WO2018129331A1 - Dosing regimens and dosage forms for targeted tgf-b inhibition - Google Patents

Dosing regimens and dosage forms for targeted tgf-b inhibition Download PDF

Info

Publication number
WO2018129331A1
WO2018129331A1 PCT/US2018/012604 US2018012604W WO2018129331A1 WO 2018129331 A1 WO2018129331 A1 WO 2018129331A1 US 2018012604 W US2018012604 W US 2018012604W WO 2018129331 A1 WO2018129331 A1 WO 2018129331A1
Authority
WO
WIPO (PCT)
Prior art keywords
cancer
polypeptide
formulation
seq
drug delivery
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/012604
Other languages
English (en)
French (fr)
Inventor
Isabelle Dussault
Samer El Bawab
Yulia Vugmeyster
Akash Khandelwal
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Merck Patent GmbH
Original Assignee
Merck Patent GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to BR112019013924-9A priority Critical patent/BR112019013924A2/pt
Priority to EP18736497.1A priority patent/EP3565599A4/en
Priority to RU2019124875A priority patent/RU2019124875A/ru
Priority to CN201880006085.0A priority patent/CN110198738A/zh
Priority to MX2019008001A priority patent/MX2019008001A/es
Priority to CA3048646A priority patent/CA3048646A1/en
Priority to SG11201906157YA priority patent/SG11201906157YA/en
Priority to AU2018205233A priority patent/AU2018205233A1/en
Priority to KR1020197022795A priority patent/KR20190102059A/ko
Priority to JP2019536228A priority patent/JP2020514290A/ja
Application filed by Merck Patent GmbH filed Critical Merck Patent GmbH
Publication of WO2018129331A1 publication Critical patent/WO2018129331A1/en
Priority to US16/460,792 priority patent/US20190330375A1/en
Priority to PH12019501574A priority patent/PH12019501574A1/en
Priority to IL267856A priority patent/IL267856A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61JCONTAINERS SPECIALLY ADAPTED FOR MEDICAL OR PHARMACEUTICAL PURPOSES; DEVICES OR METHODS SPECIALLY ADAPTED FOR BRINGING PHARMACEUTICAL PRODUCTS INTO PARTICULAR PHYSICAL OR ADMINISTERING FORMS; DEVICES FOR ADMINISTERING FOOD OR MEDICINES ORALLY; BABY COMFORTERS; DEVICES FOR RECEIVING SPITTLE
    • A61J1/00Containers specially adapted for medical or pharmaceutical purposes
    • A61J1/05Containers specially adapted for medical or pharmaceutical purposes for collecting, storing or administering blood, plasma or medical fluids ; Infusion or perfusion containers
    • A61J1/10Bag-type containers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence

Definitions

  • Effector T cells chronically sensing antigen take on an exhausted phenotype marked by PD-1 expression, a state under which tumor cells engage by upregulating PD-L1. Additionally, in the tumor microenvironment, myeloid cells, macrophages, parenchymal cells and T cells upregulate PD-L1. Blocking the axis restores the effector function in these T cells.
  • PD-1 anti-programmed death ligand 1
  • TGF ⁇ RII tumor growth factor beta receptor type II
  • the protein is a heterotetramer, consisting of the two immunoglobulin light chains of anti-PD- L1, and two heavy chains comprising the heavy chain of anti-PD-L1 genetically fused via a flexible glycine-serine linker to the extracellular domain of the human TGF ⁇ RII (see Fig.1).
  • This anti-PD-L1/TGF ⁇ Trap molecule is designed to target two major mechanisms of immunosuppression in the tumor microenvironment.
  • US patent application publication number US 20150225483 A1 describes administration of the Trap molecule at doses based on the patient’s weight.
  • the present disclosure provides improved dosing regimens for administration of bifunctional proteins targeting PD-L1 and TGF ⁇ .
  • body weight independent (BW- independent) dosing regimens and related dosage forms involving administration of at least 500 mg of the bifunctional protein administered at various dosing frequencies can be used as an anti-tumor and anti-cancer therapeutic.
  • the BW-independent dosing regimen ensures that all patients, irrespective of their body weight, will have adequate drug exposure at the tumor site.
  • the bifunctional protein of the present disclosure includes a first and a second polypeptide.
  • the first polypeptide includes: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor ⁇ Receptor II (TGF ⁇ RII), or a fragment thereof, capable of binding Transforming Growth Factor ⁇ (TGF ⁇ ) (e.g., a soluble fragment).
  • the second polypeptide includes at least a variable region of a light chain of an antibody that binds PD-L1, in which the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1 (e.g., any of the antibodies or antibody fragments described herein).
  • the bifunctional protein of the present disclosure binds to two targets, (1) PD-L1, which is largely membrane bound, and (2) TGF ⁇ , which is soluble in blood and interstitium, the BW-independent dosing regimen requires a dose that is effective not only to inhibit PD-L1 at the tumor site but also sufficient to inhibit TGF ⁇ .
  • the disclosure provides treatment of a cancer or inhibition of a tumor, e.g. ⁇ non-small cell lung cancer, melanoma, pancreatic cancer, colorectal cancer (e.g., pretreated colorectal cancer (CRC)), ovarian cancer, glioblastoma, gastric cancer (e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer), biliary tract cancer, esophageal cancer (squamous cell carcinoma or adenocarcinoma), adenoma of the head or the neck, and squamous carcinoma of the head or the neck.
  • a tumor e.g. ⁇ non-small cell lung cancer, melanoma, pancreatic cancer, colorectal cancer (e.g., pretreated colorectal cancer (CRC)), ovarian cancer, glioblastoma, gastric cancer (e.g., pretreated recurrent or refractory unresectable Stage IV gas
  • the disclosure also features a bifunctional protein described above for use in treating cancer or for use in inhibiting tumor growth.
  • the cancer or tumor may be selected from colorectal (e.g., pretreated colorectal cancer (CRC)), breast, ovarian, pancreatic, gastric (e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer), prostate, renal, cervical, myeloma, lymphoma, leukemia, thyroid, endometrial, uterine, bladder, neuroendocrine, head and neck, liver, nasopharyngeal, testicular, small cell lung cancer, non-small cell lung cancer, melanoma, basal cell skin cancer, squamous cell skin cancer, dermatofibrosarcoma
  • CRC colorectal cancer
  • breast ovarian
  • pancreatic gastric
  • gastric e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer
  • prostate renal, cervical,
  • the disclosure also features a method of promoting local depletion of TGF ⁇ .
  • the method includes administering a protein described above, where the protein binds TGF ⁇ in solution, binds PD-L1 on a cell surface, and carries the bound TGF ⁇ into the cell (e.g., a cancer cell).
  • the disclosure also features a method of inhibiting SMAD3 phosphorylation in a cell (e.g., a cancer cell or an immune cell), the method including exposing the cell in the tumor microenvironment to a protein described above.
  • a cell e.g., a cancer cell or an immune cell
  • the disclosure also features a method of inhibiting tumor growth or treating cancer.
  • the method includes exposing the tumor to a protein described above.
  • the method may further include exposing the tumor to radiation or to a chemotherapeutic, a biologic, or a vaccine.
  • the tumor or cancer is selected from colorectal (e.g., pretreated colorectal cancer (CRC)), breast, ovarian, pancreatic, gastric (e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer), prostate, renal, cervical, myeloma, lymphoma, leukemia, thyroid, endometrial, uterine, bladder, neuroendocrine, head and neck, liver, nasopharyngeal, testicular, small cell lung cancer, non-small cell lung cancer, melanoma, basal cell skin cancer, squamous cell skin cancer, dermatofibrosarcoma protuberans, Merkel cell carcinoma, glioblastoma, glioma, sarcoma, mesothelioma, and myelodysplastic syndromes.
  • CRC colorectal cancer
  • gastric e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer
  • TGF ⁇ RII or“TGF ⁇ Receptor II” is meant a polypeptide having the wild-type human TGF ⁇ Receptor Type 2 Isoform A sequence (e.g., the amino acid sequence of NCBI Reference Sequence (RefSeq) Accession No. NP_001020018 (SEQ ID NO.8)), or a polypeptide having the wild-type human TGF ⁇ Receptor Type 2 Isoform B sequence (e.g., the amino acid sequence of NCBI RefSeq Accession No. NP_003233 (SEQ ID NO.9)) or having a sequence substantially identical the amino acid sequence of SEQ ID NO.8 or of SEQ ID NO. 9.
  • the TGF ⁇ RII may retain at least 0.1%, 0.5%, 1%, 5%, 10%, 25%, 35%, 50%, 75%, 90%, 95%, or 99% of the TGF ⁇ -binding activity of the wild-type sequence.
  • the polypeptide of expressed TGF ⁇ RII lacks the signal sequence.
  • a“fragment of TGF ⁇ RII capable of binding TGF ⁇ ” is meant any portion of NCBI RefSeq Accession No. NP_001020018 (SEQ ID NO.8) or of NCBI RefSeq Accession No.
  • NP_003233 (SEQ ID NO.9), or a sequence substantially identical to SEQ ID NO.8 or SEQ ID NO.9 that is at least 20 (e.g., at least 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 175, or 200) amino acids in length that retains at least some of the TGF ⁇ -binding activity (e.g., at least 0.1%, 0.5%, 1%, 5%, 10%, 25%, 35%, 50%, 75%, 90%, 95%, or 99%) of the wild-type receptor or of the corresponding wild-type fragment. Typically such fragment is a soluble fragment.
  • an exemplary such fragment is a TGF ⁇ RII extra-cellular domain having the sequence of SEQ ID NO: 10.
  • substantially identical is meant a polypeptide exhibiting at least 50%, desirably 60%, 70%, 75%, or 80%, more desirably 85%, 90%, or 95%, and most desirably 99% amino acid sequence identity to a reference amino acid sequence.
  • the length of comparison sequences will generally be at least 10 amino acids, desirably at least 15 contiguous amino acids, more desirably at least 20, 25, 50, 75, 90, 100, 150, 200, 250, 300, or 350 contiguous amino acids, and most desirably the full-length amino acid sequence.
  • patient is meant either a human or non-human animal (e.g., a mammal).
  • Patient “Patient,”“subject,”“patient in need thereof,” and“subject in need thereof” are used interchangeably in this disclosure, and refer to a living organism suffering from or prone to a disease or condition that can be treated by administration using the methods and compositions provided in this disclosure.
  • the terms“treat,”“treating,” or“treatment,” and other grammatical equivalents as used in this disclosure, include alleviating, abating, ameliorating, or preventing a disease, condition or symptoms, preventing additional symptoms, ameliorating or preventing the underlying metabolic causes of symptoms, inhibiting the disease or condition, e.g., arresting the development of the disease or condition, relieving the disease or condition, causing regression of the disease or condition, relieving a condition caused by the disease or condition, or stopping the symptoms of the disease or condition, and are intended to include prophylaxis.
  • the terms further include achieving a therapeutic benefit and/or a prophylactic benefit.
  • therapeutic benefit is meant eradication or amelioration of the underlying disorder being treated.
  • cancer refers to all types of cancer, neoplasm, malignant or benign tumors found in mammals, including leukemia, carcinomas, and sarcomas.
  • exemplary cancers include breast cancer, ovarian cancer, colon cancer, liver cancer, kidney cancer, lung cancer, pancreatic cancer, glioblastoma.
  • Additional examples include cancer of the brain, lung cancer, non-small cell lung cancer, melanoma, sarcomas, prostate cancer, cervix cancer, stomach cancer, head and neck cancers, uterus cancer, mesothelioma, metastatic bone cancer, medulloblastoma, Hodgkin’s Disease, Non-Hodgkin’s Lymphoma, multiple myeloma, neuroblastoma, rhabdomyosarcoma, primary thrombocytosis, primary macrobulinemia, urinary bladder cancer, premalignant skin lesions, testicular cancer, lymphomas, thyroid cancer, neuroblastoma, esophageal cancer, genitourinary tract cancer, malignant hypercalcemia, endometrial cancer, adrenal cortical cancer, and neoplasms of the endocrine and exocrine pancreas.
  • the word“comprise” and other forms of the word, such as“comprising” and“comprises,” means including but not limited to, and is not intended to exclude, for example, other components.
  • “co-administer” it is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of additional therapies.
  • the protein and the composition of the present disclosure can be administered alone or can be co- administered with a second, third, or fourth therapeutic agent(s) to a patient.
  • Co-administration is meant to include simultaneous or sequential administration of the protein or composition individually or in combination (more than one therapeutic agent).
  • the term“a” is not meant to limit as a singular.
  • A“reconstituted” formulation is one which has been prepared by dissolving a lyophilized formulation in an aqueous carrier such that the bifunctional molecule is dissolved in the reconstituted formulation.
  • the reconstituted formulation is suitable for intravenous administration (IV) to a patient in need thereof.
  • the term“about” refers to any minimal alteration in the concentration or amount of an agent that does not change the efficacy of the agent in preparation of a formulation and in treatment of a disease or disorder.
  • the term“about” may include ⁇ 15% of a specified numerical value or data point.
  • Ranges can be expressed in this disclosure as from“about” one particular value, and/or to“about” another particular value. When such a range is expressed, another aspect includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent“about,” it is understood that the particular value forms another aspect.
  • each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint. It is also understood that there are a number of values disclosed in this disclosure, and that each value is also disclosed as“about” that particular value in addition to the value itself. It is also understood that throughout the application, data are provided in a number of different formats and that this data represent endpoints and starting points and ranges for any combination of the data points. For example, if a particular data point“10” and a particular data point“15” are disclosed, it is understood that greater than, greater than or equal to, less than, less than or equal to, and equal to 10 and 15 are considered disclosed as well as between 10 and 15. It is also understood that each unit between two particular units are also disclosed.
  • An“isotonic” formulation is one which has essentially the same osmotic pressure as human blood. Isotonic formulations will generally have an osmotic pressure from about 250 to 350 mOsmol/KgH 2 O. The term "hypertonic" is used to describe a formulation with an osmotic pressure above that of human blood. Isotonicity can be measured using a vapor pressure or ice- freezing type osmometer, for example.
  • the term“buffering agent” refers to one or more components that when added to an aqueous solution is able to protect the solution against variations in pH when adding acid or alkali, or upon dilution with a solvent.
  • phosphate buffers there can be used glycinate, carbonate, citrate buffers and the like, in which case, sodium, potassium or ammonium ions can serve as counterion.
  • An“acid” is a substance that yields hydrogen ions in aqueous solution.
  • a “pharmaceutically acceptable acid” includes inorganic and organic acids which are nontoxic at the concentration and manner in which they are formulated.
  • A“base” is a substance that yields hydroxyl ions in aqueous solution.
  • “Pharmaceutically acceptable bases” include inorganic and organic bases which are non-toxic at the concentration and manner in which they are formulated.
  • A“lyoprotectant” is a molecule which, when combined with a protein of interest, prevents or reduces chemical and/or physical instability of the protein upon lyophilization and subsequent storage.
  • A“preservative” is an agent that reduces bacterial action and may be optionally added to the formulations herein. The addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • preservatives examples include octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride (a mixture of alkylbenzyldimethylammonium chlorides in which the alkyl groups are long-chain compounds), and benzethonium chloride.
  • Other types of preservatives include aromatic alcohols such as phenol, butyl and benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3pentanol, and m-cresol.
  • A“surfactant” is a surface active molecule containing both a hydrophobic portion (e.g., alkyl chain) and a hydrophilic portion (e.g., carboxyl and carboxylate groups). Surfactant may be added to the formulations of the invention.
  • Surfactants suitable for use in the formulations of the present invention include, but are not limited to, polysorbates (e.g.
  • FIG.1 is a schematic drawing of an anti-PD-L1/TGF ⁇ Trap molecule including one anti-PD-L1 antibody fused to two extracellular domain (ECD) of TGF ⁇ Receptor II via a (Gly 4 Ser) 4 Gly (SEQ ID NO: 11) linker.
  • FIG.2 shows a graph of a two-step ELISA demonstrating that anti-PD-L1/TGF ⁇ Trap simultaneously binds to both PD-L1 and TGF ⁇ .
  • FIG.3 is a graph showing anti-PD-L1/TGF ⁇ Trap induces a dramatic increase in IL- 2 levels.
  • FIG.4A is a graph showing in vivo depletion of TGF ⁇ 1 in response to the anti-PD- L1/TGF ⁇ Trap. Line graphs represent na ⁇ ve, isotype control, and three different doses, as indicated in the legend.
  • FIG.4B is a graph showing in vivo depletion of TGF ⁇ 2 in response to the anti-PD-L1/TGF ⁇ Trap. Line graphs represent na ⁇ ve, isotype control, and three different doses, as indicated in the legend.
  • FIG.4C is a graph showing in vivo depletion of TGF ⁇ 3 in response to the anti-PD-L1/TGF ⁇ Trap. Line graphs represent na ⁇ ve, isotype control, and three different doses, as indicated in the legend.
  • FIG.4D is a graph showing that occupancy of PD- L1 by the anti-PD-L1/TGF ⁇ Trap supports a receptor binding model in the EMT-6 tumor system.
  • FIG.5 is a graph showing anti-tumor efficacy of anti-PD-L1/TGF ⁇ Trap control (anti-PD-L1(mut)/TGF ⁇ ) in Detroit 562 xenograft model.
  • FIG.6A is a scatter-plot showing relationship between clearance and body weight.
  • FIG. 7A is a box-plot of C avg distribution for an entire population for a fixed (1200 mg) versus mg/kg based dosing (17.65 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.7B is a box-plot of exposure AUC distribution for an entire population for a fixed (1200 mg) versus mg/kg based dosing (17.65 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.7C is a box-plot of C trough distribution for an entire population for a fixed (1200 mg) versus mg/kg based dosing (17.65 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.7D is a box-plot of C max distribution for an entire population for a fixed (1200 mg) versus mg/kg based dosing (17.65 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.7E is a box-plot of C avg distribution for an entire population for a fixed (500 mg) versus mg/kg based dosing (7.35 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.7F is a box-plot of exposure AUC distribution for an entire population for a fixed (500 mg) versus mg/kg based dosing (7.35 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.7G is a box-plot of C trough distribution for an entire population for a fixed (500 mg) versus mg/kg based dosing (7.35 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.7H is a box-plot of C max distribution for an entire population for a fixed (500 mg) versus mg/kg based dosing (7.35 mg/kg) in a simulated population of 68 kg median body weight.
  • FIG.8A is a box-plot of C avg distribution across body weight quartiles for a fixed (1200 mg) versus mg/kg (17.65 mg/kg) based dosing in a simulated population of 68 kg median body weight.
  • FIG.8B is a box-plot of exposure (AUC) distribution across body weight quartiles for a fixed (1200 mg) versus mg/kg (17.65 mg/kg) based dosing in a simulated population of 68 kg median body weight.
  • AUC exposure
  • FIG.8C is a box-plot of C trough distribution across body weight quartiles for a fixed (1200 mg) versus mg/kg (17.65 mg/kg) based dosing in a simulated population of 68 kg median body weight.
  • FIG.8D is a box-plot of C max distribution across body weight quartiles for a fixed (1200 mg) versus mg/kg (17.65 mg/kg) based dosing in a simulated population of 68 kg median body weight.
  • FIG.8E is a box-plot of C avg distribution across body weight quartiles for a fixed (500 mg) versus mg/kg (7.35 mg/kg) based dosing in a simulated population of 68 kg median body weight.
  • FIG.8F is a box-plot of exposure (AUC) distribution across body weight quartiles for a fixed (500 mg) versus mg/kg (7.35 mg/kg) based dosing in a simulated population of 68 kg median body weight.
  • FIG.8G is a box-plot of C trough distribution across body weight quartiles for a fixed (500 mg) versus mg/kg (7.35 mg/kg) based dosing in a simulated population of 68 kg median body weight.
  • FIG.8H is a box-plot of C max distribution across body weight quartiles for a fixed (500 mg) versus mg/kg (7.35 mg/kg) based dosing in a simulated population of 68 kg median body weight.
  • FIG.9A is a goodness of fit scatter plot for the PK-Efficacy model showing the predicted tumor volume vs. the observed tumor volume.
  • FIG.9B is a goodness of fit scatter plot for the PK-Efficacy model showing the conditional weighted residuals (GWRES) vs. the time after dose.
  • FIGs.10A–10C are graphs showing the predicted PK and PD-L1 receptor occupancy (“RO”) of anti-PD-L1/TGF ⁇ Trap molecules at doses and schedules associated with tumor regression in mice.
  • FIG.10A is a graph showing the predicted plasma concentration vs. time.
  • FIG.10B is a graph showing the predicted PD-L1 RO vs. time in PBMC.
  • FIG.10C is a graph showing the predicted PD-L1 RO vs. time in tumor.
  • FIGs.11A–11C are graphs showing the predicted PK and PD-L1 receptor occupancy (“RO”) of ant-PD-L1/TGF ⁇ Trap molecules at doses and schedules associated with tumor stasis in mice.
  • FIG.11A is a graph showing the predicted plasma concentration vs. time.
  • FIG.11B is a graph showing the predicted PD-L1 RO vs. time in PBMC.
  • FIG.11C is a graph showing the predicted PD-L1 RO vs. time in tumor.
  • FIGs.12A-12B are box-plots of simulated exposure distribution (FIG.12A: C average , FIG.12B: C trough ) for entire population for various dosing regimens in a simulated population of 68 kg median body weight.
  • FIG.13 is a spider plot that demonstrates that patients with previously progressive disease (both with primary refractory and acquired resistant disease) achieved significant disease stabilization.
  • FIG.14 shows a histogram of efficacy of an anti-PD-L1/TGF ⁇ Trap molecule in patients treated with anti-PD-1/PD-L1 treatment.
  • PK/Efficacy Model (Mouse Model) [0049] Experiments were also conducted to determine the efficacy of the anti-PD-L1/TGF ⁇ Trap molecule in a tumor model. Efficacy results from EMT-6 xenografts were used to establish the PK/Efficacy model. The established PK model in mice was used to simulate anti- PD-L1/TGF ⁇ Trap plasma exposure for the efficacy experiment settings. The estimated parameters are reported in Table 1. The estimated KC50 value was 55.3 ⁇ g/mL. This value represents the average plasma concentrations for which 50% if the maximal anti-tumor activity of the anti-PD-L1/TGF ⁇ Trap molecule could be achieved.
  • FIGs.11A-11C which summarize the PK/RO/Efficacy for the anti-PD-L1/TGF ⁇ Trap molecule in mice. 95% of PD- L1 RO is achieved at a plasma concentration of 40 ⁇ g/mL with an expected/estimate TGI of only about 65%. Increasing the concentration above 40 ⁇ g/mL results in an additional increase in tumor growth inhibition.
  • a flat dose of at least 500 mg administered once every two weeks is required to maintain an average concentration of about 100 ⁇ g/mL, while a flat dose of about 1200 mg administered once every two weeks is required to maintain a C trough of about 100 ⁇ g/mL.
  • about 1200 mg to about 3000 mg e.g., about 1200, about 1300, about 1400, about 1500, about 1600, about 1700, about 1800, about 1900, about 2000, about 2100, about 2200, about 2300, about 2400, etc.
  • a protein product of the present disclosure e.g., anti-PD-L1/TGF ⁇ Trap
  • about 1200 mg of anti-PD-L1/TGF ⁇ Trap molecule is administered to a subject once every two weeks.
  • about 1800 mg of anti-PD-L1/TGF ⁇ Trap molecule is administered to a subject once every three weeks.
  • about 1200 mg to about 3000 mg e.g., about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, about 1600 mg, about 1700 mg, about 1800 mg, about 1900 mg, about 2000 mg, about 2100 mg, about 2200 mg, about 2300 mg, about 2400 mg, etc.
  • a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3 is administered to the subject.
  • about 1200 mg of the protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and the second polypeptide that includes the amino acid sequence of SEQ ID NO: 1 is administered to a subject once every two weeks.
  • about 1800 mg of the protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and the second polypeptide that includes the amino acid sequence of SEQ ID NO: 1 is administered to a subject once every three weeks.
  • PK Pharmacokinetic
  • Serum samples for pharmacokinetic (PK) data analysis were collected before the start of the first dose and at the following time points after the first dose: on Day 1 immediately after the infusion and 4 hours after the start of the infusion; on Day 2 at least 24 hours after the Day 1 end of infusion; and on Days 8 and 15.
  • pre-dose end-of-infusion and 2 to 8 hours after the end of infusion samples were collected on days 15, 29, 43.
  • pre-dose samples were or were to be collected followed by once every 6 weeks PK sampling until 12 weeks, then once every 12 weeks PK sampling. In the expansion phase sparse PK sampling was conducted.
  • a new, body weight-independent dosing regimen for the administration of anti-PD-L1/TGF ⁇ Trap molecules has been created to achieve less variability in exposure, reduce dosing errors, reduce the time necessary for dose preparation, and reduce drug wastage compared to the mg/kg dosing, thus facilitating favorable treatment outcomes.
  • a flat dose of at least 500 mg can be administered, regardless of the patient’s body weight.
  • a flat dose of at least 1200 mg can be administered, regardless of the patient’s body weight.
  • such a dose would be administered repeatedly, such as once every two weeks or once every 3 weeks, for example.
  • Body weight was a relevant covariate on both CL and V1.
  • the impact of the dosing strategy on the exposure variability of the protein of the present disclosure was explored. Specifically, simulations were performed to compare the exposure distribution using a flat dosing approach of 1200 mg once every two weeks versus a BW-adjusted dosing approach of either 17.65 mg/kg once every two weeks (corresponding to 1200 mg once every two weeks for a 68 kg subject or 15 mg/kg once every two weeks (corresponding to 1200 mg for a 80 kg subject).
  • ORR overall response rate
  • a flat dose of at least 500 mg administered once every two weeks is required to maintain an average concentration of about 100 ⁇ g/mL for a typical subject, while a flat dose of about 1200 mg administered once every two weeks is required to maintain a C trough of about 100 ⁇ g/mL.
  • a flat dose of about 1200 mg once every two weeks is required to maintain a C trough of about 100 ⁇ g/mL.
  • C avg 1200 mg once every two weeks is equivalent to 1800 mg once every three weeks (Fig.12A), while for C trough , 1200 mg once every two weeks is equivalent to 2800 mg once every three weeks (Fig.12B).
  • TGF ⁇ as a Cancer Target [0073] The current disclosure permits localized reduction in TGF ⁇ in a tumor
  • TGF ⁇ RII soluble cytokine receptor
  • An example of an antibody moiety of the disclosure to an immune checkpoint protein is anti-PD-L1.
  • This bifunctional molecule sometimes referred to in this document as an“antibody-cytokine Trap,” is effective precisely because the anti-receptor antibody and cytokine Trap are physically linked.
  • the resulting advantage (over, for example, administration of the antibody and the receptor as separate molecules) is partly because cytokines function predominantly in the local environment through autocrine and paracrine functions.
  • the antibody moiety directs the cytokine Trap to the tumor microenvironment where it can be most effective, by neutralizing the local
  • This depletion is achieved by (1) anti-PD-L1 targeting of tumor cells; (2) binding of the TGF ⁇ autocrine/paracrine in the tumor microenvironment by the TGF ⁇ Trap; and (3) destruction of the bound TGF ⁇ through the PD-L1 receptor-mediated endocytosis.
  • TGF ⁇ RII fused to the C-terminus of Fc fragment of crystallization of IgG was several-fold more potent than the TGF ⁇ RII-Fc that places the TGF ⁇ RII at the N-terminus of Fc.
  • TGF ⁇ activity is developmental stage and context dependent. Indeed TGF ⁇ can act as either a tumor promoter or a tumor suppressor, affecting tumor initiation, progression and metastasis.
  • the mechanisms underlying this dual role of TGF ⁇ remain unclear (Yang et al., Trends Immunol.2010; 31:220–227).
  • Smad-dependent signaling mediates the growth inhibition of TGF ⁇ signaling, while the Smad independent pathways contribute to its tumor-promoting effect, there are also data showing that the Smad-dependent pathways are involved in tumor progression (Yang et al., Cancer Res.2008; 68:9107-11).
  • TGF ⁇ RI is the signaling chain and cannot bind ligand.
  • TGF ⁇ RII binds the ligand TGF ⁇ 1 and 3, but not TGF ⁇ 2, with high affinity.
  • TGF ⁇ RII/TGF ⁇ complex recruits TGF ⁇ RI to form the signaling complex (Won et al., Cancer Res.1999; 59:1273-7).
  • TGF ⁇ RIII is a positive regulator of TGF ⁇ binding to its signaling receptors and binds all 3 TGF ⁇ isoforms with high affinity.
  • the TGF ⁇ /TGF ⁇ RIII complex binds TGF ⁇ RII and then recruits TGF ⁇ RI, which displaces
  • TGF ⁇ RIII to form the signaling complex.
  • the three different TGF ⁇ isoforms all signal through the same receptor, they are known to have differential expression patterns and non-overlapping functions in vivo.
  • the three different TGF- ⁇ isoform knockout mice have distinct phenotypes, indicating numerous non-compensated functions (Bujak et al., Cardiovasc Res.2007; 74:184-95).
  • TGF ⁇ 1 null mice While TGF ⁇ 1 null mice have hematopoiesis and vasculogenesis defects and TGF ⁇ 3 null mice display pulmonary development and defective palatogenesis, TGF ⁇ 2 null mice show various developmental abnormalities, the most prominent being multiple cardiac deformities (Bartram et al., Circulation.2001; 103:2745-52; Yamagishi et al., Anat Rec.2012; 295:257-67).
  • TGF ⁇ is implicated to play a major role in the repair of myocardial damage after ischemia and reperfusion injury.
  • cardiomyocytes secrete TGF ⁇ , which acts as an autocrine to maintain the spontaneous beating rate.
  • TGF ⁇ 2 70-85% of the TGF ⁇ secreted by cardiomyocytes is TGF ⁇ 2 (Roberts et al., J Clin Invest.1992; 90:2056-62).
  • TGF ⁇ RI kinase inhibitors present applicants have observed a lack of toxicity, including cardiotoxicity, for anti-PD-L1/TGF ⁇ Trap in monkeys.
  • TGF ⁇ receptors As soluble receptor traps and neutralizing antibodies.
  • soluble TGF ⁇ RIII may seem the obvious choice since it binds all the three TGF ⁇ ligands.
  • TGF ⁇ RIII which occurs naturally as a 280-330 kD glucosaminoglycan (GAG)-glycoprotein, with extracellular domain of 762 amino acid residues, is a very complex protein for biotherapeutic development.
  • the soluble TGF ⁇ RIII devoid of GAG could be produced in insect cells and shown to be a potent TGF ⁇ neutralizing agent (Vilchis-Landeros et al, Biochem J 355:215, 2001).
  • the two separate binding domains (the endoglin-related and the uromodulin-related) of TGF ⁇ RIII could be independently expressed, but they were shown to have affinities 20 to 100 times lower than that of the soluble TGF ⁇ RIII, and much diminished neutralizing activity (Mendoza et al., Biochemistry.2009; 48:11755-65).
  • the extracellular domain of TGF ⁇ RII is only 136 amino acid residues in length and can be produced as a glycosylated protein of 25-35 kD.
  • the recombinant soluble TGF ⁇ RII was further shown to bind TGF ⁇ 1 with a K D of 200 pM, which is fairly similar to the K D of 50 pM for the full length TGF ⁇ RII on cells (Lin et al., J Biol Chem.1995; 270:2747-54). Soluble TGF ⁇ RII-Fc was tested as an anti-cancer agent and was shown to inhibit established murine malignant mesothelioma growth in a tumor model (Suzuki et al., Clin.
  • TGF ⁇ RII does not bind TGF ⁇ 2
  • TGF ⁇ RIII binds TGF ⁇ 1 and 3 with lower affinity than TGF ⁇ RII
  • a fusion protein of the endoglin domain of TGF ⁇ RIII and extracellular domain of TGF ⁇ RII was produced in bacteria and was shown to inhibit the signaling of TGF ⁇ 1 and 2 in cell based assays more effectively than either TGF ⁇ RII or RIII (Verona et al., Protein Eng Des Sel.2008; 21:463-73).
  • Still another approach to neutralize all three isoforms of the TGF ⁇ ligands is to screen for a pan-neutralizing anti-TGF ⁇ antibody, or an anti-receptor antibody that blocks the receptor from binding to TGF ⁇ 1, 2 and 3.
  • GC1008 a human antibody specific for all isoforms of TGF ⁇ , was in a Phase I/II study in patients with advanced malignant melanoma or renal cell carcinoma (Morris et al., J Clin Oncol 2008; 26:9028 (Meeting abstract)).
  • Metelimumab an antibody specific for TGF ⁇ 1 was tested in Phase 2 clinical trial as a treatment to prevent excessive post-operative scarring for glaucoma surgery; and Lerdelimumab, an antibody specific for TGF ⁇ 2, was found to be safe but ineffective at improving scarring after eye surgery in a Phase 3 study (Khaw et al., Ophthalmology 2007; 114:1822–1830).
  • Anti-TGF ⁇ RII antibodies that block the receptor from binding to all the three TGF ⁇ isoforms have also shown some therapeutic efficacy against primary tumor growth and metastasis in mouse models (Zhong et al., Clin Cancer Res.2010; 16:1191-205).
  • TGF ⁇ RII antibody TR1 anti– human TGF ⁇ RII antibody TR1
  • anti-mouse TGF ⁇ RII antibody MT1 anti-mouse TGF ⁇ RII antibody MT1
  • the antibody-TGF ⁇ Trap of the disclosure is a bifunctional protein containing at least portion of a human TGF ⁇ Receptor II (TGF ⁇ RII) that is capable of binding TGF ⁇ .
  • the TGF ⁇ Trap polypeptide is a soluble portion of the human TGF ⁇ Receptor Type 2 Isoform A (SEQ ID NO: 8) that is capable of binding TGF ⁇ .
  • TGF ⁇ Trap polypeptide contains at least amino acids 73-184 of SEQ ID NO: 8.
  • the TGF ⁇ Trap polypeptide contains amino acids 24-184 of SEQ ID NO: 8.
  • the TGF ⁇ Trap polypeptide is a soluble portion of the human TGF ⁇ Receptor Type 2 Isoform B (SEQ ID NO: 9) that is capable of binding TGF ⁇ .
  • TGF ⁇ Trap polypeptide contains at least amino acids 48-159 of SEQ ID NO: 9.
  • the TGF ⁇ Trap polypeptide contains amino acids 24-159 of SEQ ID NO: 9.
  • the TGF ⁇ Trap polypeptide contains amino acids 24-105 of SEQ ID NO: 9.
  • T cell inhibition checkpoints for dis-inhibition with therapeutic antibodies is an area of intense investigation (for a review, see Pardoll, Nat Rev Cancer.2012; 12:253-264).
  • the antibody moiety or antigen binding fragment thereof targets T cell inhibition checkpoint receptor proteins on the T cell, such as, for example: CTLA-4, PD-1, BTLA, LAG-3, TIM-3, or LAIR1.
  • the antibody moiety targets the counter-receptors on antigen presenting cells and tumor cells (which co-opt some of these counter-receptors for their own immune evasion), such as for example: PD-L1 (B7-H1), B7-DC, HVEM, TIM-4, B7-H3, or B7-H4.
  • PD-L1 B7-H1
  • B7-DC B7-DC
  • HVEM HVEM
  • TIM-4 B7-H3
  • B7-H3 B7-H4
  • the disclosure contemplates antibody TGF ⁇ traps that target, through their antibody moiety or antigen binding fragment thereof, T cell inhibition checkpoints for dis-inhibition.
  • T cell inhibition checkpoint receptor proteins such as anti-PD-1, anti-PD-L1, anti-TIM-3 and anti-LAG3.
  • the programmed death 1 (PD-1)/PD-L1 axis is an important mechanism for tumor immune evasion. Effector T cells chronically sensing antigen take on an exhausted phenotype marked by PD-1 expression, a state under which tumor cells engage by upregulating PD-L1. Additionally, in the tumor microenvironment, myeloid cells, macrophages, parenchymal cells and T cells upregulate PD-L1. Blocking the axis restores the effector function in these T cells.
  • TGF ⁇ (1, 2, and 3 isoforms), which is an inhibitory cytokine produced in the tumor microenvironment by cells including apoptotic neutrophils, myeloid- derived suppressor cells, T cells and tumor.
  • TGF ⁇ RII reduced malignant mesothelioma in a manner that was associated with increases in CD8+ T cell anti- tumor effects.
  • the absence of TGF ⁇ 1 produced by activated CD4+ T cells and Treg cells has been shown to inhibit tumor growth, and protect mice from spontaneous cancer. Thus, TGF ⁇ appears to be important for tumor immune evasion.
  • TGF ⁇ has growth inhibitory effects on normal epithelial cells, functioning as a regulator of epithelial cell homeostasis, and it acts as a tumor suppressor during early carcinogenesis. As tumors progress toward malignancy, the growth inhibitory effects of TGF ⁇ on the tumor are lost via mutation in one or more TGF ⁇ pathway signaling components or through oncogenic reprogramming. Upon loss of sensitivity to TGF ⁇ inhibition, the tumor continues to produce high levels of TGF ⁇ , which then serve to promote tumor growth. The TGF ⁇ cytokine is overexpressed in various cancer types with correlation to tumor stage.
  • TGF ⁇ signaling contributes to tumor progression by promoting metastasis, stimulating angiogenesis, and suppressing innate and adaptive anti-tumor immunity.
  • TGF ⁇ directly down-regulates the effector function of activated cytotoxic T cells and NK cells and potently induces the differentiation of na ⁇ ve CD4+ T cells to the immunosuppressive regulatory T cells (Treg) phenotype.
  • TGF ⁇ polarizes macrophages and neutrophils to a wound-healing phenotype that is associated with production of immunosuppressive cytokines.
  • neutralization of TGF ⁇ activity has the potential to control tumor growth by restoring effective anti-tumor immunity, blocking metastasis, and inhibiting angiogenesis.
  • PD-1 or PD-L1, and TGF ⁇ is attractive as an antitumor approach.
  • Concomitant PD-1 and TGF ⁇ blockade can restore pro-inflammatory cytokines.
  • Anti-PD-L1/TGF ⁇ Trap includes, for example, an extracellular domain of the human TGF ⁇ receptor TGF ⁇ RII covalently joined via a glycine/serine linker to the C terminus of each heavy chain of the fully human IgG1 anti-PD-L1 antibody.
  • TGF-targeting agent fresolimumab, which is a monoclonal antibody targeting TGF ⁇ 1, 2 and 3, showed initial evidence of tumor response in a Phase I trial in subjects with melanoma.
  • the present disclosure provides experiments, which demonstrated that the TGF ⁇ RII portion of anti-PD-L1/TGF ⁇ Trap (the Trap control“anti-PDL- 1(mut)/ TGF ⁇ Trap”) elicited antitumor activity.
  • the Trap control“anti-PDL- 1(mut)/ TGF ⁇ Trap” elicited antitumor activity.
  • anti-PDL-1(mut)/ TGF ⁇ Trap elicited a dose-dependent reduction in tumor volume when administered at 25 ⁇ g, 76 ⁇ g, or 228 ⁇ g (FIG.5).
  • the present disclosure provides experiments, which demonstrated that the protein of the present disclosure simultaneously bound to both PD-L1 and TGF ⁇ (FIG.2).
  • the present disclosure provides experiments, which demonstrated that the protein of the present disclosure (e.g. anti-PD-L1/TGF ⁇ Trap) inhibited PD-L1 and TGF ⁇ dependent signaling in vitro.
  • the present disclosure provides experiments, which demonstrated that the protein of the present disclosure enhanced T cell effector function in vitro via blockade of PD-L1-mediated immune inhibition as measured by an IL-2 induction assay following superantigen stimulation (FIG.3). At approximately 100 ng/ml, the protein of the present disclosure induced a dramatic increase in IL-2 levels in vitro (FIG.3).
  • the present disclosure provides experiments, which demonstrated that the protein of the present disclosure (e.g.
  • the present disclosure provides experiments, which demonstrated that the protein of the present disclosure occupied the PD-L1 target, supporting the notion that that the protein of the present disclosure fit to a receptor binding model in the EMT-6 tumor system (FIG.4D). [0090] In certain embodiments, the present disclosure provides experiments, which demonstrated that the protein of the present disclosure efficiently, specifically, and
  • PD-L1 target occupancy was measured in CD3+ PBMCs by flow cytometry from patient blood collected at pre-dose, Day 2 (D2), D15, and D43. Further, the blood levels of TGF ⁇ ⁇ ⁇ ⁇ ⁇ ⁇ and pro- inflammatory cytokines were measured at these time points with an additional time point at D8 using analytically validated Luminex bead- and ECLIA-based multiplex immunoassays.
  • patients can be treated with anti-PD-L1/TGF ⁇ Trap molecule intravenously
  • PK analyses of patients treated at 6 dose levels may be performed from samples for up to after the 6 th dose.
  • PD-L1 target occupancy may also be measured in CD3+ PBMCs by flow cytometry from patient blood collected at pre-dose, Day 2 (D2), D15, D43, and up to D85.
  • the blood levels of TGF ⁇ ⁇ ⁇ ⁇ ⁇ ⁇ and pro-inflammatory cytokines may be measured at these time points with an additional time point, e.g., at D8, using analytically validated Luminex bead- and ECLIA-based multiplex immunoassays.
  • Anti-PD-L1 Antibodies [0094] The disclosure can include any anti-PD-L1 antibody, or antigen-binding fragment thereof, described in the art. Anti-PD-L1 antibodies are commercially available, for example, the 29E2A3 antibody (Biolegend, Cat. No.329701). Antibodies can be monoclonal, chimeric, humanized, or human.
  • Antibody fragments include Fab, F(ab’)2, scFv and Fv fragments, which are described in further detail below.
  • Exemplary antibodies are described in PCT Publication WO 2013/079174. These antibodies can include a heavy chain variable region polypeptide including an HVR-H1, HVR- H2, and HVR-H3 sequence, where: (a) the HVR-H1 sequence is X 1 YX 2 MX 3 (SEQ ID NO: 21); (b) the HVR-H2 sequence is SIYPSGGX 4 TFYADX 5 VKG (SEQ ID NO: 22); (c) the HVR-H3 sequence is IKLGTVTTVX 6 Y (SEQ ID NO: 23); further where: X 1 is K, R, T, Q, G, A, W, M, I, or S; X 2 is V, R, K, L, M, or I; X 3 is H, T, N, Q, A, V, Y, W, F, or M; X
  • X 1 is M, I, or S; X 2 is R, K, L, M, or I; X 3 is F or M; X 4 is F or I; X 5 is S or T; X 6 is E or D.
  • X 1 is M, I, or S; X 2 is L, M, or I; X 3 is F or M; X 4 is I; X 5 is S or T; X 6 is D.
  • the polypeptide further includes variable region heavy chain framework sequences juxtaposed between the HVRs according to the formula: (HC-FR1)- (HVR-H1)-(HC-FR2)-(HVR-H2)-(HC-FR3)-(HVR-H3)-(HC-FR4).
  • the framework sequences are derived from human consensus framework sequences or human germline framework sequences.
  • HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 24);
  • HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO: 25);
  • HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO: 26);
  • HC-FR4 is WGQGTLVTVSS (SEQ ID NO: 27).
  • the heavy chain polypeptide is further combined with a variable region light chain including an HVR-L1, HVR-L2, and HVR-L3, where: (a) the HVR-L1 sequence is TGTX 7 X 8 DVGX 9 YNYVS (SEQ ID NO: 28); (b) the HVR-L2 sequence is X 10 VX 11 X 12 RPS (SEQ ID NO: 29); (c) the HVR-L3 sequence is SSX 13 TX 14 X 15 X 16 X 17 RV (SEQ ID NO: 30); further where: X 7 is N or S; X 8 is T, R, or S; X 9 is A or G; X 10 is E or D; X 11 is I, N or S; X 12 is D, H or N; X 13 is F or Y; X 14 is N or S; X 15 is R, T or S; X 16 is G or S; X 17 is I or T.
  • the light chain further includes variable region light chain framework sequences juxtaposed between the HVRs according to the formula: (LC- FR1MHVR-L1)-(LC-FR2)-(HVR-L2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
  • the light chain framework sequences are derived from human consensus framework sequences or human germline framework sequences.
  • the light chain framework sequences are lambda light chain sequences.
  • LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO: 31); LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 32); LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO: 33); LC-FR4 is FGTGTKVTVL (SEQ ID NO: 34).
  • the disclosure provides an anti-PD-L1 antibody or antigen binding fragment including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain includes an HVR-H1, HVR-H2, and HVR-H3, wherein further: (i) the HVR-H1 sequence is X 1 YX 2 MX 3 (SEQ ID NO: 21); (ii) the HVR-H2 sequence is
  • the light chain includes an HVR-L1, HVR-L2, and HVR-L3, wherein further: (iv) the HVR-L1 sequence is TGTX 7 X 8 DVGX 9 YNYVS (SEQ ID NO: 28); (v) the HVR-L2 sequence is X 10 VX 11 X 12 RPS (SEQ ID NO: 29); (vi) the HVR-L3 sequence is
  • X 1 is K, R, T, Q, G, A, W, M, I, or S
  • X 2 is V, R, K, L, M, or I
  • X 3 is H, T, N, Q, A, V, Y, W, F, or M
  • X 4 is F or I
  • X 5 is S or T
  • X 6 is E or D
  • X 7 is N or S
  • X 8 is T, R, or S
  • X 9 is A or G
  • X 10 is E or D
  • X 11 is I, N, or S
  • X 12 is D, H, or N
  • X 13 is F or Y
  • X 14 is N or S
  • X 15 is R, T, or S
  • X 16 is G or S
  • X 17 is I or T.
  • X 1 is M, I, or S;
  • X 2 is R, K, L, M, or I;
  • X 3 is F or M;
  • X 4 is F or I;
  • X 5 is S or T;
  • X 6 is E or D;
  • X 7 is N or S;
  • X 8 is T, R, or S;
  • X 9 is A or G;
  • X 10 is E or D;
  • X 11 is N or S;
  • X 12 is N;
  • X 13 is F or Y;
  • X 14 is S;
  • X 15 is S;
  • X 16 is G or S;
  • X 17 is T.
  • X 1 is M, I, or S;
  • X 2 is L, M, or I;
  • X 3 is F or M;
  • X 4 is I;
  • X 5 is S or T;
  • X 6 is D;
  • X 7 is N or S;
  • X 8 is T, R, or S;
  • X 9 is A or G;
  • X 10 is E or D;
  • X 11 is N or S;
  • X 12 is N;
  • X 13 is F or Y;
  • X 14 is S;
  • X 15 is S;
  • X 16 is G or S;
  • X 17 is T.
  • the heavy chain variable region includes one or more framework sequences juxtaposed between the HVRs as: (HC-FR1)-(HVR-H1)-(HC-FR2)-(HVR-H2)-(HC- FR3)-(HVR-H3)-(HC-FR4), and the light chain variable regions include one or more framework sequences juxtaposed between the HVRs as: (LC-FR1 MHVR-L1 )-(LC-FR2)- (HVR-L2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
  • the framework sequences are derived from human consensus framework sequences or human germline sequences.
  • one or more of the heavy chain framework sequences is the following: HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 24); HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO: 25); HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO: 26); HC-FR4 is WGQGTLVTVSS (SEQ ID NO: 27).
  • the light chain framework sequences are lambda light chain sequences.
  • one or more of the light chain framework sequences is the following: LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO: 31); LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 32); LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO: 33); LC-FR4 is FGTGTKVTVL (SEQ ID NO: 34).
  • the heavy chain variable region polypeptide, antibody, or antibody fragment further includes at least a C H 1 domain.
  • the heavy chain variable region polypeptide, antibody, or antibody fragment further includes a C H 1, a C H 2, and a C H 3 domain.
  • the variable region light chain, antibody, or antibody fragment further includes a C L domain.
  • the antibody further includes a C H 1, a C H 2, a C H 3, and a C L domain.
  • the antibody further includes a human or murine constant region.
  • the human constant region is selected from the group consisting of IgG1, IgG2, IgG2, IgG3, IgG4.
  • the human or murine constant region is lgG1.
  • the disclosure features an anti-PD-L1 antibody including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3, having at least 80% overall sequence identity to SYIMM (SEQ ID NO: 35), SIYPSGGITFYADTVKG (SEQ ID NO: 36), and IKLGTVTTVDY (SEQ ID NO: 37), respectively, and (b) the light chain includes an HVR-L1, an HVR-L2, and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGGYNYVS (SEQ ID NO: 38), DVSNRPS (SEQ ID NO: 39), and SSYTSSSTRV (SEQ ID NO: 40), respectively.
  • sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%.
  • the disclosure features an anti-PD-L1 antibody including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3, having at least 80% overall sequence identity to MYMMM (SEQ ID NO: 41), SIYPSGGITFYADSVKG (SEQ ID NO: 42), and IKLGTVTTVDY (SEQ ID NO: 37), respectively, and (b) the light chain includes an HVR-L1, an HVR-L2, and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGAYNYVS (SEQ ID NO: 43), DVSNRPS (SEQ ID NO: 39), and SSYTSSSTRV (SEQ ID NO: 40), respectively.
  • the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3, having at least 80% overall sequence identity to MYMMM (SEQ ID NO: 41), SIYPSGGITFYADSVKG (SEQ ID NO:
  • sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%.
  • the heavy chain variable region includes one or more framework sequences juxtaposed between the HVRs as: (HC-FR1)-(HVR-H1)-(HC-FR2)-(HVR-H2)-(HC- FR3)-(HVR-H3)-(HC-FR4), and the light chain variable regions include one or more framework sequences juxtaposed between the HVRs as: (LC-FR1)-(HVR-L1)-(LC-FR2)- (HVR-L2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
  • the framework sequences are derived from human germline sequences.
  • one or more of the heavy chain framework sequences is the following: HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 24); HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO: 25); HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO: 26); HC-FR4 is WGQGTLVTVSS (SEQ ID NO: 27).
  • the light chain framework sequences are derived from a lambda light chain sequence.
  • one or more of the light chain framework sequences is the following: LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO: 31); LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 32); LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO: 33); LC-FR4 is FGTGTKVTVL (SEQ ID NO: 34). [00135] In a still further specific aspect, the antibody further includes a human or murine constant region.
  • the human constant region is selected from the group consisting of IgG1, IgG2, IgG2, IgG3, IgG4.
  • the disclosure features an anti-PD-L1 antibody including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMVWRQAPGKGLEWVSSIYPSGGITF YADWKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLV TVSS (SEQ ID NO: 44), and (b) the light chain sequence has at least 85% sequence identity to the light chain sequence: QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSN RPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
  • the sequence identity is 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%.
  • the disclosure provides for an anti-PD-L1 antibody including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence: EVQLLESGGGLVQPGGSLRLSCAASGFTFSMYMMMWVRQAPGKGLEVWSSIYPSGGI TFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARIKLGTVTTVDYWG QGTLVTVSS (SEQ ID NO: 46), and (b) the light chain sequence has at least 85% sequence identity to the light chain sequence: QSALTQPASVSGSPGQSITISCTGTSSDVGAYNYVSWYQQHPGKAPKLMIYDVSNR PSGVSNRFSG
  • the sequence identity is 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
  • the antibody binds to human, mouse, or cynomolgus monkey PD-L1.
  • the antibody is capable of blocking the interaction between human, mice, or cynomolgus monkey PD-L1 and the respective human, mouse, or cynomolgus monkey PD-1 receptors.
  • the antibody binds to human PD-L1 with a KD of 5x10 -9 M or less, preferably with a KD of 2x10 -9 M or less, and even more preferred with a KD of 1x10 -9 M or less.
  • the disclosure relates to an anti-PD-L1 antibody or antigen binding fragment thereof which binds to a functional epitope including residues Y56 and D61 of human PD-L1.
  • the functional epitope further includes E58, E60, Q66, R113, and M115 of human PD-L1.
  • the antibody binds to a conformational epitope, including residues 54-66 and 112-122 of human PD-L1.
  • the disclosure is related to an anti-PD-L1 antibody, or antigen binding fragment thereof, which cross-competes for binding to PD-L1 with an antibody according to the disclosure as described herein.
  • the disclosure features proteins and polypeptides including any of the above described anti-PD-L1 antibodies in combination with at least one
  • the disclosure features an isolated nucleic acid encoding a polypeptide, or light chain or a heavy chain variable region sequence of an anti-PD-L1 antibody, or antigen binding fragment thereof, as described herein.
  • the disclosure provides for an isolated nucleic acid encoding a light chain or a heavy chain variable region sequence of an anti-PD-L1 antibody, wherein: (a) the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3 sequence having at least 80% sequence identity to SYIMM (SEQ ID NO: 35), SIYPSGGITFYADTVKG (SEQ ID NO: 36), and IKLGTVTTVDY (SEQ ID NO: 37), respectively, or (b) the light chain includes an HVR-L1, an HVR-L2, and an HVR-L3 sequence having at least 80% sequence identity to TGTSSDVGGYNYVS (SEQ ID NO: 38), DVSNRPS (SEQ ID NO: 39), and SSYTSSSTRV (SEQ ID NO: 40), respectively.
  • the heavy chain includes an HVR-H1, an HVR-H2, and an HVR-H3 sequence having at least 80% sequence identity to SYIMM (SEQ ID NO: 35), SIYPSGGIT
  • sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%.
  • nucleic acid sequence for the heavy chain is:
  • nucleic acid sequence for the light chain is:
  • the disclosure features an anti-PD-L1 antibody moiety including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
  • the light chain sequence has at least 85% sequence identity to the light chain sequence:
  • the disclosure features an anti-PD-L1 antibody moiety including a heavy chain and a light chain variable region sequence, where: (a) the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
  • the light chain sequence has at least 85% sequence identity to the light chain sequence:
  • anti-PD-L1 antibodies that can be used in an anti-PD- L1/TGF ⁇ Trap are described in US patent publication US 7,943,743.
  • the anti-PD-L1 antibody is MDX-1105.
  • the anti-PD-L1 antibody is MEDI-4736.
  • Constant Region The proteins and peptides of the disclosure can include a constant region of an immunoglobulin or a fragment, analog, variant, mutant, or derivative of the constant region.
  • the constant region is derived from a human immunoglobulin heavy chain, for example, IgG1, IgG2, IgG3, IgG4, or other classes.
  • the constant region includes a CH2 domain. In certain embodiments, the constant region includes CH2 and CH3 domains or includes hinge-CH2-CH3. Alternatively, the constant region can include all or a portion of the hinge region, the CH2 domain and/or the CH3 domain. [00158] In one embodiment, the constant region contains a mutation that reduces affinity for an Fc receptor or reduces Fc effector function. For example, the constant region can contain a mutation that eliminates the glycosylation site within the constant region of an IgG heavy chain.
  • the constant region contains mutations, deletions, or insertions at an amino acid position corresponding to Leu234, Leu235, Gly236, Gly237, Asn297, or Pro331 of IgG1 (amino acids are numbered according to EU nomenclature).
  • the constant region contains a mutation at an amino acid position corresponding to Asn297 of IgG1.
  • the constant region contains mutations, deletions, or insertions at an amino acid position corresponding to Leu281, Leu282, Gly283, Gly284, Asn344, or Pro378 of IgG1.
  • the constant region contains a CH2 domain derived from a human IgG2 or IgG4 heavy chain.
  • the CH2 domain contains a mutation that eliminates the glycosylation site within the CH2 domain.
  • the mutation alters the asparagine within the Gln-Phe-Asn-Ser (SEQ ID NO: 15) amino acid sequence within the CH2 domain of the IgG2 or IgG4 heavy chain.
  • the mutation changes the asparagine to a glutamine.
  • the mutation alters both the phenylalanine and the asparagine within the Gln-Phe-Asn-Ser (SEQ ID NO: 15) amino acid sequence.
  • the Gln-Phe-Asn-Ser (SEQ ID NO: 15) amino acid sequence is replaced with a Gln-Ala-Gln-Ser (SEQ ID NO: 16) amino acid sequence.
  • the asparagine within the Gln-Phe- Asn-Ser (SEQ ID NO: 15) amino acid sequence corresponds to Asn297 of IgG1.
  • the constant region includes a CH2 domain and at least a portion of a hinge region.
  • the hinge region can be derived from an immunoglobulin heavy chain, e.g., IgG1, IgG2, IgG3, IgG4, or other classes.
  • the hinge region is derived from human IgG1, IgG2, IgG3, IgG4, or other suitable classes. More preferably the hinge region is derived from a human IgG1 heavy chain.
  • the cysteine in the Pro- Lys-Ser-Cys-Asp-Lys (SEQ ID NO: 17) amino acid sequence of the IgG1 hinge region is altered.
  • the Pro-Lys-Ser-Cys-Asp-Lys (SEQ ID NO: 17) amino acid sequence is replaced with a Pro-Lys-Ser-Ser-Asp-Lys (SEQ ID NO: 18) amino acid sequence.
  • the constant region includes a CH2 domain derived from a first antibody isotype and a hinge region derived from a second antibody isotype.
  • the CH2 domain is derived from a human IgG2 or IgG4 heavy chain, while the hinge region is derived from an altered human IgG1 heavy chain.
  • the junction region of a protein or polypeptide of the present disclosure can contain alterations that, relative to the naturally-occurring sequences of an immunoglobulin heavy chain and erythropoietin, preferably lie within about 10 amino acids of the junction point. These amino acid changes can cause an increase in hydrophobicity.
  • the constant region is derived from an IgG sequence in which the C-terminal lysine residue is replaced.
  • the C-terminal lysine of an IgG sequence is replaced with a non-lysine amino acid, such as alanine or leucine, to further increase serum half-life.
  • the constant region is derived from an IgG sequence in which the Leu-Ser-Leu-Ser (SEQ ID NO: 19) amino acid sequence near the C-terminus of the constant region is altered to eliminate potential junctional T-cell epitopes.
  • the Leu-Ser-Leu-Ser (SEQ ID NO: 19) amino acid sequence is replaced with an Ala-Thr-Ala-Thr (SEQ ID NO: 20) amino acid sequence.
  • the amino acids within the Leu-Ser-Leu-Ser (SEQ ID NO: 19) segment are replaced with other amino acids such as glycine or proline.
  • Suitable hinge regions for the present disclosure can be derived from IgG1, IgG2, IgG3, IgG4, and other immunoglobulin classes.
  • the IgG1 hinge region has three cysteines, two of which are involved in disulfide bonds between the two heavy chains of the immunoglobulin.
  • a hinge region of the present disclosure is derived from IgG1, e.g., human IgG1.
  • the first cysteine within the human IgG1 hinge region is mutated to another amino acid, preferably serine.
  • the IgG2 isotype hinge region has four disulfide bonds that tend to promote oligomerization and possibly incorrect disulfide bonding during secretion in recombinant systems.
  • a suitable hinge region can be derived from an IgG2 hinge; the first two cysteines are each preferably mutated to another amino acid.
  • the hinge region of IgG4 is known to form interchain disulfide bonds inefficiently.
  • a suitable hinge region for the present disclosure can be derived from the IgG4 hinge region, preferably containing a mutation that enhances correct formation of disulfide bonds between heavy chain- derived moieties (Angal S, et al. (1993) Mol. Immunol., 30:105-8).
  • the constant region can contain CH2 and/or CH3 domains and a hinge region that are derived from different antibody isotypes, i.e., a hybrid constant region.
  • the constant region contains CH2 and/or CH3 domains derived from IgG2 or IgG4 and a mutant hinge region derived from IgG1.
  • a mutant hinge region from another IgG subclass is used in a hybrid constant region.
  • a mutant form of the IgG4 hinge that allows efficient disulfide bonding between the two heavy chains can be used.
  • a mutant hinge can also be derived from an IgG2 hinge in which the first two cysteines are each mutated to another amino acid. Assembly of such hybrid constant regions has been described in U.S. Patent Publication No.20030044423, the disclosure of which is hereby incorporated by reference.
  • the constant region can contain one or more mutations described herein. The combinations of mutations in the Fc portion can have additive or synergistic effects on the prolonged serum half-life and increased in vivo potency of the bifunctional molecule.
  • the constant region can contain (i) a region derived from an IgG sequence in which the Leu-Ser-Leu-Ser (SEQ ID NO: 19) amino acid sequence is replaced with an Ala-Thr-Ala-Thr (SEQ ID NO: 20) amino acid sequence; (ii) a C-terminal alanine residue instead of lysine; (iii) a CH2 domain and a hinge region that are derived from different antibody isotypes, for example, an IgG2 CH2 domain and an altered IgG1 hinge region; and (iv) a mutation that eliminates the glycosylation site within the IgG2-derived CH2 domain, for example, a Gln-Ala-Gln-Ser (SEQ ID NO: 16) amino acid sequence instead of the Gln-Phe-Asn-Ser (SEQ ID NO: 15) amino acid sequence within the IgG2-derived CH2 domain.
  • Antibody fragments can also include antigen-binding fragments of antibodies.
  • Exemplary antibody fragments include scFv, Fv, Fab, F(ab’) 2 , and single domain VHH fragments such as those of camelid origin.
  • Single-chain antibody fragments also known as single-chain antibodies (scFvs) are recombinant polypeptides which typically bind antigens or receptors; these fragments contain at least one fragment of an antibody variable heavy-chain amino acid sequence (V H ) tethered to at least one fragment of an antibody variable light-chain sequence (V L ) with or without one or more interconnecting linkers.
  • Such a linker may be a short, flexible peptide selected to assure that the proper three-dimensional folding of the V L and V H domains occurs once they are linked so as to maintain the target molecule binding-specificity of the whole antibody from which the single-chain antibody fragment is derived.
  • the carboxyl terminus of the V L or V H sequence is covalently linked by such a peptide linker to the amino acid terminus of a complementary V L and V H sequence.
  • Single-chain antibody fragments can be generated by molecular cloning, antibody phage display library or similar techniques. These proteins can be produced either in eukaryotic cells or prokaryotic cells, including bacteria.
  • Single-chain antibody fragments contain amino acid sequences having at least one of the variable regions or CDRs of the whole antibodies described in this specification, but are lacking some or all of the constant domains of those antibodies. These constant domains are not necessary for antigen binding, but constitute a major portion of the structure of whole antibodies. Single-chain antibody fragments may therefore overcome some of the problems associated with the use of antibodies containing part or all of a constant domain. For example, single-chain antibody fragments tend to be free of undesired interactions between biological molecules and the heavy-chain constant region, or other unwanted biological activity.
  • single-chain antibody fragments are considerably smaller than whole antibodies and may therefore have greater capillary permeability than whole antibodies, allowing single- chain antibody fragments to localize and bind to target antigen-binding sites more efficiently.
  • antibody fragments can be produced on a relatively large scale in prokaryotic cells, thus facilitating their production.
  • the relatively small size of single-chain antibody fragments makes them less likely than whole antibodies to provoke an immune response in a recipient.
  • Fragments of antibodies that have the same or comparable binding characteristics to those of the whole antibody may also be present. Such fragments may contain one or both Fab fragments or the F(ab’) 2 fragment.
  • compositions may contain all six CDRs of the whole antibody, although fragments containing fewer than all of such regions, such as three, four or five CDRs, are also functional.
  • Pharmaceutical Compositions [00169] The present disclosure also features pharmaceutical compositions that contain a therapeutically effective amount of a protein described herein.
  • the composition can be formulated for use in a variety of drug delivery systems.
  • One or more physiologically acceptable excipients or carriers can also be included in the composition for proper
  • the present disclosure provides an intravenous drug delivery formulation that includes 500 mg– 2000 mg of a protein including a first polypeptide and a second polypeptide
  • the first polypeptide includes: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor ⁇ Receptor II (TGF ⁇ RII), or a fragment thereof, capable of binding Transforming Growth Factor ⁇ (TGF ⁇ )
  • the second polypeptide includes at least a variable region of a light chain of an antibody that binds PD-L1, and the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1.
  • a protein product of the present disclosure includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • the intravenous drug delivery formulation may include about 500 mg to about 2400 mg dose (e.g., about 500 mg to about 2300 mg, about 500 mg to about 2200 mg, about 500 mg to about 2100 mg, about 500 mg to about 2000 mg, about 500 mg to about 1900 mg, about 500 mg to about 1800 mg, about 500 mg to about 1700 mg, about 500 mg to about 1600 mg, about 500 mg to about 1500 mg, about 500 mg to about 1400 mg, about 500 mg to about 1300 mg, about 500 mg to about 1200 mg, about 500 mg to about 1100 mg, about 500 mg to about 1000 mg, about 500 mg to about 900 mg, about 500 mg to about 800 mg, about 500 mg to about 700 mg, about 500 mg to about 600 mg, about 600 mg to 2400 mg,
  • the intravenous drug delivery formulation may include about 500 to about 2000 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • the intravenous drug delivery formulation may include about 500 mg dose of a protein product of the present disclosure with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and the second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • the intravenous drug delivery formulation may include 500 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • the intravenous drug delivery formulation may include about 1200 mg dose of a protein product of the present disclosure with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and the second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • the intravenous drug delivery formulation may include 1200 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • a protein of the present disclosure e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • the intravenous drug delivery formulation may include about 1200 mg to about 3000 mg (e.g., about 1200 mg to about 3000 mg, about 1200 mg to about 2900 mg, about 1200 mg to about 2800 mg, about 1200 mg to about 2700 mg, about 1200 mg to about 2600 mg, about 1200 mg to about 2500 mg, about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700 mg, about 1200 mg to about 1600 mg, about 1200 mg to about 1500 mg, about 1200 mg to about 1400 mg, about 1200 mg to about 1300 mg, about 1300 mg to about 3000 mg, about 1400 mg to about 3000 mg, about 1500 mg to about 3000 mg, about 1600 mg to about 3000 mg, about 1700 mg to about 3000 mg, about 1800 mg
  • the intravenous drug delivery formulation may include about 1200 mg to about 3000 mg (e.g., about 1200 mg to about 3000 mg, about 1200 mg to about 2900 mg, about 1200 mg to about 2800 mg, about 1200 mg to about 2700 mg, about 1200 mg to about 2600 mg, about 1200 mg to about 2500 mg, about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700 mg, about 1200 mg to about 1600 mg, about 1200 mg to about 1500 mg, about 1200 mg to about 1400 mg, about 1200 mg to about 1300 mg, about 1300 mg to about 3000 mg, about 1400 mg to about 3000 mg, about 1500 mg to about 3000 mg, about 1600 mg to about 3000 mg, about 1700 mg to about 3000 mg, about 1800 mg
  • the intravenous drug delivery formulation may include about 525 mg, about 550 mg, about 575 mg, about 600 mg, about 625 mg, about 650 mg, about 675 mg, about 700 mg, about 725 mg, about 750 mg, about 775 mg, about 800 mg, about 825 mg, about 850 mg, about 875 mg, about 900 mg, about 925 mg, about 950 mg, about 975 mg, about 1000 mg, about 1025 mg, about 1050 mg, about 1075 mg, about 1100 mg, about 1125 mg, about 1150 mg, about 1175 mg, about 1200 mg, about 1225 mg, about 1250 mg, about 1275 mg, about 1300 mg, about 1325 mg, about 1350 mg, about 1375 mg, about 1400 mg, about 1425 mg, about 1450 mg, about 1475 mg, about 1500 mg, about 1525 mg, about 1550 mg, about 1575 mg, about 1600 mg, about 1625 mg, about 1650 mg, about 1675 mg, about 1700 mg, about 1725
  • the intravenous drug delivery formulation of the present disclosure may be contained in a bag, a pen, or a syringe.
  • the bag may be connected to a channel comprising a tube and/or a needle.
  • the formulation may be a lyophilized formulation or a liquid formulation.
  • the formulation may freeze-dried (lyophilized) and contained in about 12-60 vials.
  • the formulation may be freeze-dried and about 45 mg of the freeze-dried formulation may be contained in one vial.
  • the about 40 mg– about 100 mg of freeze-dried formulation may be contained in one vial.
  • freeze dried formulation from 12, 27, or 45 vials are combined to obtained a therapeutic dose of the protein in the intravenous drug formulation.
  • the formulation may be a liquid formulation of a protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and the second polypeptide that includes the amino acid sequence of SEQ ID NO: 1, and stored as about 250 mg/vial to about 2000 mg/vial (e.g., about 250 mg/vial to about 2000 mg/vial, about 250 mg/vial to about 1900 mg/vial, about 250 mg/vial to about 1800 mg/vial, about 250 mg/vial to about 1700 mg/vial, about 250 mg/vial to about 1600 mg/vial, about 250 mg/vial to about 1500 mg/vial, about 250 mg/vial to about 1400 mg/vial, about 250 mg/vial to about 1300 mg/vial, about 250 mg/vial to about 1200 mg/vial, about 250 mg/vial to about 1100 mg
  • the formulation may be a liquid formulation and stored as about 600 mg/vial. In certain embodiments, the formulation may be a liquid formulation and stored as about 1200 mg/vial. In certain embodiments, the formulation may be a liquid formulation and stored as about 1800 mg/vial. In certain embodiments, the formulation may be a liquid formulation and stored as about 250 mg/vial.
  • This disclosure provides a liquid aqueous pharmaceutical formulation including a therapeutically effective amount of the protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap) in a buffered solution forming a formulation.
  • These compositions may be sterilized by conventional sterilization techniques, or may be sterile filtered.
  • the resulting aqueous solutions may be packaged for use as-is, or lyophilized, the lyophilized preparation being combined with a sterile aqueous carrier prior to administration.
  • the pH of the preparations typically will be between 3 and 11, more preferably between 5 and 9 or between 6 and 8, and most preferably between 7 and 8, such as 7 to 7.5.
  • the resulting compositions in solid form may be packaged in multiple single dose units, each containing a fixed amount of the above-mentioned agent or agents.
  • the composition in solid form can also be packaged in a container for a flexible quantity.
  • the present disclosure provides a formulation with an extended shelf life including a protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)), in combination with mannitol, citric acid monohydrate, sodium citrate, disodium phosphate dihydrate, sodium dihydrogen phosphate dihydrate, sodium chloride, polysorbate 80, water, and sodium hydroxide.
  • a protein of the present disclosure e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)
  • mannitol citric acid monohydrate, sodium citrate, disodium phosphate dihydrate, sodium dihydrogen phosphate dihydrate, sodium chloride, polysorbate
  • an aqueous formulation is prepared including a protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)) in a pH-buffered solution.
  • a protein of the present disclosure e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)
  • the buffer of this invention may have a pH ranging from about 4 to about 8, e.g., from about 4 to about 8, from about 4.5 to about 8, from about 5 to about 8, from about 5.5 to about 8, from about 6 to about 8, from about 6.5 to about 8, from about 7 to about 8, from about 7.5 to about 8, from about 4 to about 7.5, from about 4.5 to about 7.5, from about 5 to about about 7.5, from about 5.5 to about 7.5, from about 6 to about 7.5, from about 6.5 to about 7.5, from about 4 to about 7, from about 4.5 to about 7, from about 5 to about 7, from about 5.5 to about 7, from about 6 to about 7, from about 4 to about 6.5, from about 4.5 to about 6.5, from about 5 to about 6.5, from about 5.5 to about 6.5, from about 4 to about 6.0, from about 4.5 to about 6.0, from about 5 to about 6, or from about 4.8 to about 5.5, or may have a pH of about 5.0 to about 5.2.
  • Ranges intermediate to the above recited pH's are also intended to be part of this disclosure. For example, ranges of values using a combination of any of the above recited values as upper and/or lower limits are intended to be included.
  • buffers that will control the pH within this range include acetate (e.g. sodium acetate), succinate (such as sodium succinate), gluconate, histidine, citrate and other organic acid buffers.
  • the formulation includes a buffer system which contains citrate and phosphate to maintain the pH in a range of about 4 to about 8.
  • the pH range may be from about 4.5 to about 6.0, or from about pH 4.8 to about 5.5, or in a pH range of about 5.0 to about 5.2.
  • the buffer system includes citric acid monohydrate, sodium citrate, disodium phosphate dihydrate, and/or sodium dihydrogen phosphate dihydrate.
  • the buffer system includes about 1.3 mg/ml of citric acid (e.g., 1.305 mg/ml), about 0.3 mg/ml of sodium citrate (e.g., 0.305 mg/ml), about 1.5 mg/ml of disodium phosphate dihydrate (e.g., 1.53 mg/ml), about 0.9 mg/ml of sodium dihydrogen phosphate dihydrate (e.g., 0.86), and about 6.2 mg/ml of sodium chloride (e.g., 6.165 mg/ml).
  • citric acid e.g., 1.305 mg/ml
  • sodium citrate e.g. 0.305 mg/ml
  • 1.5 mg/ml of disodium phosphate dihydrate e.g., 1.53 mg/ml
  • about 0.9 mg/ml of sodium dihydrogen phosphate dihydrate e.g., 0.86
  • about 6.2 mg/ml of sodium chloride e.g., 6.165 mg/ml
  • the buffer system includes about 1-1.5 mg/ml of citric acid, about 0.25 to about 0.5 mg/ml of sodium citrate, about 1.25 to about 1.75 mg/ml of disodium phosphate dihydrate, about 0.7 to about 1.1 mg/ml of sodium dihydrogen phosphate dihydrate, and 6.0 to 6.4 mg/ml of sodium chloride.
  • the pH of the formulation is adjusted with sodium hydroxide.
  • a polyol which acts as a tonicifier and may stabilize the antibody, may also be included in the formulation. The polyol is added to the formulation in an amount which may vary with respect to the desired isotonicity of the formulation. In certain embodiments, the aqueous formulation may be isotonic.
  • the amount of polyol added may also alter with respect to the molecular weight of the polyol. For example, a lower amount of a monosaccharide (e.g. mannitol) may be added, compared to a disaccharide (such as trehalose).
  • a monosaccharide e.g. mannitol
  • a disaccharide such as trehalose
  • the polyol which may be used in the formulation as a tonicity agent is mannitol.
  • the mannitol concentration may be about 5 to about 20 mg/ml.
  • the concentration of mannitol may be about 7.5 to about 15 mg/ml.
  • the concentration of mannitol may be about 10– about 14 mg/ml.
  • the concentration of mannitol may be about 12 mg/ml.
  • the polyol sorbitol may be included in the formulation. [00181]
  • a detergent or surfactant may also be added to the formulation.
  • Exemplary detergents include nonionic detergents such as polysorbates (e.g.
  • the formulation may include a surfactant which is a polysorbate.
  • the formulation may contain the detergent polysorbate 80 or Tween 80. Tween 80 is a term used to describe polyoxyethylene (20) sorbitanmonooleate (see Fiedler, Lexikon der Hilfsstoffe, Editio Cantor Verlag Aulendorf, 4th edi., 1996).
  • the formulation may contain between about 0.1 mg/mL and about 10 mg/mL of polysorbate 80, or between about 0.5 mg/mL and about 5 mg/mL. In certain embodiments, about 0.1% polysorbate 80 may be added in the formulation.
  • Lyophilized Formulation [00182] The lyophilized formulation of the present disclosure includes the anti-PD-L1/TGF ⁇ Trap molecule and a lyoprotectant.
  • the lyoprotectant may be sugar, e.g., disaccharides.
  • the lycoprotectant may be sucrose or maltose.
  • the lyophilized formulation may also include one or more of a buffering agent, a surfactant, a bulking agent, and/or a preservative.
  • the amount of sucrose or maltose useful for stabilization of the lyophilized drug product may be in a weight ratio of at least 1:2 protein to sucrose or maltose.
  • the protein to sucrose or maltose weight ratio may be of from 1:2 to 1:5.
  • the pH of the formulation, prior to lyophilization may be set by addition of a pharmaceutically acceptable acid and/or base.
  • the pharmaceutically acceptable acid may be hydrochloric acid.
  • the pharmaceutically acceptable base may be sodium hydroxide.
  • the pH of the solution containing the protein of the present disclosure may be adjusted between about 6 to about 8.
  • the pH range for the lyophilized drug product may be from about 7 to about 8.
  • a salt or buffer components may be added in an amount of about 10 mM– about 200 mM.
  • the salts and/or buffers are pharmaceutically acceptable and are derived from various known acids (inorganic and organic) with“base forming” metals or amines.
  • the buffer may be phosphate buffer.
  • the buffer may be glycinate, carbonate, citrate buffers, in which case, sodium, potassium or ammonium ions can serve as counterion.
  • a“bulking agent” may be added.
  • A“bulking agent” is a compound which adds mass to a lyophilized mixture and contributes to the physical structure of the lyophilized cake (e.g., facilitates the production of an essentially uniform lyophilized cake which maintains an open pore structure).
  • Illustrative bulking agents include mannitol, glycine, polyethylene glycol and sorbitol.
  • the lyophilized formulations of the present invention may contain such bulking agents.
  • a preservative may be optionally added to the formulations herein to reduce bacterial action. The addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • the lyophilized drug product may be constituted with an aqueous carrier.
  • the aqueous carrier of interest herein is one which is pharmaceutically acceptable (e.g., safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation, after lyophilization.
  • Illustrative diluents include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
  • the lyophilized drug product of the current disclosure is reconstituted with either Sterile Water for Injection, USP (SWFI) or 0.9% Sodium Chloride Injection, USP. During reconstitution, the lyophilized powder dissolves into a solution.
  • SWFI Sterile Water for Injection
  • USP 0.9% Sodium Chloride Injection
  • the lyophilized powder dissolves into a solution.
  • the lyophilized protein product of the instant disclosure is constituted to about 4.5 mL water for injection and diluted with 0.9% saline solution (sodium chloride solution).
  • Liquid Formulation [00192] In embodiments, the protein product of the present disclosure is formulated as a liquid formulation.
  • the liquid formulation may be presented at a 10 mg/mL concentration in eithera USP / Ph Eur type I 50R vial closed with a rubber stopper and sealed with an aluminum crimp seal closure.
  • the stopper may be made of elastomer complying with USP and Ph Eur.
  • vials may be filled with about 61.2 mL of the protein product solution in order to allow an extractable volume of 60 mL.
  • the liquid formulation may be diluted with 0.9% saline solution.
  • vials may contain about 61.2 mL of the protein product (e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)) solution of about 20 mg/mL to about 50 mg/mL (e.g., about 20 mg/mL, about 25 mg/mL, about 30 mg/mL, about 35 mg/mL, about 40 mg/mL, about 45 mg/mL or about 50 mg/mL) in order to allow an extractable volume of 60 mL for delivering about 1200 mg to about 3000 mg (e.g., about 1200 mg to about 3000 mg, about 1200 mg to about 2900 mg, about 1200 mg to about 2800 mg, about 1200 mg to about 2700 mg, about 1200 mg to about 2600 mg, about 1200 mg to about 2500 mg, about 1200 mg to about 2400 mg, about
  • vials may contain about 61.2 mL of the protein product solution (protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and the second polypeptide that includes the amino acid sequence of SEQ ID NO: 1) of about 20 mg/mL to about 50 mg/mL (e.g., about 20 mg/mL, about 25 mg/mL, about 30 mg/mL, about 35 mg/mL, about 40 mg/mL, about 45 mg/mL or about 50 mg/mL) in order to allow an extractable volume of 60 mL for delivering about 1200 mg to about 3000 mg (e.g., about 1200 mg to about 3000 mg, about 1200 mg to about 2900 mg, about 1200 mg to about 2800 mg, about 1200 mg to about 2700 mg, about 1200 mg to about 2600 mg, about 1200 mg to about 2500 mg, about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg
  • the protein product solution protein
  • the liquid formulation of the disclosure may be prepared as a 10 mg/mL concentration solution in combination with a sugar at stabilizing levels.
  • the liquid formulation may be prepared in an aqueous carrier.
  • a stabilizer may be added in an amount no greater than that which may result in a viscosity undesirable or unsuitable for intravenous administration.
  • the sugar may be disaccharides, e.g., sucrose.
  • the liquid formulation may also include one or more of a buffering agent, a surfactant, and a preservative.
  • the pH of the liquid formulation may be set by addition of a pharmaceutically acceptable acid and/or base.
  • the pharmaceutically acceptable acid may be hydrochloric acid.
  • the base may be sodium hydroxide.
  • deamidation is a common product variant of peptides and proteins that may occur during fermentation, harvest/cell clarification, purification, drug substance/drug product storage and during sample analysis. Deamidation is the loss of NH 3 from a protein forming a succinimide intermediate that can undergo hydrolysis. The succinimide intermediate results in a 17 u mass decrease of the parent peptide. The subsequent hydrolysis results in an 18 u mass increase. Isolation of the succinimide intermediate is difficult due to instability under aqueous conditions. As such, deamidation is typically detectable as 1 u mass increase.
  • Deamidation of an asparagine results in either aspartic or isoaspartic acid.
  • the parameters affecting the rate of deamidation include pH, temperature, solvent dielectric constant, ionic strength, primary sequence, local polypeptide conformation and tertiary structure.
  • the amino acid residues adjacent to Asn in the peptide chain affect deamidation rates. Gly and Ser following an Asn in protein sequences results in a higher susceptibility to deamidation.
  • the liquid formulation of the present disclosure may be preserved under conditions of pH and humidity to prevent deamination of the protein product.
  • the aqueous carrier of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation.
  • Illustrative carriers include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
  • a preservative may be optionally added to the formulations herein to reduce bacterial action. The addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • Intravenous (IV) formulations may be the preferred administration route in particular instances, such as when a patient is in the hospital after transplantation receiving all drugs via the IV route.
  • the liquid formulation is diluted with 0.9% Sodium Chloride solution before administration.
  • the diluted drug product for injection is isotonic and suitable for administration by intravenous infusion.
  • a salt or buffer components may be added in an amount of 10 mM - 200 mM.
  • the salts and/or buffers are pharmaceutically acceptable and are derived from various known acids (inorganic and organic) with“base forming” metals or amines.
  • the buffer may be phosphate buffer.
  • the buffer may be glycinate, carbonate, citrate buffers, in which case, sodium, potassium or ammonium ions can serve as counterion.
  • a preservative may be optionally added to the formulations herein to reduce bacterial action. The addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • the aqueous carrier of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation.
  • Illustrative carriers include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffered solution (e.g.
  • a preservative may be optionally added to the formulations herein to reduce bacterial action.
  • the addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • Method of Treating Cancer or Inhibiting Tumor Growth [00205] In one aspect the present disclosure provides a method of treating cancer or inhibiting tumor growth in a subject in need thereof, the method including administering to the subject a dose of at least 500 mg of a protein including a first polypeptide and a second polypeptide.
  • the first polypeptide includes: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor ⁇ Receptor II (TGF ⁇ RII), or a fragment thereof, capable of binding Transforming Growth Factor ⁇ (TGF ⁇ ).
  • the second polypeptide includes at least a variable region of a light chain of an antibody that binds PD-L1, and the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1.
  • the method of treating cancer or inhibiting tumor growth of the present disclosure involves administering to a subject a protein including two peptides in which the first polypeptide includes the amino acid sequence of SEQ ID NO: 3, and the second polypeptide includes the amino acid sequence of SEQ ID NO: 1.
  • the protein is an anti-PD-L1/TGF ⁇ Trap molecule.
  • the method of treating cancer or inhibiting tumor growth of the present disclosure involves administering to a subject a protein (e.g., an anti-PD-L1/TGF ⁇ Trap molecule (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)) at a dose of about 1200 mg to about 3000 mg (e.g., about 1200 mg to about 3000 mg, about 1200 mg to about 2900 mg, about 1200 mg to about 2800 mg, about 1200 mg to about 2700 mg, about 1200 mg to about 2600 mg, about 1200 mg to about 2500 mg, about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700
  • a protein e.
  • about 1200 mg of anti- PD-L1/TGF ⁇ Trap molecule is administered to a subject once every two weeks. In certain embodiments, about 1800 mg of anti-PD-L1/TGF ⁇ Trap molecule is administered to a subject once every three weeks. In certain embodiments, about 1200 mg of a protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3 and the second polypeptide that includes the amino acid sequence of SEQ ID NO: 1 is administered to a subject once every two weeks.
  • about 1800 mg of a protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3 and the second polypeptide that includes the amino acid sequence of SEQ ID NO: 1 is administered to a subject once every three weeks.
  • the dose may be about 500 mg, about 525 mg, about 550 mg, about 575 mg, about 600 mg, about 625 mg, about 650 mg, about 675 mg, about 700 mg, about 725 mg, about 750 mg, about 775 mg, about 800 mg, about 825 mg, about 850 mg, about 875 mg, about 900 mg, about 925 mg, about 950 mg, about 975 mg, about 1000 mg, about 1025 mg, about 1050 mg, about 1075 mg, about 1100 mg, about 1125 mg, about 1150 mg, about 1175 mg, about 1200 mg, about 1225 mg, about 1250 mg, about 1275 mg, about 1300 mg, about 1325 mg, about 1350 mg, about 1375 mg, about 1400 mg
  • the dose may be administered once every two weeks.
  • the protein may be administered by intravenous administration, e.g., with a prefilled bag, a prefilled pen, or a prefilled syringes.
  • the protein is administered intravenously from a 250 ml saline bag, and the intravenous infusion may be for about one hour (e.g., 50 to 80 minutes).
  • the bag is connected to a channel comprising a tube and/or a needle.
  • the method treats a cancer or inhibits tumor growth, for example, among the following: non-small cell lung cancer, melanoma, pancreatic cancer, colorectal cancer, ovarian cancer, breast cancer, prostate cancer, glioblastoma, gastric cancer, biliary tract cancer, esophageal cancer (squamous cell carcinoma or adenocarcinoma), adenoma of the head or the neck, squamous carcinoma of the head or the neck, prostate cancer, renal cancer, cervical cancer, myeloma, lymphoma, leukemia, thyroid cancer, endometrial cancer, uterine cancer, bladder cancer, neuroendocrine cancer, liver cancer, nasopharyngeal cancer, testicular cancer, small cell lung cancer, basal cell skin cancer, squamous cell skin cancer, dermatofibrosarcoma protuberans, Merkel cell carcinoma, glioma, sarcoma, mesothelioma
  • non-small cell lung cancer
  • the method treats a cancer of pretreated patients, for example pretreated non-small cell lung cancer, pretreated melanoma, pretreated pancreatic cancer, pretreated colorectal cancer, pretreated ovarian cancer, pretreated breast cancer, pretreated glioblastoma, pretreated recurrent or refractory unresectable Stage IV gastric cancer, pretreated biliary tract cancer, pretreated esophageal cancer (squamous cell carcinoma or adenocarcinoma), pretreated adenoma of the head or the neck, pretreated squamous carcinoma of the head or the neck, pretreated prostate cancer, pretreated renal cancer, pretreated cervical cancer, pretreated myeloma, pretreated lymphoma, pretreated leukemia, pretreated thyroid cancer, pretreated endometrial cancer, pretreated uterine cancer, pretreated bladder cancer, pretreated neuroendocrine cancer, pretreated liver cancer, pretreated nasopharyngeal cancer, pretreated testicular cancer, pretreated small cell
  • the tumor is an advanced solid tumor.
  • the tumor is refractory to prior treatment.
  • patients who had advanced NSCLC and were previously treated with anti-PD-1 or anti-PD-L1 agent (“PDx therapy”) and subsequently had documented disease progression are treated by intravenously administering about 1200 mg of anti-PD-L1/TGF ⁇ Trap. Patient best overall response (BOR) to prior PDx therapy was documented.
  • PDx therapy anti-PD-1 or anti-PD-L1 agent
  • patients with progressive disease (PD) following prior PDx therapy are treated by intravenously administering about 1200 mg – about 2400 mg (e.g., about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700 mg, about 1200 mg to about 1600 mg, about 1200 mg to about 1500 mg, about 1200 mg to about 1400 mg, about 1200 mg to about 1300 mg, about 1300 mg to about 2400 mg, about 1400 mg to about 2400 mg, about 1500 mg to about 2400 mg, about 1600 mg to about 2400 mg, about 1700 mg to about 2400 mg, about 1800 mg to about 2400 mg, about 1900 mg
  • patients characterized as acquired resistant i.e., the patients’ disease initially responded to prior PDx therapy but the patients ultimately reverted to disease progression stage, are treated by intravenously administering about 1200 mg to about 2400 mg of anti-PD-L1/TGF ⁇ Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • SA stable disease
  • PR partial response
  • CR complete response
  • TGF- ⁇ a molecule known to inhibit tumor immune activation
  • patients who had advanced NSCLC with refractory, relapsed or progressive disease on or after a single line of platinum-based chemtherapy are treated by intravenously administering about 1200 mg– about 2400 mg (e.g., about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700 mg, about 1200 mg to about 1600 mg, about 1200 mg to about 1500 mg, about 1200 mg to about 1400 mg, about 1200 mg to about 1300 mg, about 1300 mg to about 2400 mg, about 1400 mg to about 2400 mg, about 1500 mg to about 2400 mg, about 1600 mg to about 2400 mg, about 1700 mg to about 2400 mg, about 1800 mg to about 2400 mg, about 1900 mg to about 2400 mg, about 2000 mg to about 2400 mg, about 2000 mg to about 2400
  • patients who had advanced NSCLC with refractory, relapsed or progressive disease on or after a single line of platinum-based chemtherapy are treated by intravenously administering anti-PD-L1/TGF ⁇ Trap at a dose of about 1200 mg once every 2 weeks.
  • patients who had advanced NSCLC with refractory, relapsed or progressive disease on or after a single line of platinum-based chemtherapy are treated by intravenously administering anti-PD-L1/TGF ⁇ Trap at a dose of about 500 mg– about 1200 mg (e.g., about 500 mg to about 1000 mg, about 500 mg to about 1000 mg, about 500 mg to about 900 mg, about 500 mg to about 800 mg, about 500 mg to about 700 mg, about 500 mg to about 600 mg) which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • patients who had advanced NSCLC with refractory, relapsed or progressive disease on or after a single line of platinum-based chemtherapy are treated by intravenously administering anti-PD-L1/TGF ⁇ Trap at a dose of about 500 mg once every 2 weeks.
  • patients with heavily pretreated recurrent or refractory unresectable Stage IV gastric cancer are treated by intravenously administering about 1200 mg – about 2400 mg (e.g., about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700 mg, about 1200 mg to about 1600 mg, about 1200 mg to about 1500 mg, about 1200 mg to about 1400 mg, about 1200 mg to about 1300 mg, about 1300 mg to about 2400 mg, about 1400 mg to about 2400 mg, about 1500 mg to about 2400 mg, about 1600 mg to about 2400 mg, about 1700 mg to about 2400 mg, about 1800 mg to about 2400 mg, about 1900 mg to about 2400 mg, about 2000 mg to about 2400 mg, about 2100 mg to about 2400 mg
  • patients with heavily pretreated recurrent or refractory unresectable Stage IV gastric cancer are treated by intravenously administering anti-PD- L1/TGF ⁇ Trap at a dose of about 1200 mg once every 2 weeks for 2– 30 weeks.
  • the treated patients received at least 3 prior anticancer therapies. In certain embodiments, the treated patients received at least 4 prior anticancer therapies.
  • patients with pretreated colorectal cancer are treated by intravenously administering about 1200 mg– about 2400 mg (e.g., about 1200 mg to about 2400 mg, about 1200 mg to about 2300 mg, about 1200 mg to about 2200 mg, about 1200 mg to about 2100 mg, about 1200 mg to about 2000 mg, about 1200 mg to about 1900 mg, about 1200 mg to about 1800 mg, about 1200 mg to about 1700 mg, about 1200 mg to about 1600 mg, about 1200 mg to about 1500 mg, about 1200 mg to about 1400 mg, about 1200 mg to about 1300 mg, about 1300 mg to about 2400 mg, about 1400 mg to about 2400 mg, about 1500 mg to about 2400 mg, about 1600 mg to about 2400 mg, about 1700 mg to about 2400 mg, about 1800 mg to about 2400 mg, about 1900 mg to about 2400 mg, about 2000 mg to about 2400 mg, about 2100 mg to about 2400 mg, about 2200 mg to about 2400 mg,
  • patients with pretreated colorectal cancer are treated with anti-PD-L1/TGF ⁇ Trap at a dose of about 1200 mg once every 2 weeks for 2– 38 weeks.
  • the treated patients received at least 3 prior anticancer therapies.
  • the present disclosure provides a drug delivery device including a formulation comprising about 500 mg– about 3000 mg of a protein including a first polypeptide and a second polypeptide
  • the first polypeptide includes: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor ⁇ Receptor II (TGF ⁇ RII), or a fragment thereof, capable of binding Transforming Growth Factor ⁇ (TGF ⁇ )
  • the second polypeptide includes at least a variable region of a light chain of an antibody that binds PD-L1, and the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1.
  • the device may be a bag, a pen, or a syringe.
  • the bag may be connected to a channel comprising a tube and/or a needle.
  • the drug delivery device may include about 500 mg to about 3000 mg (e.g., about 500 mg to about 3000 mg, about 500 mg to about 2900 mg, about 500 mg to about 2800 mg, about 500 mg to about 2700 mg, about 500 mg to about 2600 mg, about 500 mg to about 2500 mg, about 500 mg to about 2400 mg, about 500 mg to about 2300 mg, about 500 mg to about 2200 mg, about 500 mg to about 2100 mg, about 500 mg to about 2000 mg, about 500 mg to about 1900 mg, about 500 mg to about 1800 mg, about 500 mg to about 1700 mg, about 500 mg to about 1600 mg, about 500 mg to about 1500 mg, about 500 mg to about 1400 mg, about 500 mg to about 1300 mg, about 500 mg to about 1200 mg
  • the drug delivery device may include about 500 to about 1200 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1). In certain embodiments, the drug delivery device may include about 500 mg dose of the protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1).
  • the drug delivery device includes about 1200 mg dose of a protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1). In certain embodiments, the drug delivery device includes about 1200 mg or about 1800 mg dose of the protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and the second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • a protein of the present disclosure e.g., anti-PD-L1/TGF ⁇ Trap, which includes a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • the drug delivery device includes about 1200 mg dose of the protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • the protein of the present disclosure e.g., anti-PD-L1/TGF ⁇ Trap (e.g., including a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and a second polypeptide that includes the amino acid sequence of SEQ ID NO: 1)).
  • the drug delivery device may include about 500 mg, about 525 mg, about 550 mg, about 575 mg, about 600 mg, about 625 mg, about 650 mg, about 675 mg, about 700 mg, about 725 mg, about 750 mg, about 775 mg, about 800 mg, about 825 mg, about 850 mg, about 875 mg, about 900 mg, about 925 mg, about 950 mg, about 975 mg, about 1000 mg, about 1025 mg, about 1050 mg, about 1075 mg, about 1100 mg, about 1125 mg, about 1150 mg, about 1175 mg, about 1200 mg, about 1225 mg, about 1250 mg, about 1275 mg, about 1300 mg, about 1325 mg, about 1350 mg, about 1375 mg, about 1400 mg, about 1425 mg, about 1450 mg, about 1475 mg, about 1500 mg, about 1525 mg, about 1550 mg, about 1575 mg, about 1600 mg, about 1625 mg, about 1650 mg, about 1675 mg, about 1700 mg, about 1725 mg, about
  • kits including one or more vessels collectively including a formulation of about 500 mg to about 2400 mg (e.g., about 500 mg to about 2400 mg, about 500 mg to about 2300 mg, about 500 mg to about 2200 mg, about 500 mg to about 2100 mg, about 500 mg to about 2000 mg, about 500 mg to about 1900 mg, about 500 mg to about 1800 mg, about 500 mg to about 1700 mg, about 500 mg to about 1600 mg, about 500 mg to about 1500 mg, about 500 mg to about 1400 mg, about 500 mg to about 1300 mg, about 500 mg to about 1200 mg, about 500 mg to about 1100 mg, about 500 mg to about 1000 mg, about 500 mg to about 900 mg, about 500 mg to about 800 mg, about 500 mg to about 700 mg, about 500 mg to about 600 mg, about 600 mg to about 2400 mg, about 700 mg to about 2400 mg, about 800 mg to about 2400 mg, about 900 mg to about 2400 mg, about 1000 mg to about 2400 mg, about 1100 mg
  • the vessels collectively may include a dose of about 500 mg to about 2400 mg (e.g., about 500 mg to about 2400 mg, about 500 mg to about 2300 mg, about 500 mg to about 2200 mg, about 500 mg to about 2100 mg, about 500 mg to about 2000 mg, about 500 mg to about 1900 mg, about 500 mg to about 1800 mg, about 500 mg to about 1700 mg, about 500 mg to about 1600 mg, about 500 mg to about 1500 mg, about 500 mg to about 1400 mg, about 500 mg to about 1300 mg, about 500 mg to about 1200 mg, about 500 mg to about 1100 mg, about 500 mg to about 1000 mg, about 500 mg to about 900 mg, about 500 mg to about 800 mg, about 500 mg to about 700 mg, about 500 mg to about 600 mg, about 600 mg to about 2400 mg, about 700 mg to about 2400 mg, about 800 mg to about 2400 mg, about 900 mg to about 2400 mg, about 1000 mg to about 2400 mg, about 1100 mg to about 2400 mg.
  • 500 mg to about 2400 mg e.
  • the vessels collectively may include 500 to 1800 mg dose of the protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap). In certain embodiments, the vessels collectively may include a 500 mg dose of the protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap). In certain embodiments, the vessels collectively may include a 1200 mg dose of the protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap). In certain embodiments, the vessels collectively may include an 1800 mg dose of the protein of the present disclosure (e.g., anti-PD-L1/TGF ⁇ Trap).
  • the formulation is prepared and packaged as a liquid formulation and stored as about 250 mg/vial to about 1000 mg/vial (e.g., about 250 mg/vial to about 1000 mg/vial, about 250 mg/vial to about 900 mg/vial, about 250 mg/vial to about 800 mg/vial, about 250 mg/vial to about 700 mg/vial, about 250 mg/vial to about 600 mg/vial, about 250 mg/vial to about 500 mg/vial, about 250 mg/vial to about 400 mg/vial, about 250 mg/vial to about 300 mg/vial, about 300 mg/vial to about 1000 mg/vial, about 400 mg/vial to about 1000 mg/vial, about 500 mg/vial to about 1000 mg/vial, about 600 mg/vial to about 1000 mg/vial, about 700 mg/vial to about 1000 mg/vial, about 800 mg/vial to about 1000 mg/vial, or about 900 mg/vial to about 1000 mg/vial).
  • the formulation is a liquid formulation and stored as about 600 mg/vial, or stored as about 250 mg/vial.
  • the vessels collectively may include a dose of about 1200 mg or about 1800 mg of the protein product with a first polypeptide that includes the amino acid sequence of SEQ ID NO: 3, and the second polypeptide that includes the amino acid sequence of SEQ ID NO: 1.
  • the formulation is prepared and packaged as a liquid formulation and stored as about 250 mg/vial to about 1200 mg/vial (e.g., about 250 mg/vial to about 1200 mg/vial, about 250 mg/vial to about 1100 mg/vial, about 250 mg/vial to about 1000 mg/vial, about 250 mg/vial to about 900 mg/vial, about 250 mg/vial to about 800 mg/vial, about 250 mg/vial to about 700 mg/vial, about 250 mg/vial to about 600 mg/vial, about 250 mg/vial to about 500 mg/vial, about 250 mg/vial to about 400 mg/vial, about 250 mg/vial to about 300 mg/vial, about 300 mg/vial to about 1200 mg/vial, about 400 mg/vial to about 1200 mg/vial, about 500 mg/vial to about 1200 mg/vial, about 600 mg/vial to about 1200 mg/vial, about 700 mg/vial to about 1200 mg/vial, about 500
  • the formulation is a liquid formulation and stored as about as about 1200 mg/vial, or stored as about 600 mg/vial, or stored as about 250 mg/vial.
  • the vessels collectively may include about 500 mg, about 525 mg, about 550 mg, about 575 mg, about 600 mg, about 625 mg, about 650 mg, about 675 mg, about 700 mg, about 725 mg, about 750 mg, about 775 mg, about 800 mg, about 825 mg, about 850 mg, about 875 mg, about 900 mg, about 925 mg, about 950 mg, about 975 mg, about 1000 mg, about 1025 mg, about 1050 mg, about 1075 mg, about 1100 mg, about 1125 mg, about 1150 mg, about 1175 mg, about 1200 mg, about 1225 mg, about 1250 mg, about 1275 mg, about 1300 mg, about 1325 mg, about 1350 mg, about 1375 mg, about 1400 mg, about 1425 mg, about 1450 mg, about 14
  • the formulation in the vessels may be a lyophilized formulation or a liquid formulation.
  • the formulation may be packed in kits containing a suitable number of vials. The information on the medication may be included, which are in accordance with approved submission documents.
  • the kit may be shipped in transport cool containers (2° C. to 8° C.) that are monitored with temperature control devices.
  • the formulation may be stored at 2° C. to 8° C. until use.
  • the freeze-dried drug product may be reconstituted with 4.5 mL of water for Injection and diluted with about 0.9% saline solution (sodium chloride injection) while the liquid formulation may be diluted with about 0.9% saline solution.
  • the delivery device is an injector pen.
  • An injector pen is a device designed to allow a user to self-administer a pre-measured dose of a medicament composition subcutaneously or intramuscularly.
  • An injector pen may have a housing, inside of which is a cartridge.
  • the cartridge may have one or several chambers containing medicament compositions or components thereof and is adapted to be attached to a needle assembly. The cartridge can hold either a pre-mixed liquid medicament or a solid medicament and a liquid that are mixed prior to injection.
  • the housing may carry an actuation assembly with a stored energy source, for example, a compressed spring. Activation of the actuation assembly causes a sequence of movements, whereby the needle extends from the injector pen into the user so that the medicament compound is then forced through the needle and into the user. After delivery of the dose of medicament into the injection site, the needle may remain in an extended position. If the injector pen is of the type designed to carry plural components of the medicament composition in separate, sealed compartments, structure may be included that forces the components to mix when the actuation assembly is activated.
  • the antibody-cytokine Trap proteins are generally produced recombinantly, using mammalian cells containing a nucleic acid engineered to express the protein.
  • the anti-PD-L1/TGF ⁇ Trap proteins described in the application can be used to treat cancer or reduce tumor growth in a patient.
  • Exemplary cancers include non-small cell lung cancer, melanoma, pancreatic cancer, colorectal cancer (e.g., pretreated colorectal cancer (CRC)), ovarian cancer, glioblastoma, gastric cancer (e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer), biliary tract cancer, esophageal cancer (squamous cell carcinoma or adenocarcinoma), adenoma of the head or the neck, and squamous carcinoma of the head or the neck.
  • colorectal cancer e.g., pretreated colorectal cancer (CRC)
  • ovarian cancer e.g., glioblastoma
  • gastric cancer e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer
  • biliary tract cancer e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer
  • the cancer or tumor to be treated with an anti-PD-L1/ TGF ⁇ Trap may be selected based on the expression or elevated expression of PD-L1 and TGF ⁇ in the tumor, the correlation of their expression levels with prognosis or disease progression, and preclinical and clinical experience on the sensitivity of the tumor to treatments targeting PD-L1 and TGF ⁇ .
  • Such cancers or tumors include but are not limited to colorectal, breast, ovarian, pancreatic, gastric, prostate, renal, cervical, bladder, head and neck, liver, non-small cell lung cancer, advanced non-small cell lung cancer, melanoma, Merkel cell carcinoma, and mesothelioma.
  • EXAMPLE 1 Packaging of Intravenous Drug Formulation
  • the formulation of anti-PD-L1/TGF ⁇ Trap is prepared as a lyophilized formulation or a liquid formulation.
  • 45 mg of freeze-dried anti- PD-L1/TGF ⁇ Trap is sterilized and stored in one container.
  • Several such containers are then packaged in a kit for delivering a specific body weight independent dose to a subject diagnosed with a cancer or a tumor.
  • the kit contains 12-60 vials.
  • the formulation is prepared and packaged as a liquid formulation and stored as 250 mg/vial to 1000 mg/vial.
  • the formulation is a liquid formulation and stored as 600 mg/vial, or stored as 250 mg/vial.
  • the formulation is used for treating cancer or tumor, for example, non-small cell lung cancer, melanoma, pancreatic cancer, colorectal cancer (e.g., pretreated colorectal cancer (CRC)), ovarian cancer, glioblastoma, gastric cancer (e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer), biliary tract cancer, esophageal cancer (squamous cell carcinoma or adenocarcinoma), adenoma of the head or the neck, and squamous carcinoma of the head or the neck.
  • CRC colorectal cancer
  • ovarian cancer e.g., glioblastoma
  • gastric cancer e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer
  • biliary tract cancer e.g., pretreated recurrent or refractory unresectable Stage IV gastric cancer
  • esophageal cancer
  • a subject diagnosed with such a cancer or tumor is intravenously administered a formulation containing 500 mg to 2000 mg of anti-PD-L1/TGF ⁇ Trap.
  • the subject is intravenously administered 500 mg of anti-PD-L1/TGF ⁇ Trap or 1200 mg of anti- PD-L1/TGF ⁇ Trap.
  • the intravenous administration is from a saline bag, and administration is once in two weeks.
  • the amount of the anti-PD-L1/TGF ⁇ Trap administered to a subject is independent of the subject’s body weight.
  • EXAMPLE 2 BW-Independent Dosing Regimen
  • the BW-independent dose of 500 mg or 1200 mg was administered to subjects with non-small cell lung cancer (NSCLC) once every two weeks. The administration was performed intravenously for about an hour (-10 minutes / +20 minutes, i.e., 50 minutes to 80 minutes).
  • premedication with an antihistamine and with paracetamol (acetaminophen) for example, 25- 50 mg diphenhydramine and 500-650 mg paracetamol [acetaminophen] IV or oral equivalent) approximately 30 to 60 minutes prior to each dose of was administered for the first 2 infusions.
  • paracetamol acetaminophen
  • Preferred subjects had adequate hematological function defined by white blood cell (WBC) count ⁇ 3 ⁇ 109/L with absolute neutrophil count (ANC) ⁇ 1.5 ⁇ 109/L, lymphocyte count ⁇ 0.5 ⁇ 109/L, platelet count ⁇ 120 ⁇ 109/L, and Hgb ⁇ 9 g/ dL (in absence of blood transfusion); adequate hepatic function defined by a total bilirubin level ⁇ 1.5 ⁇ ULN, an AST level ⁇ 2.5 ⁇ ULN, and an ALT level ⁇ 2.5 ⁇ ULN; and adequate renal function defined by an estimated creatinine clearance > 50 mL/min according to the Cockcroft- Gault formula or by measure of creatinine clearance from 24 hour urine collection.
  • WBC white blood cell
  • ANC absolute neutrophil count
  • AST ⁇ 5.0 ⁇ ULN, ALT ⁇ 5.0 ⁇ ULN, and bilirubin ⁇ 3.0 was acceptable.
  • certain subjects had: - Histologically or cytologically confirmed Stage IIIb or IV NSCLC with relapsed, refractory or progressive disease on or after a single line of platinum-based chemotherapy, and no previous treatment with combination immunotherapy.
  • a second-line of systemic treatment including a fluoropyrimidine, oxaliplatin, irinotecan and/or bevacizumab.
  • Triple-negative breast cancer that progressed during or after first-line of
  • Radiotherapy and temozolomide were radiotherapy and temozolomide.
  • SCCHN Squamous Cell Carcinoma Head and Neck
  • Stage III/IV Squamous Cell Carcinoma Head and Neck
  • tumor progression or recurrence within 6 months of last dose of platinum therapy in the adjuvant (i.e. with radiation after surgery), primary (i.e., with radiation), recurrent, or metastatic setting.
  • adenosquamous carcinoma, or adenocarcinoma of the cervix following standard of care treatment with systemic therapy for advanced disease - Histologically or cytologically confirmed recurrent or refractory unresectable Stage IV gastric or gastro-esophageal junctional adenocarcinoma for which no standard therapy exists or standard therapy has failed.
  • EXAMPLE 3 Efficacy Assessments [00238] Tumor response assessment is performed by CT scan or MRI. Scans performed at baseline are repeated at subsequent visits. In general, lesions detected at baseline are followed using the same imaging methodology and preferably the same imaging equipment at subsequent tumor evaluation visits. Skin metastasis can be used as target lesions according to RECIST 1.1 using measurements by caliper, if they fulfill RECIST 1.1 for target lesions.
  • EXAMPLE 4 Treatment of Advanced NSCLC Patients Refractory or Resistant to Prior Treatment with anti-PD-1 or anti-PD-L1 agent [00239] Objective: Histologically confirmed Stage IV, or recurrent NSCLC in patients who received and failed platinum-based chemotherapy as monotherapy and failed with disease progression and have received anti-PD-1 or anti-PD-L1 as monotherapy and failed with disease progression, were selected for treatment with 1200 mg of anti-PD-L1/TGF ⁇ Trap therapy.
  • a sub- cohort of patients with progressive disease (PD) following prior PDx therapy was considered as “primary refractory”, i.e., among these patients disease progression was observed following PDx therapy initiation without any observed benefit from the treatment.
  • Another sub-cohort of the patients was characterized as“acquired resistant”, i.e., the patients’ disease initially responded to prior PDx therapy, but the patients ultimately reverted to disease progression stage.
  • the acquired resistant patients were characterized with BOR of stable disease (SD), partial response (PR) or complete response (CR) to prior PDx therapy before the subsequent disease progression.
  • SD stable disease
  • PR partial response
  • CR complete response
  • anti-PD-L1/TGF ⁇ Trap was found to be an innovative first-in-class bifunctional fusion protein designed to simultaneously target 2 immune suppressive pathways: PD-L1 and TGF- ⁇ . Inhibition of the TGF- ⁇ pathway, thereforeaids in overcoming treatment failure to anti-PD-1/PD-L1 agents.
  • Treatment with anti-PD-L1/TGF ⁇ Trap resulted in initial clinical activity in patients with heavily pre-treated NSCLC with disease primary refractory or acquired resistant to prior treatment with anti-PD-1 or anti-PD-L1 therapy.
  • EXAMPLE 5 Treatment of Pretreated Recurrent or Refractory Stage IV Gastric Cancer Patients
  • Objective Patients with heavily pretreated recurrent or refractory unresectable Stage IV gastric cancer were selected for treatment with 1200 mg of anti-PD-L1/TGF ⁇ Trap therapy and safety and efficacy was assessed.
  • Study Design and Results A total of 31 patients were treated with anti-PD- L1/TGF ⁇ Trap at a dose of 1200 mg every 2 weeks until confirmed progressive disease, unacceptable toxicity, or trial withdrawal. The cohort consisted of a heavily pretreated Asian patient population with 67.7% receiving at least 3 prior anticancer therapies and 29.3% at least 4 prior anticancer therapies.
  • Baseline characteristics of patients are listed in the table 8 below. [00251] Table 8: Patient characteristics of patients are listed in the table 8 below. [00251] Table 8: Patient characteristics
  • anti-PD-L1/TGF ⁇ Trap was found to be an innovative first-in-class bifunctional fusion protein designed to simultaneously target 2 immune suppressive pathways: PD-L1 and TGF- ⁇ . Inhibition of the TGF- ⁇ pathway may aid in overcoming treatment failure to anti–PD-1/PD-L1 agents. Treatment with anti-PD-L1/TGF ⁇ Trap resulted in initial clinical activity in Asian patients with heavily pretreated gastric cancer.
  • EXAMPLE 6 Treatment of Patients with Heavily Pretreated Colorectal Cancer (CRC) [00257] Background and Objective: CRC is respectively the second and third most common cancer in women and men worldwide. Recently, 4 consensus molecular subgroups (CMS) of CRC have been described– including the poor-prognosis, mesenchymal CMS4 group which is characterized by angiogenic, inflammatory, and immunosuppressive qualities. It is
  • TGF- ⁇ may play a role in mediating this immuno-suppressive phenotype providing a rationale for using anti-PD-L1/TGF ⁇ Trap in these patients.
  • Anti ⁇ PD-L1 therapy has shown substantial activity for patients with defective mismatch repair (e.g. microsatellite instability-high (MSI-H)) CRC, however only about 4% of patients with metastatic CRC have MSI-H tumors, and these treatments have had minimal activity in patients with proficient mismatch repair.
  • MSI-H microsatellite instability-high
  • the median duration of treatment was 7.1 weeks (range: 2-38), and as of the data cut-off date at the time of analysis, 2 patients remained on active treatment.
  • Primary endpoint is BOR per RECIST v1.1, secondary endpoints being safety/tolerability.
  • Baseline characteristics of patients are listed in the table below. In summary, this was a heavily pre-treated patient population with 87.5% of patients receiving greater than 3 prior treatment regimens, overall good clinical status (PS 0-1) and included a range of ages and genders. Approximate 34% of tumors were KRAS-mutated, and a majority of patients (81.3%) had ⁇ 1% PD-L1 expression on tumor cells based upon the Dako 73-10 PD-L1 assay.
  • Tumor- sidedness was not prospectively collected in the database, but was determined based upon the patient’s prior cancer surgery history. Using this clinical assessment, 40.6% of tumors were noted to be left sided, 28.1% were right-sided, and 31.3% were unable to be determined based upon available data. [00259] Table 11: Patient characteristics
  • anti-PD-L1/TGF ⁇ Trap was found to be an innovative first-in-class bifunctional fusion protein designed to simultaneously target 2 immune suppressive pathways, TGF- ⁇ and PD-L1.
  • Treatment with anti-PD-L1/TGF ⁇ Trap resulted in initial clinical activity in heavily pretreated patients with advanced CRC; 1 patient had a durable PR; 1 patient had SD; and 27 patients had PD as BOR.
  • the patient with a PR ongoing for 8.3 months had CRC that was MSI, CMS4, KRAS-mutant, and PD-L1+.
  • a second patient remains well without recurrence at 13 months after initial progressive disease.
  • EXAMPLE 7 Establishing Efficacious Dose/Dosing Regimen and Exposure in Humans: preliminary dose-response and exposure-response in 2 nd Line Non Small Cell Lung Cancer (2L NSCLC) following once every 2 weeks (q2w) dosing of anti-PD-L1/TGF ⁇ Trap [00264]
  • Dose-response and exposure-response of the subjects were assessed.
  • ORR overall response rate
  • DNA sequence from the translation initiation codon to the translation stop codon of the anti- PD-L1 lambda light chain is the leader sequence preceding the VL is the signal peptide from urokinase plasminogen activator
  • IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQE VCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS DECNDNIIFSEEYNTSNPD SEQ ID NO: 11
  • a method of treating cancer or inhibiting tumor growth in a subject in need thereof comprising administering to the subject a dose of at least 500 mg of a protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor ⁇ Receptor II (TGF ⁇ RII), or a fragment thereof, capable of binding Transforming Growth Factor ⁇ (TGF ⁇ ), wherein the second polypeptide comprises at least a variable region of a light chain of an antibody that binds PD-L1, and wherein the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1.
  • the first polypeptide comprises the amino acid
  • the second polypeptide comprises the amino acid sequence of SEQ ID NO: 1.
  • the method of claim 1 or 2 wherein the dose is 500 mg to 2400 mg. 4.
  • the method of any one of claims 1-6, wherein the dose is administered once every two weeks or once every three weeks. 8.
  • the protein is administered by
  • intravenous administration 9. The method of claim 8, wherein the intravenous administration is performed with a prefilled bag, a prefilled pen, or a prefilled syringe comprising a formulation comprising the protein. 10. The method of claim 9, wherein the bag is connected to a channel comprising a tube and/or a needle. 11.
  • the cancer or tumor is selected from the group consisting of: non-small cell lung cancer, melanoma, pancreatic cancer, colorectal cancer, ovarian cancer, glioblastoma, gastric cancer, biliary tract cancer, esophageal cancer (squamous cell carcinoma or adenocarcinoma), adenoma of the head or the neck, and squamous carcinoma of the head or the neck. 12.
  • the cancer or tumor is selected from the group consisting of: colorectal, breast, ovarian, pancreatic, gastric, prostate, renal, cervical, myeloma, lymphoma, leukemia, thyroid, endometrial, uterine, bladder, neuroendocrine, head and neck, liver, nasopharyngeal, testicular, small cell lung cancer, non-small cell lung cancer, melanoma, basal cell skin cancer, squamous cell skin cancer, dermatofibrosarcoma protuberans, Merkel cell carcinoma, glioblastoma, glioma, sarcoma, mesothelioma, and myelodysplastic syndromes.
  • the tumor is an advanced solid tumor.
  • the tumor is refractory and/or resistant to prior
  • An intravenous drug delivery formulation comprising 500 mg– 2400 mg of a protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor ⁇ Receptor II (TGF ⁇ RII), or a fragment thereof, capable of binding Transforming Growth Factor ⁇ (TGF ⁇ ), wherein the second polypeptide comprises at least a variable region of a light chain of an antibody that binds PD-L1, and wherein the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1.
  • PD-L1 Human protein Programmed Death Ligand 1
  • TGF ⁇ RII human Transforming Growth Factor ⁇ Receptor II
  • TGF ⁇ Transforming Growth Factor ⁇
  • the second polypeptide comprises at least a
  • 21. The intravenous drug delivery formulation of claim 20, wherein the bag is connected to a channel comprising a tube and/or a needle.
  • a drug delivery device comprising a formulation comprising 500 mg– 2400 mg of a protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor ⁇ Receptor II (TGF ⁇ RII), or a fragment thereof, capable of binding Transforming Growth Factor ⁇ (TGF ⁇ ), wherein the second polypeptide comprises at least a variable region of a light chain of an antibody that binds PD-L1, and wherein the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1.
  • the drug delivery device of claim 23 or 24 comprising 1200 mg of the protein.
  • the drug delivery device of claim 23 or 24 comprising 1200 mg to 2400 mg of the protein.
  • the drug delivery device of claim 23 or 24 comprising 1800 mg of the protein.
  • a kit comprising one or more vessels collectively comprising a formulation comprising 500 mg– 2400 mg of a protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises: (a) at least a variable region of a heavy chain of an antibody that binds to human protein Programmed Death Ligand 1 (PD-L1); and (b) human Transforming Growth Factor ⁇ Receptor II (TGF ⁇ RII), or a fragment thereof, capable of binding Transforming Growth Factor ⁇ (TGF ⁇ ), wherein the second polypeptide comprises at least a variable region of a light chain of an antibody that binds PD-L1, and wherein the heavy chain of the first polypeptide and the light chain of the second polypeptide, when combined, form an antigen binding site that binds PD-L1.
  • PD-L1 Human protein Programmed Death Ligand 1
  • TGF ⁇ RII human Transforming Growth Factor ⁇ Receptor II
  • TGF ⁇ Transforming Growth Factor ⁇
  • the kit of claim 30 wherein the first polypeptide comprises the amino acid sequence of SEQ ID NO: 3, and the second polypeptide comprises the amino acid sequence of SEQ ID NO: 1.
  • the vessels collectively comprise 1200 mg of the protein.
  • 33. The kit of claim 30 or 31, wherein the vessels collectively comprise 1200 to 2400 mg of the protein.
  • 35. The kit of any one of claims 30-34, wherein the formulation is a lyophilized formulation or a liquid formulation. 36.
  • the intravenous drug delivery formulation, the drug delivery device, or the kit of claim 36 wherein the cancer or tumor is selected from the group consisting of: colorectal, breast, ovarian, pancreatic, gastric, prostate, renal, cervical, myeloma, lymphoma, leukemia, thyroid, endometrial, uterine, bladder, neuroendocrine, head and neck, liver, nasopharyngeal, testicular, small cell lung cancer, non-small cell lung cancer, melanoma, basal cell skin cancer, squamous cell skin cancer, dermatofibrosarcoma protuberans, Merkel cell carcinoma, glioblastoma, glioma, sarcoma, mesothelioma, and myelodysplastic syndromes.
  • the cancer or tumor is selected from the group consisting of: colorectal, breast, ovarian, pancreatic, gastric, prostate, renal, cervical, myeloma, lymphoma, leuk
  • the intravenous drug delivery formulation, the drug delivery device, or the kit of claim 36 wherein the tumor is an advanced solid tumor.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Dermatology (AREA)
  • Epidemiology (AREA)
  • Hematology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Endoscopes (AREA)
PCT/US2018/012604 2017-01-07 2018-01-05 Dosing regimens and dosage forms for targeted tgf-b inhibition Ceased WO2018129331A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
KR1020197022795A KR20190102059A (ko) 2017-01-07 2018-01-05 표적화된 TGF-β 억제를 위한 투약 레지멘 및 투여 형태
RU2019124875A RU2019124875A (ru) 2017-01-07 2018-01-05 Схемы дозирования и лекарственные формы для направленного ингибирования tgf-b
CN201880006085.0A CN110198738A (zh) 2017-01-07 2018-01-05 用于靶向的TGF-β抑制的给药方案和剂型
MX2019008001A MX2019008001A (es) 2017-01-07 2018-01-05 Regimenes de dosificacion y formas de dosificacion para inhibicion dirigida de factor beta de crecimiento transformante.
CA3048646A CA3048646A1 (en) 2017-01-07 2018-01-05 Dosing regimens and dosage forms for targeted tgf-b inhibition
SG11201906157YA SG11201906157YA (en) 2017-01-07 2018-01-05 Dosing regimens and dosage forms for targeted tgf-b inhibition
AU2018205233A AU2018205233A1 (en) 2017-01-07 2018-01-05 Dosing regimens and dosage forms for targeted TGFβ inhibition
BR112019013924-9A BR112019013924A2 (pt) 2017-01-07 2018-01-05 Regimes de dosagem e formas de dosagem para inibição de tgf-beta direcionada
EP18736497.1A EP3565599A4 (en) 2017-01-07 2018-01-05 DOSAGE PATTERNS AND DOSAGE FORMS FOR TARGETED INHIBITION OF TGF-B
JP2019536228A JP2020514290A (ja) 2017-01-07 2018-01-05 標的tgf−β阻害のための投薬計画及び投薬形態
US16/460,792 US20190330375A1 (en) 2017-01-07 2019-07-02 Dosing regimens and dosage forms for targeted tgf-b inhibition
PH12019501574A PH12019501574A1 (en) 2017-01-07 2019-07-03 Dosing regimens and dosage forms for targeted tgf-b inhibition
IL267856A IL267856A (en) 2017-01-07 2019-07-04 Compositions comprising a bifunctional protein targeting pd-l1 and tgfb

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762443698P 2017-01-07 2017-01-07
US62/443,698 2017-01-07
US201762581978P 2017-11-06 2017-11-06
US62/581,978 2017-11-06

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/460,792 Continuation US20190330375A1 (en) 2017-01-07 2019-07-02 Dosing regimens and dosage forms for targeted tgf-b inhibition

Publications (1)

Publication Number Publication Date
WO2018129331A1 true WO2018129331A1 (en) 2018-07-12

Family

ID=62791283

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/012604 Ceased WO2018129331A1 (en) 2017-01-07 2018-01-05 Dosing regimens and dosage forms for targeted tgf-b inhibition

Country Status (15)

Country Link
US (1) US20190330375A1 (https=)
EP (1) EP3565599A4 (https=)
JP (1) JP2020514290A (https=)
KR (1) KR20190102059A (https=)
CN (1) CN110198738A (https=)
AU (1) AU2018205233A1 (https=)
BR (1) BR112019013924A2 (https=)
CA (1) CA3048646A1 (https=)
CL (1) CL2019001871A1 (https=)
IL (1) IL267856A (https=)
MX (1) MX2019008001A (https=)
PH (1) PH12019501574A1 (https=)
RU (1) RU2019124875A (https=)
SG (1) SG11201906157YA (https=)
WO (1) WO2018129331A1 (https=)

Cited By (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020009992A1 (en) * 2018-07-02 2020-01-09 Merck Patent Gmbh Combination therapy with targeted tgf-b inhibition for treatment of advanced non-small cell lung cancer
EP3689905A2 (en) 2019-01-30 2020-08-05 Scholar Rock, Inc. Ltbp complex-specific inhibitors of tgf-beta and uses thereof
WO2020248926A1 (zh) * 2019-06-10 2020-12-17 山东博安生物技术有限公司 抗PDL1和TGFβ的双功能融合蛋白及其用途
US10981973B2 (en) 2013-08-22 2021-04-20 Acceleron Pharma Inc. Methods of treating a sclerotic disorder by administering a transforming growth factor beta receptor type II fusion polypeptide
US11021527B2 (en) 2017-05-04 2021-06-01 Acceleron Pharma Inc. Transforming growth factor beta receptor type II fusion polypeptides
WO2021142427A1 (en) 2020-01-11 2021-07-15 Scholar Rock, Inc. TGFβ INHIBITORS AND USE THEREOF
WO2021142448A2 (en) 2020-01-11 2021-07-15 Scholar Rock,Inc. Tgf-beta inhibitors and use thereof
KR20210090643A (ko) * 2018-11-09 2021-07-20 지앙수 헨그루이 메디슨 컴퍼니 리미티드 TGF-β 수용체 융합 단백질 약학적 조성물 및 이의 용도
WO2021164701A1 (en) * 2020-02-18 2021-08-26 Nanjing GenScript Biotech Co., Ltd. Fusion proteins and uses thereof
WO2021169986A1 (en) * 2020-02-25 2021-09-02 Wuxi Biologics (Shanghai) Co. Ltd. A bifunctional fusion protein and uses thereof
US11203624B2 (en) 2015-08-04 2021-12-21 Acceleron Pharma Inc. Method for treating myelofibrosis comprising administering a transforming growth factor beta type II receptor antagonist
EP3810654A4 (en) * 2018-06-22 2022-04-20 Merck Patent GmbH DOSAGE REGIMEN FOR TARGETED INHIBITION OF TGF-? FOR USE IN THE TREATMENT OF BILIARY TRACT CANCER
WO2022188689A1 (zh) 2021-03-08 2022-09-15 南京金斯瑞生物科技有限公司 使用双重病毒载体系统递送抗体
WO2022204581A2 (en) 2021-03-26 2022-09-29 Scholar Rock, Inc. Tgf-beta inhibitors and use thereof
US20220362104A1 (en) * 2019-10-24 2022-11-17 Amgen Inc. Systems and approaches for drug delivery
WO2022256723A2 (en) 2021-06-03 2022-12-08 Scholar Rock, Inc. Tgf-beta inhibitors and therapeutic use thereof
US11535669B2 (en) 2018-07-09 2022-12-27 Precigen, Inc. Fusion constructs and methods of using thereof
JP2023501971A (ja) * 2019-11-01 2023-01-20 アレス トレーディング ソシエテ アノニム 癌の治療のための、放射線療法と共に用いるPD-1、TGFβ、及びATMの組み合わせ阻害
JP2023507620A (ja) * 2019-12-20 2023-02-24 アレス トレーディング ソシエテ アノニム IgG:TGFβRII融合タンパク質組成物
EP4054617A4 (en) * 2019-11-05 2023-12-27 Acceleron Pharma Inc. Treatments for systemic sclerosis
EP4073124A4 (en) * 2019-12-11 2024-01-24 Wuxi Biologics Ireland Limited Bi-functional antibody against pd-l1 and tgfbeta
WO2024187051A1 (en) 2023-03-07 2024-09-12 Scholar Rock, Inc. Tgf-beta inhibitors for use for treating resistant or unresponsive cancer in patients
US12194094B2 (en) 2020-07-10 2025-01-14 Precigen, Inc. Fusion constructs and methods of using thereof
WO2025240343A1 (en) 2024-05-13 2025-11-20 Scholar Rock, Inc. Tgf-beta inhibitors for treating cancer

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112574314A (zh) * 2019-09-30 2021-03-30 和铂医药(苏州)有限公司 一种融合蛋白及其应用
CN111118064B (zh) * 2019-12-24 2022-10-25 华南理工大学 一种精子生成障碍动物模型及其制备方法与应用
CN116323657B (zh) * 2020-09-24 2023-12-08 上海齐鲁制药研究中心有限公司 同时靶向PD-L1和TGFβ的双功能分子及其医药用途
PE20241477A1 (es) * 2021-11-19 2024-07-17 Merus Nv Unidades de union multiespecificas que comprenden los dominios de union a pd-1 y tgf-brii

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5785682A (en) * 1995-03-22 1998-07-28 Abbott Laboratories Pre-filled syringe drug delivery system
US20150225483A1 (en) * 2014-02-10 2015-08-13 Merck Patent Gmbh TARGETED TGFß INHIBITION
US20160106835A1 (en) * 2013-05-31 2016-04-21 Merck Sharp & Dohme Corp. Combination therapies for cancer
US20160168260A1 (en) * 2012-04-30 2016-06-16 Biocon Limited Targeted/immunomodulatory fusion proteins and methods for making same
US20160340430A1 (en) * 2010-03-05 2016-11-24 The Johns Hopkins University Compositions and methods for targeted immunomodulatory antibodies and fusion proteins

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130110045A1 (en) * 2011-10-31 2013-05-02 Ming-Yuan Wu Single use intravenous therapy administering device with needle safety covers
EP4245376A3 (en) * 2014-10-14 2023-12-13 Novartis AG Antibody molecules to pd-l1 and uses thereof
US10828353B2 (en) * 2015-01-31 2020-11-10 The Trustees Of The University Of Pennsylvania Compositions and methods for T cell delivery of therapeutic molecules
EP3770171A1 (en) * 2015-04-03 2021-01-27 XOMA Technology Ltd. Treatment of cancer using inhibitors of tgf-beta and pd-1
ES2835866T5 (es) * 2015-05-12 2024-12-02 Hoffmann La Roche Procedimientos terapéuticos y de diagnóstico para el cáncer

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5785682A (en) * 1995-03-22 1998-07-28 Abbott Laboratories Pre-filled syringe drug delivery system
US20160340430A1 (en) * 2010-03-05 2016-11-24 The Johns Hopkins University Compositions and methods for targeted immunomodulatory antibodies and fusion proteins
US20160168260A1 (en) * 2012-04-30 2016-06-16 Biocon Limited Targeted/immunomodulatory fusion proteins and methods for making same
US20160106835A1 (en) * 2013-05-31 2016-04-21 Merck Sharp & Dohme Corp. Combination therapies for cancer
US20150225483A1 (en) * 2014-02-10 2015-08-13 Merck Patent Gmbh TARGETED TGFß INHIBITION

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3565599A4 *

Cited By (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10981973B2 (en) 2013-08-22 2021-04-20 Acceleron Pharma Inc. Methods of treating a sclerotic disorder by administering a transforming growth factor beta receptor type II fusion polypeptide
US11008377B2 (en) 2013-08-22 2021-05-18 Acceleron Pharma Inc. Methods of treating a fibrotic disorder by administering transforming growth factor beta receptor II fusion polypeptides
US11203624B2 (en) 2015-08-04 2021-12-21 Acceleron Pharma Inc. Method for treating myelofibrosis comprising administering a transforming growth factor beta type II receptor antagonist
US12195519B2 (en) 2017-05-04 2025-01-14 Acceleron Pharma Inc. Transforming growth factor-beta (TGF-beta) receptor type II fusion polypeptides
US11021527B2 (en) 2017-05-04 2021-06-01 Acceleron Pharma Inc. Transforming growth factor beta receptor type II fusion polypeptides
EP3810654A4 (en) * 2018-06-22 2022-04-20 Merck Patent GmbH DOSAGE REGIMEN FOR TARGETED INHIBITION OF TGF-? FOR USE IN THE TREATMENT OF BILIARY TRACT CANCER
WO2020009992A1 (en) * 2018-07-02 2020-01-09 Merck Patent Gmbh Combination therapy with targeted tgf-b inhibition for treatment of advanced non-small cell lung cancer
US11535669B2 (en) 2018-07-09 2022-12-27 Precigen, Inc. Fusion constructs and methods of using thereof
JP7436477B2 (ja) 2018-11-09 2024-02-21 ジエンス ヘンルイ メデイシンカンパニー リミテッド TGF-β受容体融合タンパク質医薬組成物およびその使用
TWI829799B (zh) * 2018-11-09 2024-01-21 大陸商江蘇恆瑞醫藥股份有限公司 一種TGF-β受體融合蛋白醫藥組成物及其用途
US12559539B2 (en) * 2018-11-09 2026-02-24 Jiangsu Hengrui Medicine Co., Ltd. TGF-beta receptor fusion protein pharmaceutical composition and use thereof
AU2019374363B2 (en) * 2018-11-09 2025-12-18 Jiangsu Hengrui Medicine Co., Ltd. TGF-β receptor fusion protein pharmaceutical composition and use thereof
KR102881644B1 (ko) * 2018-11-09 2025-11-06 지앙수 헨그루이 파마슈티컬스 컴퍼니 리미티드 TGF-β 수용체 융합 단백질 약학적 조성물 및 이의 용도
US20220017601A1 (en) * 2018-11-09 2022-01-20 Jiangsu Hengrui Medicine Co., Ltd. TGF-beta RECEPTOR FUSION PROTEIN PHARMACEUTICAL COMPOSITION AND USE THEREOF
JP2022512862A (ja) * 2018-11-09 2022-02-07 ジエンス ヘンルイ メデイシンカンパニー リミテッド TGF-β受容体融合タンパク質医薬組成物およびその使用
KR20210090643A (ko) * 2018-11-09 2021-07-20 지앙수 헨그루이 메디슨 컴퍼니 리미티드 TGF-β 수용체 융합 단백질 약학적 조성물 및 이의 용도
EP3878461A4 (en) * 2018-11-09 2022-08-17 Jiangsu Hengrui Medicine Co., Ltd. PHARMACEUTICAL COMPOSITION OF TGF-BETA RECEPTOR FUSION PROTEIN AND USE THEREOF
EP3689905A2 (en) 2019-01-30 2020-08-05 Scholar Rock, Inc. Ltbp complex-specific inhibitors of tgf-beta and uses thereof
WO2020160291A2 (en) 2019-01-30 2020-08-06 Scholar Rock, Inc. LTBP COMPLEX-SPECIFIC INHIBITORS OF TGFβ AND USES THEREOF
WO2020248926A1 (zh) * 2019-06-10 2020-12-17 山东博安生物技术有限公司 抗PDL1和TGFβ的双功能融合蛋白及其用途
US12325748B2 (en) 2019-06-10 2025-06-10 Shandong Boan Biotechnology Co., Ltd. Bifunctional fusion protein against PDL1 and TGFβ and use thereof
US20220362104A1 (en) * 2019-10-24 2022-11-17 Amgen Inc. Systems and approaches for drug delivery
JP2023501971A (ja) * 2019-11-01 2023-01-20 アレス トレーディング ソシエテ アノニム 癌の治療のための、放射線療法と共に用いるPD-1、TGFβ、及びATMの組み合わせ阻害
US12527839B2 (en) 2019-11-05 2026-01-20 Acceleron Pharma Inc. Treatments for systemic sclerosis
EP4054617A4 (en) * 2019-11-05 2023-12-27 Acceleron Pharma Inc. Treatments for systemic sclerosis
EP4073124A4 (en) * 2019-12-11 2024-01-24 Wuxi Biologics Ireland Limited Bi-functional antibody against pd-l1 and tgfbeta
JP7730817B6 (ja) 2019-12-20 2025-09-26 アレス トレーディング ソシエテ アノニム IgG:TGFβRII融合タンパク質組成物
JP2023507620A (ja) * 2019-12-20 2023-02-24 アレス トレーディング ソシエテ アノニム IgG:TGFβRII融合タンパク質組成物
JP7730817B2 (ja) 2019-12-20 2025-08-28 アレス トレーディング ソシエテ アノニム IgG:TGFβRII融合タンパク質組成物
WO2021142427A1 (en) 2020-01-11 2021-07-15 Scholar Rock, Inc. TGFβ INHIBITORS AND USE THEREOF
WO2021142448A2 (en) 2020-01-11 2021-07-15 Scholar Rock,Inc. Tgf-beta inhibitors and use thereof
WO2021164701A1 (en) * 2020-02-18 2021-08-26 Nanjing GenScript Biotech Co., Ltd. Fusion proteins and uses thereof
WO2021169986A1 (en) * 2020-02-25 2021-09-02 Wuxi Biologics (Shanghai) Co. Ltd. A bifunctional fusion protein and uses thereof
US12194094B2 (en) 2020-07-10 2025-01-14 Precigen, Inc. Fusion constructs and methods of using thereof
WO2022188689A1 (zh) 2021-03-08 2022-09-15 南京金斯瑞生物科技有限公司 使用双重病毒载体系统递送抗体
WO2022204581A2 (en) 2021-03-26 2022-09-29 Scholar Rock, Inc. Tgf-beta inhibitors and use thereof
WO2022256723A2 (en) 2021-06-03 2022-12-08 Scholar Rock, Inc. Tgf-beta inhibitors and therapeutic use thereof
WO2024187051A1 (en) 2023-03-07 2024-09-12 Scholar Rock, Inc. Tgf-beta inhibitors for use for treating resistant or unresponsive cancer in patients
WO2025240343A1 (en) 2024-05-13 2025-11-20 Scholar Rock, Inc. Tgf-beta inhibitors for treating cancer

Also Published As

Publication number Publication date
MX2019008001A (es) 2019-09-09
BR112019013924A2 (pt) 2020-02-11
CL2019001871A1 (es) 2019-12-13
JP2020514290A (ja) 2020-05-21
CN110198738A (zh) 2019-09-03
KR20190102059A (ko) 2019-09-02
SG11201906157YA (en) 2019-08-27
PH12019501574A1 (en) 2019-11-04
IL267856A (en) 2019-09-26
RU2019124875A (ru) 2021-02-08
CA3048646A1 (en) 2018-07-12
EP3565599A1 (en) 2019-11-13
EP3565599A4 (en) 2020-07-01
US20190330375A1 (en) 2019-10-31
RU2019124875A3 (https=) 2021-07-08
AU2018205233A1 (en) 2019-07-11

Similar Documents

Publication Publication Date Title
EP3565599A1 (en) Dosing regimens and dosage forms for targeted tgf-b inhibition
SG10202111905PA (en) Stable formulations of anti-tigit antibodies alone and in combination with programmed death receptor 1 (pd-1) antibodies and methods of use thereof
BR112019022695A2 (pt) Formulações estáveis de anticorpos anti-ctla4 isolados e em combinação com anticorpos do receptor de morte programada 1 (pd-1) e métodos de uso das mesmas
JP7448552B2 (ja) がんの併用療法
US20210113656A1 (en) Treatment of stage iii nsclc and mitigation of pathological conditions associated with the treatment
US20210061899A1 (en) Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naïve subjects
US20210115145A1 (en) Combination therapy with targeted tgf-b inhibition for treatment of advanced non-small cell lung cancer
US20210214446A1 (en) Dosing regimens for targeted tgf-b inhibition for use in treating biliary tract cancer
HK40012523A (en) DOSING REGIMENS AND DOSAGE FORMS FOR TARGETED TGF-β INHIBITION

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18736497

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3048646

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019536228

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018205233

Country of ref document: AU

Date of ref document: 20180105

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019013924

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20197022795

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018736497

Country of ref document: EP

Effective date: 20190807

ENP Entry into the national phase

Ref document number: 112019013924

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190704

WWW Wipo information: withdrawn in national office

Ref document number: 754845

Country of ref document: NZ