WO2018130834A1 - Mycobacteria tuberculosis chaperonin 60.1 peptides and uses thereof - Google Patents
Mycobacteria tuberculosis chaperonin 60.1 peptides and uses thereof Download PDFInfo
- Publication number
- WO2018130834A1 WO2018130834A1 PCT/GB2018/050072 GB2018050072W WO2018130834A1 WO 2018130834 A1 WO2018130834 A1 WO 2018130834A1 GB 2018050072 W GB2018050072 W GB 2018050072W WO 2018130834 A1 WO2018130834 A1 WO 2018130834A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- isolated
- peptide molecule
- recombinant peptide
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/35—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/04—Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/48—Drugs for disorders of the endocrine system of the pancreatic hormones
- A61P5/50—Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/10—Antioedematous agents; Diuretics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
Definitions
- the present invention relates to novel peptides derivable from the Mycobacteria tuberculosis polypeptide chaperonin 60.1 and to their use in medicine, such as for the prevention and/or treatment of inflammatory conditions.
- WO2009106819 discloses a series of novel peptides derivable from MtCpn60.1 including a peptide designated as "Peptide 4" having an amino acid sequence: DGSWVNKVSELPAGHGLNVNTLSYGDLAAD (SEQ ID NO: 1). SEQ ID NO: 1 exhibits anti-inflammatory activity and has been shown to significantly reduce the recruitment of eosinophils in an animal model of allergic airway inflammation.
- WO2013057499 discloses several sub-fragments of SEQ ID NO: 1 that are shown to possess biological activity.
- the present invention is based upon the unexpected finding that certain novel sub-fragments and variants of SEQ ID NO: 1 (DGSWVNKVSELPAGHGLNVNTLSYGDLAAD) exhibit biological activity and an improved pharmacokinetic profile.
- the novel peptides of the present invention are particularly suited for development as pharmaceuticals owing to their comparatively short amino acid chain length which renders them convenient to prepare and isolate in high yield. They are also indicated to possess improved biological stability in vivo relative to MtCpn60.1 and known peptide fragments thereof. In particular, the peptides claimed herein possess improved half-life.
- the present application provides an isolated or recombinant peptide molecule consisting of an amino acid sequence selected from one of the group (i) to (ix): (i) XHGLNVNTLSYGD (SEQ ID NO: 2)
- X is absent or is selected from the group consisting of a beta alanine residue, 9-amino-3,6-dioxaoctanoic acid, and an acetyl group; or variants thereof comprising one or more of i(i) to i(iii);
- i(i) one or more amino acid residues are in the D conformation, i(ii) GLNVNTLSYGD is inverted, or
- the present inventors have surprisingly found that the above-mentioned peptides are effective as anti-inflammatory agents whilst at the same time having significantly improved plasma half-life relative to the known peptides derived from chaperonin 60.1 described above.
- the peptides of the invention are chemically or recombinantly synthesized and have a number of different chemical, structural and functional properties to the full-length chaperonin 60.1.
- peptides consisting of the amino acid sequence defined in (i) to (ix) reduce trafficking of eosinophils and/or neutrophils to sites of inflammation, permitting their use in the prevention and/or treatment of a variety of diseases and disorders, including asthma, multiple sclerosis, Crohn's disease, rheumatoid arthritis and inflammatory bowel disease.
- a function e.g. biological activity
- peptides consisting of the amino acid sequence defined in (i) to (ix) reduce trafficking of eosinophils and/or neutrophils to sites of inflammation, permitting their use in the prevention and/or treatment of a variety of diseases and disorders, including asthma, multiple sclerosis, Crohn's disease, rheumatoid arthritis and inflammatory bowel disease.
- Functional equivalence in respect of a particular biological activity can be measured using conventional models and methods; for example, by measuring inflammogen induced eosinophil or neutrophil pulmonary influx in sensitized (inflammogen - ovalbumin) or naive (inflammogen - LPS) animals .
- variant is meant a peptide having an amino acid sequence which has or 66% or more, such as 70%, 75%, 80%, 85%, 90% or 95% or more identity to a sequence (i) to (ix) above.
- variant refers to polypeptides and peptides differing from naturally occurring molecules by amino acid insertions, deletions, and substitutions, created using, e g., recombinant DNA techniques.
- Guidance in determining which amino acid residues may be replaced, added or deleted without abolishing activities of interest may be found by comparing the sequence of the particular polypeptide with that of homologous peptides and minimizing the number of amino acid sequence changes made in regions of high homology (conserved regions) or by replacing amino acids with consensus sequence.
- recombinant variants encoding these same or similar polypeptides may be synthesized or selected by making use of the "redundancy" in the genetic code.
- Various codon substitutions such as the silent changes which produce various restriction sites, may be introduced to optimize cloning into a plasmid or viral vector or expression in a particular prokaryotic or eukaryotic system.
- Mutations in the polynucleotide sequence may be reflected in the polypeptide or domains of other peptides added to the polypeptide to modify the properties of any part of the polypeptide, to change characteristics such as ligand- binding affinities, interchain affinities, or degradation/turnover rate.
- amino acid substitutions are the result of replacing one amino acid with another amino acid having similar structural and/or chemical properties, i.e., conservative amino acid replacements.
- conservative amino acid replacements may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
- nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine; polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine; positively charged (basic) amino acids include arginine, lysine, and histidine; and negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
- “Insertions” or “deletions” are preferably in the range of about 1 to 10 amino acids, more preferably 1 to 5 amino acids, such as 1 , 2, 3, 4 or 5 amino acids.
- the variation allowed may be experimentally determined by systematically making insertions, deletions, or substitutions of amino acids in a polypeptide molecule using recombinant DNA techniques and assaying the resulting recombinant variants for biological activity.
- insertions, deletions or non-conservative alterations can be engineered to produce altered polypeptides.
- Such alterations can, for example, alter one or more of the biological functions or biochemical characteristics of the polypeptides of the invention.
- such alterations may change polypeptide characteristics such as ligand-binding affinities, interchain affinities, or degradation/turnover rate.
- such alterations can be selected so as to generate polypeptides that are better suited for expression, scale up and the like in the host cells chosen for expression.
- Fragments of the peptides of the present invention which are capable of exhibiting biological activity are also encompassed by the present invention.
- Such fragments may be in linear form or they may be cyclized using known methods, for example, as described in H. U. Saragovi, et al., Bio/Technology 10, 773-778 (1992) and in R. S. McDowell, et al., J. Amer. Chem. Soc. 114, 9245-9253 (1992), both of which are incorporated herein by reference.
- Such fragments may be fused to carrier molecules such as immunoglobulins for many purposes, including increasing the valency of protein binding sites.
- identity is meant the number or percentage (dependent on presentation of the results) of amino acid residues in a candidate sequence that are identical with the amino acid residues of the sequence of interest, after aligning the sequences and introducing gaps, if necessary to achieve maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- the percentage sequence identity between two polypeptides may be determined using suitable computer programs, for example the GAP program of the University of Wisconsin Genetic Computing Group and it will be appreciated that percent identity is calculated in relation to polypeptides whose sequence has been aligned optimally.
- the alignment may alternatively be carried out using the Clustal W program (Thompson et al., (1994) Nucleic Acids Res. 22, 4673-80).
- the parameters used may be as follows: fast pairwise alignment parameters: K-tuple(word) size; 1 , window size; 5, gap penalty; 3, number of top diagonals; 5. Scoring method: x percent; multiple alignment parameters: gap open penalty; 10, gap extension penalty; 0.05. Scoring matrix: BLOSUM.
- Sequence identity may be determined, e.g., using the Jotun Hein method (Hein, J. (1990) Methods Enzymol. 183:626-645). Identity between sequences can also be determined by other methods known in the art, e.g. by varying hybridization conditions.
- Preferred embodiments of the invention relate to an isolated or recombinant peptide molecule consisting of an amino acid sequence selected from one of the group (a) to (n):
- NKVSELPAGHGLNVNTLSYGDLAAD SEQ ID NO: 8
- upper case denotes an L-amino acid residue
- lower case denotes a D-amino acid residue
- X is absent or is selected from the group consisting of a beta alanine residue, 9-amino-3,6-dioxaoctanoic acid, and an acetyl group.
- the peptides of the invention preferably consist of from 5 to 40 amino acid residues, preferably 5 to 30, most preferably 5 to 20 amino acid residues.
- the isolated or recombinant peptide molecule consists of an amino acid sequence HGLNVNTLSYGD-NH2 (SEQ ID NO: 17) or a functionally equivalent fragment or variant thereof.
- the isolated or recombinant peptide molecule consists of an amino acid sequence bAla-HGLNVNTLSYGD-NH2 (SEQ ID NO: 18) or a functionally equivalent fragment or variant thereof.
- the isolated or recombinant peptide molecule consists of an amino acid sequence Ac-dGysltnvnlGh-NH2 (SEQ ID NO: 19), Ac-hGlnvntlsyGd-NH2 (SEQ ID NO: 20) or a functionally equivalent fragment or variant thereof.
- the present invention provides an isolated or recombinant peptide molecule consisting of an amino acid sequence hGLNVNTLSYGd-NH2 (SEQ ID NO: 14) or a functionally equivalent fragment or variant thereof.
- the present invention provides an isolated or recombinant peptide molecule consisting of an amino acid sequence HGLNVNTLSYGd-NH2 (SEQ ID NO: 15); or a functionally equivalent fragment or variant thereof.
- isolated or recombinant peptide molecule consisting of an amino acid sequence hGLNVNTLSYGD-NH2 (SEQ ID NO: 16); or a functionally equivalent fragment or variant thereof.
- an isolated or recombinant peptide molecule consisting of an amino acid sequence DGSWVN KVSEL-N H2 (SEQ ID NO: 3); or a functionally equivalent fragment or variant thereof.
- MtCpn60.1 may be cloned and expressed using the methods described in T.H. Kong et al., Proc. Natl. Acad. Sci., 1993, 90, 2608-2612 and J.C. Lewthwaite et al, Infection and Immunity, 2001 , 69(12), 7349-7355. MtCpn60.1 is also commercially available from Lionex (Germany).
- the peptides of the present invention may be prepared and/or isolated using conventional methods known in the art. For example, by solution or solid phase synthesis using traditional methods or using a solid phase automated synthesizer, for example as described in I. Coin, Nature Protocols, 2007, 2, 3247-3256.
- the peptides of the present invention are prepared by Fmoc solid phase synthesis using methods analogous to those described in G.B. Fields and R.L. Noble, Int. J. Peptide Protein Res., 1990, 35(3), 161-214.
- Peptides may be cyclized using known methods, for example, as described in H. U. Saragovi, et al., Bio/Technology 10, 773-778 (1992) and in R. S.
- Such peptides may be fused to carrier molecules such as immunoglobulins for many purposes, including increasing the valency of protein binding sites. It is understood that the compounds of the invention include salts. Metabolites and pro-drugs are also included. The compounds according to the invention also include any isotopic derivatives.
- the peptides may be used according to the invention when the patient is further administered one or more therapeutic agents or when the peptides are provided in combination with one or more therapeutic agents.
- the therapeutic agent may be selected from, but not limited to, disease modifying agents, including biological immunomodulators, analgesics, broncodilators, anti-inflammatory agents, anti-allergic drugs, allergen immunotherapy, antivira!s, antibiotics, antibodies, steroids and drugs commonly used in the treatment of any of the chronic and relapsing-remitting conditions according to the invention.
- Disease modifying agents include for example hydroxychloroquine, sulfasalazine, leflunamide, methotrexate and minocycline and biologies which target TNFaipha.such as abatacept, adalimumab, etanercept, infliximab and golimumab, or immunomodulators such as alemtuzumab, interferon beta- 1 b, beta interferon-1a dimethyl fumarate, Copaxone, nataiizumab and teriflunomide.
- Analgesics include, paracetamol, non steroidal antiinflammatory drugs such as ibuprofen and aspirin, codeine, tramadol, morphine, amitripty!ine, gabapentin and opiates.
- Anti-inflammatory agents include leukotriene receptor antagonists, theophylline and PDE4 inhibitors such as roflumiiast, low, medium and high dose corticosteroids, via inhalation, sub cutaneous, intramuscular, sublingual, intravenous and oral dosing.
- Antivirals include oseltamivir.
- Antibiotics include amoxicillin.
- Antibodies include anti-!gE antibodies (e.g. omaiuzimab), antibodies which modify cytokine signaling (e.g. anti-!L-5mab mepoiuzimab).
- Steroids include fluticasone propionate and fluticasone furorate, beciomethasone dipropionate, budesonide, ciciesonide, f!unisolide. and mometasone.
- the use according to the invention when the further one or more therapeutic agents are selected from corticosteroids, anti-ieukotrienes, cytokine monoclonal antibodies or theophylline may be preferred.
- Use when the further agent is a bronchodilator may also be preferred.
- Preferred bronchodilators include, short acting B2 agonists such as salbutarnol, long acting B2 agonists such as sa!meterol, formotero!, olodaterol and vilanteroi, short acting muscarinic receptor antagonists such as ipratropium bromide and long acting muscarinic receptor antagonists such as aclidinum bromide, tiotropium bromide, and glycopyrronium bromide.
- short acting B2 agonists such as salbutarnol
- long acting B2 agonists such as sa!meterol, formotero!, olodaterol and vilanteroi
- short acting muscarinic receptor antagonists such as ipratropium bromide and long acting muscarinic receptor antagonists such as aclidinum bromide, tiotropium bromide, and glycopyrronium bromide.
- a peptide as defined herein for use in medicine or veterinary medicine.
- the peptide of the invention may be for use in a human or non-human animal, typically a mammal.
- the peptide of the present invention is used for the treatment and/or prevention of acute and/or chronic inflammatory conditions.
- acute and/or chronic inflammatory conditions include inflammation associated with infection (such as septic shock, sepsis or systemic inflammatory response syndrome (SIRS)), ischemia-reperfusion injury including coronary thrombosis and cerebral artery blockage, shock lung syndrome, endotoxin lethality, arthritis (particularly rheumatoid arthritis or chronic inflammatory arthritis), complement-mediated hyperacute rejection, nephritis, cytokine or chemokine-induced lung injury, non-allergic asthma, allergic asthma, allergic rhinitis, atopic dermatitis, cystic fibrosis, pulmonary fibrosis, inflammatory bowel disease, Crohn's disease and ulcerative colitis.
- infection such as septic shock, sepsis or systemic inflammatory response syndrome (SIRS)
- ischemia-reperfusion injury including coronary thrombosis and cerebral artery
- inflammatory conditions include; acute organ failure associated with surgery, such as acute kidney injury, acute respiratory distress syndrome associated with the following surgical interventions (not exhaustive list); cardiac surgery, coronary artery bypass, aortic aneurysm, valve surgery, oesophagectomy, kidney diseases, coronary artery bypass grafting, aortic root and ascending aortic aneurysm repair surgery.
- acute organ failure associated with surgery such as acute kidney injury, acute respiratory distress syndrome associated with the following surgical interventions (not exhaustive list); cardiac surgery, coronary artery bypass, aortic aneurysm, valve surgery, oesophagectomy, kidney diseases, coronary artery bypass grafting, aortic root and ascending aortic aneurysm repair surgery.
- the present invention provides the use of a peptide as defined herein for the prevention and/or treatment of chronic obstructive pulmonary disease.
- the present invention provides the use of a peptide as defined herein for the prevention and/or treatment of autoimmune disorders.
- autoimmune disorders are included conditions where it can be shown that the autoimmune process contributes to the pathogenesis of a disease. Such disorders are typically associated with a T helper lymphocyte-1 (Th-1) type immune response.
- Th-1 T helper lymphocyte-1
- Preferred autoimmune disorders include rheumatoid arthritis and multiple sclerosis.
- the present invention provides the use of a peptide as defined herein for the prevention and/or treatment of allergic conditions.
- allergic conditions and disorders which may be prevented and/or treated with the peptide molecules of the present invention include eczema, dermatitis, allergic rhinitis (hay fever), allergic airways diseases, hyper-eosinophilic syndrome, contact dermatitis; respiratory diseases characterized by eosinophilic airway inflammation and airway hyper-responsiveness, such as asthma, including allergic asthma and intrinsic asthma, allergic bronchopulmonary aspergillosis, eosinophilic pneumonia, allergic bronchitis bronchiectasis, occupational asthma, reactive airway disease syndrome, interstitial lung disease, hyper-eosinophilic syndrome, parasitic lung disease; anaphylaxis, serum sickness, drug reactions, food allergies, insect venom allergies, mastocytosis, hypersensitivity pneumonitis, urticaria, angioedema, eczema, a
- allergic disorders and “allergic conditions” as used herein are included conditions associated with a T helper lymphocyte-2 (Th-2) type immune response.
- Th-2 T helper lymphocyte-2
- IgE levels occur and Th-2 immune responses predominate over Th-1 responses, resulting in inflammatory response.
- WO2013057499 discloses suitable assays for assessing
- T-cell-dependent immunoglobulin responses and isotype switching which will identify, among others, proteins that modulate T-cell dependent antibody responses and that affect Th1/Th2 profiles
- MLR mixed lymphocyte reaction
- dendritic cell-dependent assays (which will identify, among others, proteins expressed by dendritic cells that activate naive T-cells),
- lymphocyte survival/apoptosis (which will identify, among others, proteins that prevent apoptosis after superantigen induction and proteins that regulate lymphocyte homeostasis),
- immunomodulatory effects of the peptide molecules of the present invention against rheumatoid arthritis may be determined in an experimental animal model system.
- treatment means reducing, alleviating or eliminating one or more symptoms of the condition which is being treated, relative to the symptoms prior to treatment.
- symptoms which may be affected include eosinophilia, decreased secretion of particular cytokines, a Th2-baised immune response, allergic response and the presence of autoantibodies.
- prevention means delaying or preventing the onset of a condition or reducing its severity, as assessed by the appearance or extent of one or more symptoms of said condition.
- the invention further provides a method of preventing and/or treating a condition as defined above which comprises administering to a mammal, including man, a peptide as defined herein.
- the invention still further provides the use of a peptide as defined herein in the manufacture of a medicament for the prevention and/or treatment of a condition as defined above.
- the present invention provides a pharmaceutical composition
- a pharmaceutical composition comprising a peptide molecule as defined above and one or more pharmaceutically acceptable excipients for use in a method as defined above.
- the compounds described herein may be formulated for administration in any convenient way.
- the present invention provides a pharmaceutical composition comprising a peptide molecule as defined above and one or more pharmaceutically acceptable excipients for use in a method as defined above.
- Any suitable route of administration can be used.
- any of oral, topical, parenteral, ocular, rectal, vaginal, inhalation, buccal, sublingual and intranasal delivery routes may be suitable.
- the peptide molecules and pharmaceutical compositions of the invention can be administered parenterally, for example, intravenously, intra-arterially, intraperitoneally, intra- thecally, intraventricularly, intrasternally, intracranially, intra-muscularly or subcutaneously, or they may be administered by infusion techniques. They are best used in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood.
- the aqueous solutions should be suitably buffered (preferably to a pH of from 3 to 9), if necessary.
- the preparation of suitable parenteral formulations under sterile conditions is readily accomplished by standard pharmaceutical techniques well-known to those skilled in the art.
- Medicaments and pharmaceutical compositions suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
- the medicaments and compositions may be presented in unit- dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
- Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.
- the molecules, medicaments and pharmaceutical compositions of the invention can also be administered intranasally or by inhalation and are conveniently delivered in the form of a dry powder inhaler or an aerosol spray presentation from a pressurised container, pump, spray or nebuliser with the use of a suitable propellant, e.g.
- the dosage unit may be determined by providing a valve to deliver a metered amount.
- the pressurised container, pump, spray or nebuliser may contain a solution or suspension of the active agent, e.g.
- Capsules and cartridges (made, for example, from gelatin) for use in an inhaler or insufflator may be formulated to contain a powder mix of a agent of the invention and a suitable powder base such as lactose or starch.
- Aerosol or dry powder formulations are preferably arranged so that each metered dose or "puff" contains at least 200pg of a molecule of the invention for delivery to the patient. It will be appreciated that he overall daily dose with an aerosol will vary from patient to patient, and may be administered in a single dose or, more usually, in divided doses throughout the day.
- the peptide molecules and pharmaceutical compositions of the invention can also be delivered orally.
- the process may employ a natural process for oral uptake of vitamin Bi 2 and/or vitamin D in the body to co-deliver proteins and peptides.
- the nucleic acids, molecules and pharmaceutical formulations of the invention can move through the intestinal wall.
- Complexes are synthesised between vitamin Bi 2 analogues and/or vitamin D analogues and the drug that retain both significant affinity for intrinsic factor (IF) in the vitamin Bi 2 portion/vitamin D portion of the complex and significant bioactivity of the active substance of the complex.
- IF intrinsic factor
- compositions of the invention will normally be administered by any parenteral route or intranasally, and in some embodiments orally, in the form of a pharmaceutical composition comprising the active ingredient.
- compositions may be administered at varying doses.
- the peptide molecules and pharmaceutical compositions of the invention can be administered alone but will generally be administered in admixture with a suitable pharmaceutical excipient, diluent or carrier selected with regard to the intended route of administration and standard pharmaceutical practice.
- the pharmaceutical composition of the present invention is a unit dosage containing a daily dose or unit, daily sub-dose or an appropriate fraction thereof, of the active ingredient.
- the peptide molecules and pharmaceutical compositions of the invention can be administered orally, buccally or sublingually in the form of tablets, capsules, ovules, elixirs, solutions or suspensions, which may contain flavouring or colouring agents, for immediate-, delayed- or controlled-release applications.
- the peptide molecules and pharmaceutical compositions of the invention may also be administered via intracavernosal injection.
- Such tablets may contain excipients such as microcrystalline cellulose, lactose, sodium citrate, calcium carbonate, dibasic calcium phosphate and glycine, disintegrants such as starch (preferably corn, potato or tapioca starch), sodium starch glycollate, croscarmellose sodium and certain complex silicates, and granulation binders such as polyvinylpyrrolidone, hydroxypropylmethylcellulose (HPMC), hydroxy-propylcellulose (HPC), sucrose, gelatin and acacia. Additionally, lubricating agents such as magnesium stearate, stearic acid, and glyceryl behenate may be included.
- excipients such as microcrystalline cellulose, lactose, sodium citrate, calcium carbonate, dibasic calcium phosphate and glycine
- disintegrants such as starch (preferably corn, potato or tapioca starch), sodium starch glycollate, croscarmellose sodium and certain complex silicates
- Solid compositions of a similar type may also be employed as fillers in gelatin capsules.
- Preferred excipients in this regard include lactose, starch, cellulose, milk sugar or high molecular weight polyethylene glycols.
- the agents of the invention may be combined with various sweetening or flavouring agents, colouring matter or dyes, with emulsifying and/or suspending agents and with diluents such as water, ethanol, propylene glycol and glycerin, and combinations thereof.
- the daily dosage level of the molecules, medicaments and pharmaceutical compositions of the invention will usually be from 200pg to 100 mg per adult per day administered in single or divided doses.
- the vial, the tablets or capsules of the molecules of the invention may contain from 200pg to 100mg of active agent for administration singly or two or more at a time, as appropriate.
- the physician in any event will determine the actual dosage which will be most suitable for any individual patient and it will vary with the age, weight and response of the particular patient.
- the above dosages are exemplary of the average case. There can, of course, be individual instances where higher or lower dosage ranges are merited and such are within the scope of this invention.
- the molecules, medicaments and pharmaceutical compositions of the invention can be administered in the form of a suppository or pessary, or they may be applied topically in the form of a lotion, solution, cream, gel, ointment or dusting powder.
- the molecules, medicaments and pharmaceutical compositions of the invention may also be transdermal ⁇ administered, for example, by the use of a skin patch. They may also be administered by the ocular route, particularly for treating diseases of the eye.
- the molecules, medicaments and pharmaceutical compositions of the invention can be formulated as micronised suspensions in isotonic, pH adjusted, sterile saline, or, preferably, as solutions in isotonic, pH adjusted, sterile saline, optionally in combination with a preservative such as a benzylalkonium chloride.
- a preservative such as a benzylalkonium chloride.
- they may be formulated in an ointment such as petrolatum.
- the molecules, medicaments and pharmaceutical compositions of the invention can be formulated as a suitable ointment containing the active agent suspended or dissolved in, for example, a mixture with one or more of the following: mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene polyoxypropylene agent, emulsifying wax and water.
- ком ⁇ онентs can be formulated as a suitable lotion or cream, suspended or dissolved in, for example, a mixture of one or more of the following: mineral oil, sorbitan monostearate, a polyethylene glycol, liquid paraffin, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
- Formulations suitable for topical administration in the mouth include lozenges comprising the active ingredient in a flavoured basis, usually sucrose and acacia or tragacanth; pastilles comprising the active ingredient in an inert basis such as gelatin and glycerin, or sucrose and acacia; and mouth-washes comprising the active ingredient in a suitable liquid carrier.
- the molecules, medicaments and pharmaceutical compositions of the invention is administered as a suitably acceptable formulation in accordance with normal veterinary practice and the veterinary surgeon will determine the dosing regimen and route of administration which will be most appropriate for a particular animal.
- the formulation is a pharmaceutical formulation.
- the formulation is a veterinary formulation.
- the daily dosage level will be from 10pg to 100mg.
- the daily dosage level will be from 20pg to 50mg, 20pg to 10mg or 20pg to 8mg, administered in single or divided doses.
- Preferred pharmaceutical formulations include those in which the active ingredient is present in at least 0.000001 % up to 5% by weight. That is, the ratio of active ingredient to the other components (i.e. the addition of adjuvant, diluent and carrier) of the pharmaceutical composition is at least 1 :99 (e.g. at least 10:90, preferably at least 30:70 and most preferably at least 50:50) by weight.
- the pharmaceutical composition or the medicament of the invention is formulated to permit administration by at least one route selected from the group comprising or consisting of: intranasal; oral; parenteral; topical; ophthalmic; suppository; pessary; or inhalation routes. Formulations suitable for such administration routes are well known to those in the art of pharmacy and medicine and exemplary formulations are described above and in the accompanying examples.
- the time between dose administration to the patient is between six and twelve hours; in a preferred embodiment, the time between dose administration to the patient is between nine and twelve hours after the previous dose; more preferably, the time between dose administration to the patient is between twelve hours and twelve days; even more preferably, the time between dose administration to the patient is between twelve days and six months.
- the pharmaceutical composition or the medicament of the invention is formulated to permit administration by at least one route selected from the group comprising or consisting of: intranasal; sub-lingual, oral; parenteral; topical; ophthalmic; suppository; pessary; or inhalation routes.
- routes selected from the group comprising or consisting of: intranasal; sub-lingual, oral; parenteral; topical; ophthalmic; suppository; pessary; or inhalation routes.
- routes suitable for such administration routes are well known to those in the art of pharmacy and medicine and exemplary formulations are described above and in the accompanying examples.
- Figure 1 shows the effect of SEQ ID NO: 1 (0.5 pg/mouse i.v) on LPS induced lung neutrophil influx in the mouse when SEQ ID NO: 1 is administered at 0, 30 and 60 minutes prior to administration of LPS.
- Figure 2 shows the effect of SEQ ID NO: 3 (50 pg/mouse i.v) on LPS induced lung neutrophil influx in the mouse when SEQ ID NO: 3 is administered at 0, 30 and 60 minutes prior to administration of LPS.
- Figure 3 shows the effect of SEQ ID NO: 3 (50 pg/mouse i.v) on LPS induced lung neutrophil influx in the mouse when SEQ ID NO: 3 is administered at 0, 30, 60 and 120 minutes post administration of LPS.
- Figure 4 shows the effect of SEQ ID NO: 1 (50 pg/mouse i.v) on LPS induced lung neutrophil influx in the mouse when SEQ ID NO: 1 is administered at 0, 30, 60 and 120 minutes post administration of LPS.
- Figure 5 shows the effect of SEQ ID NO: 17 (0.05, 0.5 and 5 pg/dose) on LPS induced neutrophil influx to the mouse lung.
- Figure 6 shows the effect of SEQ ID NOs: 21 , 22 and 18 (50pg/mouse) on LPS induced neutrophil influx to the mouse lung.
- Figure 7 shows the effect of SEQ ID NO: 4 (0.5, 5 and 500 pg/dose) on LPS induced neutrophil influx to the mouse lung.
- Fmoc SPSS Fluorenylmethoxycarbonyl solid phase peptide synthesis
- Peptides were synthesized on 2-Chlorotrityl or TentaGel resins, derivatized with one of a number of cleavable linkers, using an Fmoc/t-butyl-based solid- phase synthesis strategy.
- Temporary N-amino group protection was afforded by the Fmoc- group, with t-butyl ethers being used for protection of tyrosine, serine, and threonine hydroxyl side chains, whereas t-butyl esters protected the side chains of aspartic and glutamic acid residues.
- Histidine and lysine side chains were protected as their N-trityl and N-Boc derivatives, respectively, cysteine as its S-trityl derivative and arginine guanidine moiety as its Pbf derivative.
- peptides were cleaved from the solid support, with removal of side chain protecting groups, by treatment with trifluoroacetic acid (TFA) containing tnisobutylsilane and water as scavengers. After removal of TFA and scavengers by evaporation and trituration in diethyl ether, peptide purification was performed by reversed-phase preparative HPLC, followed by lyophilization. The purified product was subsequently analyzed by reverse-phase HPLC and by mass spectrometry.
- TFA trifluoroacetic acid
- SEQ ID NO: 3 is a peptide in accordance with the invention which is a fragment of the peptide SEQ ID NO: 1 (Table 1) (peptide 4 disclosed in WO2009/106819).
- mice Female and male mice, 6 to 8 weeks old (Harlan, UK) received 25 ⁇ g/mouse of E. Coli lipopolysaccharide (LPS) intranasally immediately after receiving intranasal peptide diluted in sterile saline or saline only. 4 hours later mice were euthanized with an overdose of urethane and a cannula inserted into the exposed trachea and three 0.5 ml aliquots of saline were injected into the lungs. From the BAL (bronchoalveolar lavage) fluid, an aliquot (50 ⁇ ) was added to 50 ⁇ of haemolysis solution (Turk's solution, Fluka, UK).
- LPS E. Coli lipopolysaccharide
- cytospin preparations were prepared from aliquots of BAL fluid (100 ⁇ ) centrifuged at 1000 rpm for 1 min at room temperature. Cells were stained with Diff Quick and a total of 100 cells were counted to determine the proportion of neutrophils, eosinophils and monocytes using standard morphological criteria.
- SEQ ID NO: 1 is extremely potent in the mouse LPS model when dosed intravenously immediately prior to LPS challenge showing a significant inhibition of LPS induced lung neutrophil influx. SEQ ID NO: 1 looses its activity in this model however when given at earlier ( Figure 1) or later ( Figure 4) time points.
- SEQ ID NO: 3 A fragment of SEQ ID NO: 1 , SEQ ID NO: 3 is effective in the LPS mouse model when dosed intravenously. Surprisingly SEQ ID NO: 3 is also efficacious in this model against LPS induced lung neutrophil influx when dosed up to 60 mins prior to LPS challenge (Figure 2) and up to 120mins post LPS challenge ( Figure 3) unlike SEQ ID NO: 1 , which only demonstrates efficacy when dosed immediately prior to LPS challenge ( Figures 1 and 4).
- SEQ ID NO: 3 The extended dosing options for SEQ ID NO: 3 allow for both therapeutic and prophylactic, dosing protocols to be employed clinically. This profile extends the number of indications able to be treated with this peptide.
- SEQ ID NO: 1 A small peptide fragment of SEQ ID NO: 1 (peptide 4 in WO2009/106819) was synthesized and tested for efficacy in the LPS mouse lung neutrophilia model and for plasma stability in mouse, rat and human plasma (SEQ ID NO: 17). Modifications of this peptide were then made and the resulting molecules tested in the same systems.
- Plasma mouse (C57 Black 6 Male), rat (Sprague Dawley) and human containing heparin as an anti-coagulant.
- Figures 5, 6 and 7 show the results of testing the peptides in the LPS mouse method as described above for Example 2.
- Figures 5 and 6 show the effect of SEQ ID NO: 17 on LPS induced lung neutrophil influx in the mouse, with a reduction in the number of neutrophils on administration of different doses of SEQ ID NO: 17 (0.5, 5 or 50 pg/mouse).
- Figure 7 shows the effect of SEQ ID NOs: 21 , 22 and 18 (50pg/mouse, i.v) on LPS induced lung neutrophil influx in the mouse.
- SEQ ID NO: 18 retains anti-inflammatory activity in the LPS mouse model whilst showing a significant improvement in plasma half-life (Th) over the parent peptide SEQ ID NO: 17 in mouse, rat and human plasma (Table 3).
- SEQ ID NO: 21 and SEQ ID NO: 22 show superior Th to SEQ ID NO: 17 but loose efficacy in the LPS mouse lung inflammation model. Accordingly, addition of a beta-alanine group at the C-terminal only improves plasma stability whilst preserving efficacy.
- Table 4 shows plasma stability data in 3 species for SEQ ID NO: 23 and SEQ ID NO: 5: (peptide fragments 2 and 3 from WO2013057499).
- SEQ ID NO: 4 A longer fragment (SEQ ID NO: 4) was synthesized, an extended form of fragment 3 and tested for plasma stability. This fragment showed a superior half-life (Table 5) and maintained in vivo efficacy in the mouse LPS lung inflammation model (Figure 7).
- Beta- alanine addition is known to enhance the ability of synthetic protein fragments to survive the degradative action of aminopeptidases and serum proteolytic enzymes.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Diabetes (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Hematology (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Urology & Nephrology (AREA)
- Physical Education & Sports Medicine (AREA)
- Rheumatology (AREA)
- Endocrinology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Neurology (AREA)
- Oncology (AREA)
- Vascular Medicine (AREA)
- Heart & Thoracic Surgery (AREA)
- Pain & Pain Management (AREA)
- Tropical Medicine & Parasitology (AREA)
- Biomedical Technology (AREA)
- Obesity (AREA)
- Neurosurgery (AREA)
- Emergency Medicine (AREA)
- Communicable Diseases (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES18701789T ES2970436T3 (es) | 2017-01-12 | 2018-01-11 | Péptidos de chaperonina 60.1 de tuberculosis micobacteriana y usos de los mismos |
| US16/476,064 US11098090B2 (en) | 2017-01-12 | 2018-01-11 | Mycobacteria tuberculosis chaperonin 60.1 peptides and uses thereof |
| CA3049353A CA3049353C (en) | 2017-01-12 | 2018-01-11 | Mycobacteria tuberculosis chaperonin 60.1 peptides and uses thereof |
| JP2019538337A JP7252895B2 (ja) | 2017-01-12 | 2018-01-11 | 結核菌シャペロニン60.1ペプチドおよびその使用 |
| AU2018208077A AU2018208077B2 (en) | 2017-01-12 | 2018-01-11 | Mycobacteria tuberculosis chaperonin 60.1 peptides and uses thereof |
| EP18701789.2A EP3568148B1 (en) | 2017-01-12 | 2018-01-11 | Mycobacteria tuberculosis chaperonin 60.1 peptides and uses thereof |
| CN201880017906.0A CN110381979A (zh) | 2017-01-12 | 2018-01-11 | 结核分枝杆菌陪伴蛋白60.1肽及其用途 |
| JP2022188982A JP2023029902A (ja) | 2017-01-12 | 2022-11-28 | 結核菌シャペロニン60.1ペプチドおよびその使用 |
| JP2024196183A JP2025032107A (ja) | 2017-01-12 | 2024-11-08 | 結核菌シャペロニン60.1ペプチドおよびその使用 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB1700557.0 | 2017-01-12 | ||
| GBGB1700557.0A GB201700557D0 (en) | 2017-01-12 | 2017-01-12 | Novel peptides |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018130834A1 true WO2018130834A1 (en) | 2018-07-19 |
Family
ID=58463310
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2018/050072 Ceased WO2018130834A1 (en) | 2017-01-12 | 2018-01-11 | Mycobacteria tuberculosis chaperonin 60.1 peptides and uses thereof |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US11098090B2 (https=) |
| EP (1) | EP3568148B1 (https=) |
| JP (3) | JP7252895B2 (https=) |
| CN (1) | CN110381979A (https=) |
| AU (1) | AU2018208077B2 (https=) |
| CA (1) | CA3049353C (https=) |
| ES (1) | ES2970436T3 (https=) |
| GB (1) | GB201700557D0 (https=) |
| WO (1) | WO2018130834A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11834478B2 (en) | 2017-01-12 | 2023-12-05 | Revolo Biotherapeutics Limited | Method for the treatment of a relapsing-remitting condition |
| WO2024218571A1 (en) * | 2023-04-18 | 2024-10-24 | Revolo Biotherapeutics Limited | Methods and compositions for preventing or treating eosinophilic esophagitis |
| US12331088B2 (en) | 2017-01-12 | 2025-06-17 | Revolo Biotherapeutics Limited | Method for the treatment of a relapsing-remitting condition |
| US12358957B2 (en) | 2017-01-12 | 2025-07-15 | Revolo Biotherapeutics Limited | Method for the acute treatment of atopic dermatitis and allergic skin hypersensitivity |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB201700557D0 (en) * | 2017-01-12 | 2017-03-01 | Peptinnovate Ltd | Novel peptides |
| IL316981A (en) | 2022-05-16 | 2025-01-01 | Revolo Biotherapeutics Ltd | Methods and compositions for preventing or treating food allergies |
| US20240287781A1 (en) | 2023-02-28 | 2024-08-29 | Toto Ltd. | Wall-mounted flush toilet |
| AU2024326126A1 (en) | 2023-08-15 | 2026-04-02 | Revolo Biotherapeutics Limited | Methods and compositions for preventing or treating severe asthma |
| WO2025255468A2 (en) | 2024-06-06 | 2025-12-11 | Miguel Guzman | Subcutaneous formulation of a peptide derived from chaperonin 60.1 |
| WO2026024894A2 (en) | 2024-07-24 | 2026-01-29 | De Alba Jorge | Sublingual formulations of a peptide derived from chaperonin 60.1 and related methods |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002040037A2 (en) | 2000-11-17 | 2002-05-23 | Helperby Therapeutics Limited | M. tuberculosis chaperonin 60.1 and uses thereof |
| GB2391477A (en) * | 2002-11-08 | 2004-02-11 | Helperby Therapeutics Ltd | Pain relief agents |
| WO2009106819A2 (en) | 2008-02-25 | 2009-09-03 | Helperby Therapeutics Limited | Biological materials and uses thereof |
| WO2013057499A1 (en) | 2011-10-21 | 2013-04-25 | Peptinnovate Limited | Novel peptides |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR2858936A1 (fr) * | 2003-08-22 | 2005-02-25 | Diatos | Potentialisation de l'activation de prodrogues de haut poids moleculaire |
| JP2010502765A (ja) * | 2006-09-11 | 2010-01-28 | ザ・ボード・オブ・トラスティーズ・オブ・ザ・ユニバーシティ・オブ・イリノイ | キュプレドキシン由来ペプチドの修飾及びそれを使用する方法 |
| WO2011057078A2 (en) * | 2009-11-05 | 2011-05-12 | University Of Virginia Patent Foundation | Compositions and methods for detecting plectin-1 as a biomarker for cancer |
| GB201700557D0 (en) * | 2017-01-12 | 2017-03-01 | Peptinnovate Ltd | Novel peptides |
-
2017
- 2017-01-12 GB GBGB1700557.0A patent/GB201700557D0/en not_active Ceased
-
2018
- 2018-01-11 WO PCT/GB2018/050072 patent/WO2018130834A1/en not_active Ceased
- 2018-01-11 US US16/476,064 patent/US11098090B2/en active Active
- 2018-01-11 EP EP18701789.2A patent/EP3568148B1/en active Active
- 2018-01-11 CA CA3049353A patent/CA3049353C/en active Active
- 2018-01-11 AU AU2018208077A patent/AU2018208077B2/en active Active
- 2018-01-11 ES ES18701789T patent/ES2970436T3/es active Active
- 2018-01-11 JP JP2019538337A patent/JP7252895B2/ja active Active
- 2018-01-11 CN CN201880017906.0A patent/CN110381979A/zh active Pending
-
2022
- 2022-11-28 JP JP2022188982A patent/JP2023029902A/ja active Pending
-
2024
- 2024-11-08 JP JP2024196183A patent/JP2025032107A/ja active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002040037A2 (en) | 2000-11-17 | 2002-05-23 | Helperby Therapeutics Limited | M. tuberculosis chaperonin 60.1 and uses thereof |
| GB2391477A (en) * | 2002-11-08 | 2004-02-11 | Helperby Therapeutics Ltd | Pain relief agents |
| WO2009106819A2 (en) | 2008-02-25 | 2009-09-03 | Helperby Therapeutics Limited | Biological materials and uses thereof |
| WO2013057499A1 (en) | 2011-10-21 | 2013-04-25 | Peptinnovate Limited | Novel peptides |
Non-Patent Citations (11)
| Title |
|---|
| G.B. FIELDS; R.L. NOBLE, INT. J. PEPTIDE PROTEIN RES., vol. 35, no. 3, 1990, pages 161 - 214 |
| H. U. SARAGOVI ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 773 - 778 |
| H. U. SARAGOVI, BIO/TECHNOLOGY, vol. 10, 1992, pages 773 - 778 |
| HEIN, J., METHODS ENZYMOL., vol. 183, 1990, pages 626 - 645 |
| I. COIN, NATURE PROTOCOLS, vol. 2, 2007, pages 3247 - 3256 |
| J. PEPTIDE SCI., vol. 5, 1999, pages 465 - 471 |
| J.C. LEWTHWAITE ET AL., INFECTION AND IMMUNITY, vol. 69, no. 12, 2001, pages 7349 - 7355 |
| LEWTHWAITE J C ET AL: "Mycobacterium tuberculosis chaperonin 60.1 is a more potent cytokine stimulator than chaperonin 60.2 (Hsp 65) and contains a CD14-binding domain", INFECTION AND IMMUNITY,, vol. 69, no. 12, 1 December 2001 (2001-12-01), pages 7349 - 7355, XP002387790, ISSN: 0019-9567, DOI: 10.1128/IAI.69.12.7349-7355.2001 * |
| R. S. MCDOWELL ET AL., J. AMER. CHEM. SOC., vol. 114, 1992, pages 9245 - 9253 |
| T.H. KONG ET AL., PROC. NATL. ACAD. SCI., vol. 90, 1993, pages 2608 - 2612 |
| THOMPSON ET AL., NUCLEIC ACIDS RES., vol. 22, 1994, pages 4673 - 80 |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11834478B2 (en) | 2017-01-12 | 2023-12-05 | Revolo Biotherapeutics Limited | Method for the treatment of a relapsing-remitting condition |
| US11834477B2 (en) | 2017-01-12 | 2023-12-05 | Revolo Biotherapeutics Limited | Method for the acute treatment of atopic dermatitis and allergic skin hypersensitivity |
| US12331088B2 (en) | 2017-01-12 | 2025-06-17 | Revolo Biotherapeutics Limited | Method for the treatment of a relapsing-remitting condition |
| US12358957B2 (en) | 2017-01-12 | 2025-07-15 | Revolo Biotherapeutics Limited | Method for the acute treatment of atopic dermatitis and allergic skin hypersensitivity |
| US12378291B2 (en) | 2017-01-12 | 2025-08-05 | Revolo Biotherapeutics Limited | Method for the treatment of allergic rhinitis |
| WO2024218571A1 (en) * | 2023-04-18 | 2024-10-24 | Revolo Biotherapeutics Limited | Methods and compositions for preventing or treating eosinophilic esophagitis |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3568148A1 (en) | 2019-11-20 |
| JP2023029902A (ja) | 2023-03-07 |
| EP3568148B1 (en) | 2023-11-01 |
| CN110381979A (zh) | 2019-10-25 |
| CA3049353C (en) | 2024-10-29 |
| JP7252895B2 (ja) | 2023-04-05 |
| JP2020504161A (ja) | 2020-02-06 |
| EP3568148C0 (en) | 2023-11-01 |
| AU2018208077B2 (en) | 2021-11-11 |
| ES2970436T3 (es) | 2024-05-28 |
| US11098090B2 (en) | 2021-08-24 |
| AU2018208077A1 (en) | 2019-07-25 |
| CA3049353A1 (en) | 2018-07-19 |
| GB201700557D0 (en) | 2017-03-01 |
| US20200071365A1 (en) | 2020-03-05 |
| JP2025032107A (ja) | 2025-03-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA3049353C (en) | Mycobacteria tuberculosis chaperonin 60.1 peptides and uses thereof | |
| US11834478B2 (en) | Method for the treatment of a relapsing-remitting condition | |
| JP6199296B2 (ja) | 新規ペプチド | |
| US20260085098A1 (en) | Method for the treatment of an acute respiratory distress syndrome | |
| US12358957B2 (en) | Method for the acute treatment of atopic dermatitis and allergic skin hypersensitivity | |
| JPH10259198A (ja) | 連結したt細胞エピトープとその用途 | |
| CA3049355C (en) | Method for the treatment of a relapsing-remitting condition |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18701789 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3049353 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019538337 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018208077 Country of ref document: AU Date of ref document: 20180111 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018701789 Country of ref document: EP Effective date: 20190812 |