017-02-10 | 2018-02-09 | Proteins binding bcma, nkg2d and cd16 |
Country Status (14)
| Country | Link |
|---|---|
| US (1) | US20190375838A1 (https=) |
| EP (1) | EP3579876A4 (https=) |
| JP (2) | JP7257323B2 (https=) |
| KR (2) | KR20190115469A (https=) |
| CN (1) | CN110461361A (https=) |
| AU (1) | AU2018219348A1 (https=) |
| BR (1) | BR112019016424A2 (https=) |
| CA (1) | CA3054642A1 (https=) |
| IL (1) | IL268567A (https=) |
| MA (1) | MA47465A (https=) |
| MX (1) | MX2019009566A (https=) |
| MY (1) | MY205850A (https=) |
| SG (1) | SG11201907253VA (https=) |
| WO (1) | WO2018148566A1 (https=) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020033630A1 (en) * | 2018-08-08 | 2020-02-13 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind bcma, nkg2d and cd16, and methods of use |
| JP2020531525A (ja) * | 2017-08-23 | 2020-11-05 | ドラゴンフライ セラピューティクス, インコーポレイテッド | Nkg2d、cd16、および腫瘍−関連抗原に結合するタンパク質 |
| WO2020236825A3 (en) * | 2019-05-20 | 2021-02-18 | Novartis Ag | Mcl-1 inhibitor antibody-drug conjugates and methods of use |
| EP3802581A4 (en) * | 2018-05-28 | 2022-04-13 | Dragonfly Therapeutics, Inc. | MULTISPECIFIC BINDING PROTEINS AND IMPROVEMENTS THERETO |
| US11834506B2 (en) | 2017-02-08 | 2023-12-05 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| US11884732B2 (en) | 2017-02-20 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Proteins binding HER2, NKG2D and CD16 |
| US11884733B2 (en) | 2018-02-08 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| WO2024020577A3 (en) * | 2022-07-22 | 2024-02-29 | Fred Hutchinson Cancer Center | Antibodies against sars-cov-2 |
| US12043670B2 (en) | 2020-06-05 | 2024-07-23 | Eisai R&D Management Co., Ltd. | Anti-BCMA antibody-drug conjugates and methods of use |
| US12157771B2 (en) | 2020-05-06 | 2024-12-03 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and CLEC12A |
| US12215157B2 (en) | 2018-02-20 | 2025-02-04 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| EP4314080A4 (en) * | 2021-03-31 | 2025-06-04 | Janssen Biotech, Inc. | MATERIALS AND METHODS FOR REDIRECTING IMMUNE EFFECTOR CELLS |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| RU2854591C2 (ru) * | 2019-05-20 | 2026-01-14 | Новартис Аг | Конъюгаты антитело-лекарственное средство ингибитора MCL-1 и способы их применения |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3131927B8 (en) * | 2014-04-14 | 2020-12-23 | Cellectis | Bcma (cd269) specific chimeric antigen receptors for cancer immunotherapy |
| CN110461361A (zh) * | 2017-02-10 | 2019-11-15 | 蜻蜓治疗公司 | 结合bcma、nkg2d和cd16的蛋白 |
| CN112029001B (zh) * | 2020-09-02 | 2022-09-06 | 南京北恒生物科技有限公司 | 靶向nk激活性受体的嵌合抗原受体 |
| CN116368154A (zh) * | 2020-10-08 | 2023-06-30 | 阿菲姆德股份有限公司 | 三特异性结合剂 |
| EP4301402A1 (en) | 2021-03-03 | 2024-01-10 | Chemotherapeutisches Forschungsinstitut Georg-Speyer-Haus | Bispecific antibodies enhancing cell mediated immune responses |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140141022A1 (en) * | 2006-06-12 | 2014-05-22 | Emergent Product Development Seattle, Llc | Single-chain multivalent binding proteins with effector function |
| US20150166654A1 (en) * | 2012-05-30 | 2015-06-18 | Chugai Seiyaku Kabushiki Kaisha | Target tissue-specific antigen-binding molecule |
| WO2015197582A1 (en) * | 2014-06-27 | 2015-12-30 | Innate Pharma | Monomeric multispecific antigen binding proteins |
| US20160077105A1 (en) * | 2013-04-29 | 2016-03-17 | Adimab, Llc | Polyspecificity reagents, methods for their preparation and use |
Family Cites Families (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007002905A1 (en) * | 2005-06-29 | 2007-01-04 | University Of Miami | Antibody-immune cell ligand fusion protein for cancer therapy |
| JP6157046B2 (ja) * | 2008-01-07 | 2017-07-05 | アムジェン インコーポレイテッド | 静電的ステアリング(electrostaticsteering)効果を用いた抗体Fcヘテロ二量体分子を作製するための方法 |
| UY32808A (es) | 2009-07-29 | 2011-02-28 | Abbott Lab | Inmunoglobulinas como dominio variable dual y usos de las mismas |
| EP2306234A3 (de) * | 2009-10-02 | 2011-06-22 | Fraunhofer-Gesellschaft zur Förderung der Angewandten Forschung e.V. | Optischer Aliasfilter, Pixelsensoranordnung und digitale Aufnahmevorrichtung |
| BR112013023918A2 (pt) * | 2011-03-25 | 2016-12-13 | Glenmark Pharmaceuticals Sa | imunoglobulina hetero-dimérica ou fragmento hetero-dimérico da mesma, método para produzir uma imunoglobulina hetero-dimérica ou fragmento hetero-dimérico da mesma, método para construir uma interface proteína-proteína de um domínio de uma proteína de múltiplos domínios e uso de um domínio doador de um primeiro e de um segundo membro de uma super-família de imunoglobulina de ocorrência natural |
| TWI679212B (zh) | 2011-11-15 | 2019-12-11 | 美商安進股份有限公司 | 針對bcma之e3以及cd3的結合分子 |
| RU2639287C2 (ru) | 2012-06-27 | 2017-12-20 | Ф. Хоффманн-Ля Рош Аг | Способ отбора и получения высокоселективных и мультиспецифичных нацеливающих групп с заданными свойствами, включающих по меньшей мере две различные связывающие группировки, и их применения |
| WO2014122143A1 (en) * | 2013-02-05 | 2014-08-14 | Engmab Ag | Method for the selection of antibodies against bcma |
| BR112017001183A2 (pt) * | 2014-07-21 | 2017-11-28 | Novartis Ag | tratamento de câncer usando receptor de antígeno quimérico anti-bcma humanizado |
| WO2016134371A2 (en) * | 2015-02-20 | 2016-08-25 | Ohio State Innovation Foundation | Bivalent antibody directed against nkg2d and tumor associated antigens |
| RS61907B1 (sr) * | 2015-04-06 | 2021-06-30 | Subdomain Llc | Polipeptidi koji sadrže de novo vezujući domen i njihova primena |
| WO2017165464A1 (en) * | 2016-03-21 | 2017-09-28 | Elstar Therapeutics, Inc. | Multispecific and multifunctional molecules and uses thereof |
| WO2018148447A1 (en) * | 2017-02-08 | 2018-08-16 | Adimab, Llc | Antibody heavy chain variable domains targeting the nkg2d receptor |
| AU2018219887B2 (en) * | 2017-02-08 | 2024-08-15 | Dragonfly Therapeutics, LLC | Multi-specific binding proteins for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| CN110461361A (zh) * | 2017-02-10 | 2019-11-15 | 蜻蜓治疗公司 | 结合bcma、nkg2d和cd16的蛋白 |
| US20200179511A1 (en) * | 2017-04-28 | 2020-06-11 | Novartis Ag | Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor |
-
2018
- 2018-02-09 CN CN201880021558.4A patent/CN110461361A/zh active Pending
- 2018-02-09 MA MA047465A patent/MA47465A/fr unknown
- 2018-02-09 JP JP2019543761A patent/JP7257323B2/ja active Active
- 2018-02-09 MY MYPI2019004552A patent/MY205850A/en unknown
- 2018-02-09 US US16/484,936 patent/US20190375838A1/en active Pending
- 2018-02-09 SG SG11201907253VA patent/SG11201907253VA/en unknown
- 2018-02-09 CA CA3054642A patent/CA3054642A1/en active Pending
- 2018-02-09 WO PCT/US2018/017653 patent/WO2018148566A1/en not_active Ceased
- 2018-02-09 AU AU2018219348A patent/AU2018219348A1/en not_active Abandoned
- 2018-02-09 EP EP18750616.7A patent/EP3579876A4/en active Pending
- 2018-02-09 BR BR112019016424A patent/BR112019016424A2/pt not_active Application Discontinuation
- 2018-02-09 KR KR1020197026174A patent/KR20190115469A/ko not_active Ceased
- 2018-02-09 MX MX2019009566A patent/MX2019009566A/es unknown
- 2018-02-09 KR KR1020247004861A patent/KR20240078657A/ko not_active Ceased
-
2019
- 2019-08-07 IL IL268567A patent/IL268567A/en unknown
-
2022
- 2022-12-08 JP JP2022196214A patent/JP2023029988A/ja active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140141022A1 (en) * | 2006-06-12 | 2014-05-22 | Emergent Product Development Seattle, Llc | Single-chain multivalent binding proteins with effector function |
| US20140154252A1 (en) * | 2006-06-12 | 2014-06-05 | Emergent Product Development Seattle, Llc | Single-chain multivalent binding proteins with effector function |
| US20150166654A1 (en) * | 2012-05-30 | 2015-06-18 | Chugai Seiyaku Kabushiki Kaisha | Target tissue-specific antigen-binding molecule |
| US20160077105A1 (en) * | 2013-04-29 | 2016-03-17 | Adimab, Llc | Polyspecificity reagents, methods for their preparation and use |
| WO2015197582A1 (en) * | 2014-06-27 | 2015-12-30 | Innate Pharma | Monomeric multispecific antigen binding proteins |
Cited By (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11834506B2 (en) | 2017-02-08 | 2023-12-05 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| US11884732B2 (en) | 2017-02-20 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Proteins binding HER2, NKG2D and CD16 |
| JP2020531525A (ja) * | 2017-08-23 | 2020-11-05 | ドラゴンフライ セラピューティクス, インコーポレイテッド | Nkg2d、cd16、および腫瘍−関連抗原に結合するタンパク質 |
| US12129300B2 (en) | 2018-02-08 | 2024-10-29 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| US12264200B2 (en) | 2018-02-08 | 2025-04-01 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US11884733B2 (en) | 2018-02-08 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US11939384B1 (en) | 2018-02-08 | 2024-03-26 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12215157B2 (en) | 2018-02-20 | 2025-02-04 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use |
| EP3802581A4 (en) * | 2018-05-28 | 2022-04-13 | Dragonfly Therapeutics, Inc. | MULTISPECIFIC BINDING PROTEINS AND IMPROVEMENTS THERETO |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| EP3833392A4 (en) * | 2018-08-08 | 2022-05-18 | Dragonfly Therapeutics, Inc. | MULTISPECIFIC BINDING PROTEINS FOR BINDING CD33, NKG2D AND CD16 AND METHODS OF USE |
| WO2020033630A1 (en) * | 2018-08-08 | 2020-02-13 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind bcma, nkg2d and cd16, and methods of use |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12384851B2 (en) | 2018-08-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use |
| WO2020236825A3 (en) * | 2019-05-20 | 2021-02-18 | Novartis Ag | Mcl-1 inhibitor antibody-drug conjugates and methods of use |
| RU2854591C2 (ru) * | 2019-05-20 | 2026-01-14 | Новартис Аг | Конъюгаты антитело-лекарственное средство ингибитора MCL-1 и способы их применения |
| US12157771B2 (en) | 2020-05-06 | 2024-12-03 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and CLEC12A |
| US12043670B2 (en) | 2020-06-05 | 2024-07-23 | Eisai R&D Management Co., Ltd. | Anti-BCMA antibody-drug conjugates and methods of use |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| EP4314080A4 (en) * | 2021-03-31 | 2025-06-04 | Janssen Biotech, Inc. | MATERIALS AND METHODS FOR REDIRECTING IMMUNE EFFECTOR CELLS |
| WO2024020577A3 (en) * | 2022-07-22 | 2024-02-29 | Fred Hutchinson Cancer Center | Antibodies against sars-cov-2 |
Also Published As
| Publication number | Publication date |
|---|---|
| RU2019127910A (ru) | 2021-03-10 |
| JP2023029988A (ja) | 2023-03-07 |
| IL268567A (en) | 2019-09-26 |
| BR112019016424A2 (pt) | 2020-04-07 |
| KR20240078657A (ko) | 2024-06-04 |
| KR20190115469A (ko) | 2019-10-11 |
| EP3579876A4 (en) | 2020-11-18 |
| JP2020507328A (ja) | 2020-03-12 |
| EP3579876A1 (en) | 2019-12-18 |
| MX2019009566A (es) | 2020-01-20 |
| US20190375838A1 (en) | 2019-12-12 |
| CN110461361A (zh) | 2019-11-15 |
| CA3054642A1 (en) | 2018-08-16 |
| SG11201907253VA (en) | 2019-09-27 |
| AU2018219348A1 (en) | 2019-08-29 |
| MY205850A (en) | 2024-11-15 |
| MA47465A (fr) | 2019-12-18 |
| RU2019127910A3 (https=) | 2021-06-15 |
| JP7257323B2 (ja) | 2023-04-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230391877A1 (en) | Multispecific binding proteins targeting cea | |
| AU2018220734B2 (en) | Proteins binding CD33, NKG2D and CD16 | |
| US11884732B2 (en) | Proteins binding HER2, NKG2D and CD16 | |
| US20240018266A1 (en) | Proteins binding cd123, nkg2d and cd16 | |
| US20190375838A1 (en) | Proteins binding bcma, nkg2d and cd16 | |
| US20200277384A1 (en) | Proteins binding nkg2d, cd16, and c-type lectin-like molecule-1 (cll-1) | |
| US20200157226A1 (en) | Proteins binding nkg2d, cd16 and a tumor-associated antigen | |
| EP3579848A1 (en) | Multi-specific binding proteins for activation of natural killer cells and therapeutic uses thereof to treat cancer | |
| WO2019051308A1 (en) | NKG2D, CD16 BINDING PROTEINS AND ANTIGEN ASSOCIATED WITH A TUMOR | |
| US20200024353A1 (en) | Proteins binding psma, nkg2d and cd16 | |
| US20200231700A1 (en) | Proteins binding gd2, nkg2d and cd16 | |
| AU2018309712A1 (en) | Proteins binding NKG2D, CD16 and FLT3 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18750616 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3054642 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019543761 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019016424 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2018219348 Country of ref document: AU Date of ref document: 20180209 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20197026174 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018750616 Country of ref document: EP Effective date: 20190910 |
|
| ENP | Entry into the national phase |
Ref document number: 112019016424 Country of ref document: BR Kind code of ref document: A2 Effective date: 20190808 |
|
| WWR | Wipo information: refused in national office |
Ref document number: 521430879 Country of ref document: SA |
|
| WWR | Wipo information: refused in national office |
Ref document number: 1020247004861 Country of ref document: KR |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 268567 Country of ref document: IL |