WO2018054940A1 - Diagnostic anti-pd-l1 antibody and use thereof - Google Patents
Diagnostic anti-pd-l1 antibody and use thereof Download PDFInfo
- Publication number
- WO2018054940A1 WO2018054940A1 PCT/EP2017/073712 EP2017073712W WO2018054940A1 WO 2018054940 A1 WO2018054940 A1 WO 2018054940A1 EP 2017073712 W EP2017073712 W EP 2017073712W WO 2018054940 A1 WO2018054940 A1 WO 2018054940A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- antigen
- binding fragment
- sample
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
- G01N33/5759—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/10—Immunoglobulins specific features characterized by their source of isolation or production
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/54—F(ab')2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
- G01N2333/70532—B7 molecules, e.g. CD80, CD86
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70596—Molecules with a "CD"-designation not provided for elsewhere in G01N2333/705
Definitions
- the present invention pertains to the field of cancer diagnostics, in particular to the use of a diagnostic antibody to detect the presence of a PD-L1 epitope in a tumor sample for in vitro diagnosis.
- PD-L1 Programmed cell death 1 ligand 1 also known as cluster of differentiation (CD274) or B7 homolog 1 (B7-H1 ) is a protein that in humans is encoded by the CD274 gene and is, next to PD-L2 (CD273), one of the ligands of PD-1 (CD279).
- PD-L1 is a 40kDa type 1 transmembrane protein which is expressed on many hematopoietic cells, including dendritic cells, macrophages, mesenchymal stem cells and bone marrow-derived mast cells.
- PD-L1 is found to be inducibly expressed on epithelial and endothelial cells through the action of interferons. Sites of immune privilege such as syncytiotrophoblats in the placenta and in the retina were found to constitutively express PD-L1.
- PD-L1 in the placenta increases at the beginning of the second trimester, is upregulated by increased oxygen and is rapidly lost with low oxygen concentrations.
- PD-1-PD-L pathway regulates the balance between the stimulatory and inhibitory signals needed for effective immune responses to microbes and maintenance of self-tolerance, respectively.
- Many microorganisms that cause chronic infection exploit the PD-1— PD-L1 pathway to evade host immune effector mechanisms.
- the PD-PD-L1 pathway is also thought to regulate immune- mediated tissue damage during viral infection, since PD-1 null mice show increased liver damage upon clearance of adenovirus compared to wild type mice, which is thought to be caused by highly active and aggressive T-cells.
- This immunosuppressive mechanism can be hijacked by PD-L1 positive tumor cells eventually leading to the escape of tumors from the elimination by the immune system.
- Inhibiting the PD- 1/PD-L1 interaction by means of a monoclonal antibody provides a promising concept for the treatment of tumors with PD-L1 expression.
- Clinical trials of blocking monoclonal antibodies against PD-1 and PD-L1 are currently ongoing for patients suffering from various malignancies.
- PD-L1 expression is a predictive marker of clinical response for certain cancer types and a correlation biomarker for others (Gandini et al., Crit Rev Oncol Hematol. 2016 Apr; 100:88-98).
- metastatic melanoma for example, PD-L1 expression in tumor tissue is associated with a significant better prognosis, as PD-L1 positive patients receiving anti-PD-L1 therapy show a 53% reduction in mortality.
- Detection and scoring of PD-L1 expression in tumor tissue samples is usually done by means of immunohistochemistry on frozen or formalin-fixed, paraffin-embedded (FFPE) tumor tissue sections. Scoring of PD-L1 expression can done using different methodologies: One approach for example employed a binary end-point scoring of a specimen of being positive or negative for PD-L1 expression, with a positive result defined in terms of the percentage of tumor cells that exhibited histologic evidence of cell-surface membrane staining. Two different cut-off values of 1 % and 5% of total tumor cells have been used at which a tumor specimen was scored as PD-L1 positive (Cancer.
- PD-L1 expression in tumor specimens has also been quantified by scoring both, tumor cells and tumor-infiltrating immune cells that display a membranous staining, compared to tumor cells which showed both, membranous and a prominent cytoplasmic staining. Specimen scoring based on PD-L1 expression was subsequently done, whereby IHC scores of 0, 1 , 2, or 3 were given.
- a specimen was scored with "0” if less than 1 % of the cells were PD-L1 positive, “1 " for more than 1 %, but less than 5%, "2" if more than 5%, but less than 10%, or "3” if more than 10% of the cells were PD-L1 positive (Herbst et al. Nature. 2014 Nov 27;515(7528):563-7).
- the present inventors have surprisingly found that an antibody or antigen-binding fragments thereof directed against an epitope comprised in the amino acid sequence according to SEQ ID NO:1 binds to human PD-L1 with high specificity and reproducibility.
- the present invention provides an antibody or antigen binding fragments thereof that binds to an epitope comprised in the amino acid sequence according to SEQ ID NO: 1 with high specificity and yields reproducible results, whereby the antibody or antigen- binding fragment thereof comprises at least three amino acid sequences of SEQ ID NO:3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 in its light chain sequence at least three amino acid sequences of SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14 in their heavy chain sequence.
- the inventive antibody or antigen-binding fragment thereof may according to one embodiment be a Fab fragment.
- the inventive antigen-binding fragment is a F(ab')2 fragment. According to one embodiment the inventive antigen-binding fragment is a Fab' fragment. In one embodiment the inventive antibody is a scFv. According to one embodiment the inventive antibody is a di-scFv. According to one embodiment the inventive antibody is a monoclonal antibody.
- the inventive antibody is an IgG type antibody.
- inventive antibody light chain or antigen binding fragment thereof comprises all of SEQ ID NO:3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8.
- the heavy chain of the inventive antibody or antigen binding fragment thereof comprises all of SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, .SEQ ID NO: 13, SEQ ID NO: 14.
- the inventive antibody comprises a heavy chain or antigen-binding fragment thereof comprising the amino acid sequence according to SEQ ID NO: 1 10 and a light chain or antigen-binding fragment thereof comprising the amino acid sequence according to SEQ ID NO: 1 1 1.
- the light chain of the inventive antibody comprises the amino acid sequence according to SEQ ID NO: 15 and the heavy chain comprises the amino acid sequence according to SEQ ID NO: 16.
- inventive antibody light chain comprises the amino acid sequence according to SEQ ID NO: 1 14 and the antibody heavy chain comprises the amino acid sequence according to SEQ ID NO: 1 15.
- the inventive antibody is a rabbit antibody, or a rabbit-derived antibody.
- inventive antibody or antigen-binding fragment thereof as disclosed above is further coupled to a detectable label.
- the detectable label of the inventive antibody or antigen-binding fragment thereof is one of an enzyme, or fluorophore, or enzyme substrate.
- the inventive antibody or antigen-binding fragment thereof as disclosed above is for use in detecting the presence or expression of an epitope comprised in SEQ ID NO: 1 in a sample, which according to one embodiment is a biological sample, preferably, a tissue sample, fixed tissue sample, or a formaldehyde-fixed paraffin-embedded (FFPE) tissue, more preferably, a tumor-derived formaldehyde-fixed paraffin-embedded (FFPE) tissue.
- FFPE formaldehyde-fixed paraffin-embedded
- the detection of the presence or absence of an epitope comprised in SEQ ID NO: 1 as disclosed above is done by means of flow cytometry, ELISA, or Western blotting using the inventive antibody or antigen-binding fragment thereof as disclosed above.
- the detection of the presence or expression of an epitope comprised in SEQ ID NO: 1 using the inventive antibody or antigen-binding fragment thereof as disclosed above is done by means of immunohistochemistry (IHC).
- the present invention provides for a method of detecting the presence or expression of human PD-L1 or any fragment thereof in a sample which comprises the amino acid sequence according to SEQ ID NO: 1 whereby the inventive method comprises the step of contacting the sample with the inventive antibody or antigen-binding fragment thereof and detecting the presence of bound antibody or antigen binding fragment thereof.
- the inventive in vitro method as disclosed above is used on a biological sample, tissue sample, a fixed tissue sample, preferably a formaldehyde-fixed paraffin- embedded (FFPE) tissue sample, more preferably a formaldehyde-fixed paraffin-embedded (FFPE) tumor tissue sample.
- FFPE formaldehyde-fixed paraffin- embedded
- the sample used in the inventive in vitro methood as disclosed above is derived from a subject having, or at risk of cancer, T-cell dysfunction, acute or chronic infection or tumor immunity.
- the present invention pertains to the use of the inventive antibody or antigen-binding fragment as disclosed above in the presence or expression of an epitope comprised in SEQ ID NO: 1 in a sample.
- the present invention provides an isolated polynucleotide encoding the inventive antibody or antigen binding fragment thereof as disclosed above.
- the present invention provides an expression vector which comprises the the polynucleotide encoding the inventive antibody or antigen-binding fragment thereof.
- the present invention provides for an expression vector as disclosed above for use in producing the inventive antibody.
- the present invention provides at least one host cell comprising at least one expression vector according to the invention.
- the present invention provides at least one host cell according to the invention for use in the manufacture the inventive antibody.
- the present invention provides a method of treating cancer in patient which comprises the steps of detecting the presence or expression of human PD-L1 in a sample from said patient using the inventive anti-PD-L1 antibody as disclosed above, comparing the PD-L1 expression in the patient sample to a reference sample and administration of an immune checkpoint inhibitor (e.g. an anti-PD-L1 or anti-PD-1 antibody) to the patient if the PD-L1 expression in the patient sample is increased compared to the reference sample.
- an immune checkpoint inhibitor e.g. an anti-PD-L1 or anti-PD-1 antibody
- the inventive antibody (MKP1 A07310) as well as one antibody directed against an extracellular epitope of human PD-L1 (MKP1 B19610) were characterized using MKP1 A7310 in a concentration of and MKP1 B19610 at three different concentrations (2 g/m ⁇ , 5 ⁇ g ml and 10 g/ml) on a cancer cell line array out of 70 cell lines to assess and compare their respective binding characteristics and to determine the optimum working concentration for further studies.
- the cancer cell line array (CAX09_70_MB, manufactured by Multiblock GmbH and Zytomed Systems GmbH) was used for the assessment of antibody properties in I HC.
- the cancer cell lines that were used for the manufacture of the custom cancer cell line array were fixed in phosphate buffered 4% paraformaldehyde, pH 7 over 16 to 48 hours at room temperature and subsequently embedded in paraffin.
- MKP1 A07310 Characterization of the inventive antibody (MKP1 A07310, marked by "#") and one antibody directed against an extracellular epitope of human PD-L1 (MKP1 B19610) on the cancer cell line array CAX09_70 were tested with MKP1A7310 at a concentration of ⁇ g/ml and MKP1 B19610 at a concentration of 10 ⁇ / ⁇ .
- Figure 7 (A) IHC detection of PD-L1 positive cells using the inventive antibody with DAB as chromogen (right image); detection of chromogen by computer software (middle image); detection of blue staining of nuclei and cytoplasm (right image). Arrows indicate positive cells. (B) IHC staining on positive and negative control tissues using the inventive antibody MKP1 A07310 at a concentration of 1 ⁇ g ml.
- Figure 8 (A) Immunohistochemical using the inventive antibody MKP1A07310 on FFPE tissue of the xenograft tissue microarray TMA_Xenos_12 at a concentration of 2 ⁇ g ml.
- FIG 12 Correlation of IHC results using MKP1 B19610 on FFPE cancer cell lines stained using the Discovery XT® System (Ventana) and the AutostainerLink system (DAKO).
- A results of the IHC runs using MKP1 B19610 at low and high pH using the different IHC platforms and concentratins as indicated plotted against each other.
- B Statistical analysis of the diagrams, with Pearson correlation coefficients of 0.6186 ⁇ g/ml, high pH), 0.6969 (I pg/ml, high pH) and at low pH 0.4309 (5Mg/ml), 0.6631 ⁇ g/ml).
- DAKO AutostainerLink
- KQLIYQAS LASGVSSRFSGSGSGTQFTL I SDVVCDDAATYYCL GGVSGGPYPFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIV CVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTL TLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC
- the inventive antibody or antigen-binding fragment thereof is highly specific for PD-L1 and yields reproducible results in PD-L1 detection by immunohistochemistry to aid in the stratification of tumor patients amenable for an anti-PD-L1 based therapy.
- the described objectives are solved according to a first embodiment by the inventive antibody or antigen-binding fragment thereof that binds to an epitope comprised in the amino acid sequence according to SEQ ID NO:1 , wherein the antibody light chain or antigen binding fragment thereof comprises at least one of the amino acid sequences according to SEQ ID NO:3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 and the antibody heavy chain or antigen binding fragment thereof comprise at least one of the amino acid sequences according to SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14.
- the antibody or antigen-binding fragment thereof comprises in its light chain at least one of SEQ ID NO:3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ I D NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, or e.g. two, three, four, five, or all of SEQ ID NO:3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8.
- the light chain may comprise SEQ ID NO:3, SEQ I D NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, or e.g.
- SEQ ID NO:3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 1 16, and the antibody heavy chain or antigen binding fragment thereof comprise at least one of SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, e.g. two, three, four, five, or all of SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, e.g.
- SEQ ID NO:9 SEQ ID NO: 10, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 1 1 , SEQ ID NO: 12; SEQ ID NO: 12, SEQ ID NO: 13; SEQ ID NO: 13, SEQ ID NO: 14, or e.g. SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 ; SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12; SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13; SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or e.g.
- SEQ ID NO:9 SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12; SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ I D NO: 12, SEQ ID NO: 13; SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14; or e.g. SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or e.g. SEQ SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 1 17.
- the light chain and heavy chain amino acid sequence elements as disclosed above may e.g. be present in numerically increasing order of the SEQ ID numbers listed, and, if all of the heavy and light chain sequence elements are present in the inventive antibody or antigen-binding fragment thereof, it is preferred that the light chain sequence elements are comprised in the order SEQ ID NO:3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 1 16 and the heavy chain sequence elements are comprised in the order of SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 1 17.
- antibody refers to a polypeptide comprising a framework region from an immunoglobulin gene or fragments thereof that specifically binds and recognizes an antigen.
- the recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as immunoglobulin variable region genes.
- Antibody light chains are classified as either kappa or lambda.
- Antibody heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
- an exemplary immunoglobulin (antibody) structural unit comprises a tetramer.
- Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kD) and one "heavy” chain (about 50-70 kD) (see e.g. J Allergy Clin Immunol. 2010 February ; 125(2 0 2): S41-S52).
- the N-terminus of each chain defines a variable region of about 100 to 1 10 or more amino acids primarily responsible for antigen recognition.
- the terms variable light chain (Vi_) and variable heavy chain (VH) refer to these light and heavy chains respectively.
- the inventive antibody or antigen-binding fragment thereof is a monoclonal antibody, an Fab, F(ab')2, Fab', scFv, or di-scFv.
- Antibodies exist as intact immunoglobulins or e.g. as a well-characterized antigen-binding fragments produced by digestion with peptidases such as pepsin, or papain: Pepsin will result in proteolytic cleavage below the disulfide linkages and result in a F(ab')2 antibody fragments, while proteolytic cleavage by papain, which cleaves above the disulfide linkages, will result in two Fab fragments.
- a F(ab')2 fragment is a dimer of Fab which itself is a light chain joined to VH-CHI by a disulfide bond.
- the F(ab')2 may be reduced under mild conditions to break the disulfide linkage in the hinge region, thereby converting the F(ab)'2 dimer into an Fab' monomer.
- the aforementioned antibody fragments are defined in terms of the digestion of an intact antibody with pepsin and papain, however, such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology.
- antigen-binding fragment thereof refers to (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains, (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region, (iii) a Fd fragment consisting of the VH and CH1 domains, (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (see e.g.
- scFv refers to a molecule comprising an antibody heavy chain variable domain (or region; VH) and an antibody light chain variable domain (or region; VL) connected by a linker, and lacks constant domains, e.g. an scFv fragment according to the invention may e.g. include binding molecules which consist of one light chain variable domain (VL) or portion thereof, and one heavy chain variable domain (VH) or portion thereof, wherein each variable domain (or portion thereof) is derived from the same or different antibodies.
- scFv molecules preferably comprise an linker interposed between the VH domain and the VL domain, which may e.g. include a peptide sequence comprised of the amino acids glycine and serine.
- scFv molecules and methods of obtaining them are known in the art and are described, e.g., in U.S. Pat. No. 5,892,019, Ho et al. 1989. Gene 77:51 ; Bird et al.
- di-scFv as used for the inventive antigen-binding fragments refer to two scFv fragments which are coupled to each other via a linker, e.g. such as disclosed in Cancer Research 54, 6176-618,. December 1 , 1994, or Chem Commun (Camb). 2007 Feb 21 ;(7):695- 7.
- the antibody or antigen binding fragment according to the invention is a monoclonal antibody.
- the term "monoclonal antibody” as used for the inventive antibody refers to an antibody obtained from a population of substantially homogeneous antibodies. Monoclonal antibodies are identical except for possible naturally occurring mutations that may be present in minor amounts, or minor differences in their glycosylation pattern. Monoclonal antibodies, such as e.g. the inventive monoclonal antibody, are highly specific, being directed against a single antigenic site and specifically bind to a single epitope within the antigen, unlike polyclonal antibody preparations which typically include different antibodies directed against different epitopes. Monoclonal antibodies may e.g. be obtained by hybridoma culture as e.g. described by Kohler et al., (1975) Nature, 256:495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567).
- the inventive antibody is an IgG type monoclonal antibody, e.g. the inventive antibody may be a human lgG1 , lgG2, lgG3, or lgG4 type monoclonal antibody, or e.g. murine lgG1 , lgG2a, lgG2b, lgG2c, lgG3, or e.g. rat lgG1 , lgG2a, lgG2b, lgG2c.
- the inventive IgG type monoclonal antibody may be of any origin, e.g. of murine, goat, sheep, hamster, rat, or rabbit origin.
- the inventive antibody or the antigen-binding fragment thereof comprises all of the light chain amino acid sequences according to SEQ ID NO:3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8.
- the inventive antibody or the antigen-binding fragment thereof comprises all of the heavy chain amino acid sequences according to SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14.
- the inventive antibody or antigen-binding fragment thereof comprises three CDRs from the variable region of the light chain which comprises the amino acid sequence according to SEQ ID NO: 1 1 1 and three CDRs from variable region of the heavy chain which comprises the amino acid sequence according to SEQ ID NO:1 10.
- the inventive antibody or antigen-binding fragment thereof comprises three CDRs from the variable region of the light chain which comprises the amino acid sequence according to SEQ ID NO: 1 1 1 , and three CDRs from variable region of the heavy chain which comprises the amino acid sequence according to SEQ ID NO:1 10, and the CDRs of the light chain comprise or are comprised in the amino acid sequences according to SEQ ID NO: 4, SEQ ID NO: 6 and SEQ ID NO: 8 and the CDRs of the heavy chain comprise or are comprised in the amino acid sequences according to SEQ ID NO: 10, SEQ ID NO: 12 and SEQ ID NO: 14.
- the inventive antibody or antigen-binding fragment thereof as disclosed above comprises a light and heavy chain which comprise the CDRs as defined above whereby the light chain variable region according to SEQ ID NO: 1 1 1 further comprises four framework regions (FR) and the heavy chain variable region according to SEQ ID NO:1 10 further comprises four framework regions, whereby the framework regions of the light chain variable region comprise or are comprised in the amino acid sequences according to SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 1 16, and the framework regions of the heavy chain variable region comprise or are comprised in the amino acid sequences according to SEQ ID NO: 9, SEQ ID NO: 1 1 , SEQ ID NO: 13, SEQ ID NO: 1 17.
- the heavy chain of the inventive antibody (or e.g. an antigen-binding fragment thereof) comprises a variable region which comprises the amino acid sequence according to SEQ ID NO: 1 10 and the light chain of the inventive antibody (or e.g. an antigen-binding fragment thereof) comprises a variable region which comprises the amino acid sequence according to SEQ ID NO: 1 1 1 .
- the inventive antibody or antigen-binding fragment thereof comprises a light chain which comprises the amino acid sequence according to SEQ ID NO: 1 14 in which the signal sequence has been removed, e.g. the amino acid sequence according to SEQ ID NO: 1 12, e.g.
- variable light chain (Vi_) and the variable heavy chain (VH) of the inventive antibody e.g. comprising the amino acid sequences according to SEQ ID NO: 1 10 and SEQ I D NO: 1 1 1 may be comprised in a scFv, or e.g. a Fab which e.g. may be further be linked to a GA-SEED, or an AG-SEED.
- SEED refers to strand-exchange engineered domain (SEED) C H 3 heterodimers as disclosed in WO2007/1 10205 A2, Protein Engineering, Design & Selection vol. 23 no. 4 pp. 195-202, 2010.
- heterodimeric molecules are derivatives of human IgG and IgA CH3 domains and create complementary human SEED CH3 heterodimers that are composed of alternating segments of human IgA and IgG CH3 sequences.
- the resulting pair of SEED CH3 domains preferentially associates to form heterodimers in a 1 :1 ratio when expressed in mammalian cells to form "SEEDbodies" (Sb).
- SEEDbodies SEEDbodies
- inventive scFv comprising the amino acid sequences according to SEQ ID NO: 1 10 and SEQ ID NO: 1 10 may e.g. be linked to the GA- or AG-SEED via a peptide linker e.g. via a glycine-serine linker of the amino acid sequence (Gly 4 Ser) n as disclosed above.
- inventive antibody light chain or antigen- binding fragment thereof comprises the amino acid sequence according to SEQ I D NO: 15 and the inventive antibody heavy chain or antigen-binding fragment thereof comprises the amino acid sequence according to SEQ ID NO: 16.
- inventive antibody or antigen- binding fragment thereof may comprise the amino acid sequences according to SEQ ID NO: 15 in its light chain and the amino acid sequence according to SEQ ID NO: 16 in its heavy chain.
- both heavy and light chain sequences of the inventive antibody or antigen binding fragment thereof may comprise amino acid substitutions in the amino acid sequences not comprised in any of SEQ I D NO:3, SEQ ID NO: 4, SEQ I D NO: 5, SEQ I D NO: 6, SEQ I D NO: 7, SEQ I D NO: 8, or SEQ I D NO: 1 1 1 for the light chain and SEQ I D NO:9, SEQ I D NO: 10, SEQ I D NO: 1 1 , SEQ I D NO: 12, .SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 1 10 for the heavy chain, e.g. in amino acids that do not form part of the variable region of the light or heavy chain, or e.g.
- any light or heavy chain CDR or framework sequences e.g. amino- terminally or carboxy-terminally to SEQ I D NO:3, SEQ I D NO: 4, SEQ I D NO: 5, SEQ I D NO: 6, SEQ I D NO: 7, SEQ I D NO: 8, or e.g. SEQ I D NO: 1 1 1 of the light chain, or SEQ I D NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, .SEQ ID NO: 13, SEQ ID NO: 14, or SEQ I D NO: 1 10 of the heavy chain of the inventive antibody.
- Amino acid substitutions may e.g. be non-conservative amino acid substitutions, or conservative amino acid substitutions.
- conservative amino acid substitutions refers to an amino acid substitution in which the substituted amino acid residue is of similar charge as the replaced residue and is of similar or smaller size than the replaced residue.
- Conservative substitutions of amino acids include substitutions made e.g. amongst amino acids within the following groups:
- the inventive monoclonal IgG antibody is a rabbit antibody, or e.g. a rabbit-derived antibody.
- the inventive rabbit IgG monoclonal antibody may e.g. be generated according to the methods disclosed in Antibodies: A Laboratory Manual, Second Edition, Chapter 7, Edited by Edward A. Greenfield, CSH Press, ISBN 978-1 -9361 13- 81 -1 , or e.g. according to any suitable method in the art such as those disclosed in Proc. Natl. Acad. Sci. USA, Vol. 92, pp. 9348-9352, September 1995, or e.g. US patent 7,732,168 B2.
- rabbit-derived antibody refers to an antibody that was produced in a heterologous expression system (e.g. CHO cells, HEK293 cells) using polynucleotide sequences obtained from a rabbit hybridoma producing the respective antibody, such as e.g. the inventive antibody.
- a rabbit-derived antibodies of the invention includes antibodies that may be produced in CHO or HEK cells transfected with an expression vector comprising polynucleotides encoding the amino acid sequence (e.g. according to SEQ ID NO: 15 and/or SEQ ID NO:16) of the antibody produced by a rabbit hybridoma cell.
- recombinant monoclonal antibodies according to the invention may be generated from rabbit hybridoma cells producing the inventive antibody by the method as disclosed in PLoS One. 2016 Mar 29;1 1 (3):e0152282.
- cDNA from a single B cells may be prepared using Superscript III reverse transcriptase (Invitrogen) primed with oligo (dT).
- Antibody variable-region genes may then be recovered via two rounds of PCR using either KOD DNA polymerase (EMD Millipore) or TaqPlus Precision DNA polymerase (Agilent).
- a primary PCR may e.g. utilize gene-specific primers at both the 5' and 3' ends of the antibody variable region.
- the 5' oligonucleotide set may bind e.g. at the 5' end of the leader sequence and the 3' reverse primer set may anneal to CH1 or CK region respectively.
- a single 5' forward oligonucleotide that anneals to a "tail" encoded at the 5' end of the primary PCR product may be used with a 3' primer set that anneals in the J region.
- the secondary oligonucleotides may e.g. be used to introduce restriction sites to facilitate downstream cloning. Heavy and light chain PCR fragments may then e.g. be subcloned into to suitable expression vectors (e.g.
- Expi293 cells Life technologies
- Expi293-fectamine Life Technologies
- the transfected cells may then e.g. grown for 7 days at 37°C in a 5% CO2 environment using growth media that in allow the production of the inventive antibody.
- Resultant supernatants may e.g. harvested after 5 to 7 days.
- the inventive antibody or antigen-binding fragment thereof as is further coupled to a detectable label.
- detectable label refers to a molecule capable of detection, which may e.g. include radioactive isotopes, fluorescent probes, chemiluminescences, enzymes, enzyme substrates, enzyme cofactors, enzyme inhibitors, dyes, metal ions, or biotin.
- coupled refers to the fact that the dye, radioisotope may e.g. be non-covalently via e.g.
- inventive antibody or antigen-binding fragment thereof ionic, or hydrophobic interactions, or covalently attached to inventive antibody or antigen-binding fragment thereof.
- Coupling of the detectable labels as disclosed above such as e.g. of fluorescent probes, dyes, or enzymes to the inventive antibody or antigen-binding fragment thereof as disclosed above may e.g. be done according to methods known in the art such as those disclosed in Methods Cell Biol. 2001 ;63:185-204; Methods Mol Biol. 2010;588:43-8; Curr Protoc Mol Biol. 2001 May;Chapter 1 1 :Unit 1 1.1 .
- the detectable label coupled to the inventive antibody or antigen-binding fragment thereof is one of an enzyme, or fluorophore, or enzyme substrate.
- the detectable label coupled to the inventive antibody or antigen-binding fragment thereof may be alkaline phosphatase, horseradish peroxidase, beta-galactosidase, Tobacco Etch Virus nuclear-inclusion-a endopeptidase ("TEV protease").
- TEV protease Tobacco Etch Virus nuclear-inclusion-a endopeptidase
- the fluorophore which may e.g.
- inventive antibody may be one of 1 ,8- ANS, 4-methylumbelliferone, 7-amino-4-methylcoumarin, 7-hydroxy-4-methylcoumarin, Acridine, Alexa Fluor 350TM, Alexa Fluor 405TM, AMCA, AMCA-X, ATTO Rho6G, ATTO Rho1 1 , ATTO Rho12, ATTO Rho13, ATTO Rho14, ATTO Rho101 , Pacific Blue, Alexa Fluor 430TM, Alexa Fluor 480TM, Alexa Fluor 488TM, BODIPY 492/515, Alexa Fluor 532TM, Alexa Fluor 546TM, Alexa Fluor 555TM, Alexa Fluor 594TM, BODIPY 505/515, Cy2, cyQUANT GR, FITC, Fluo-3, Fluo-4, GFP (EGFP), mHoneydew, Oregon GreenTM 488, Oregon GreenTM 514, EYFP, DsRed, DsRed2, d
- Fluorophores which may be coupled to the inventive antibody or antigen-binding fragment may e.g. also include quantum dots.
- the term quantum dot as used in the present invention refers to a single spherical nanocrystal of semiconductor material where the radius of the nanocrystal is less than or equal to the size of the exciton Bohr radius for that semiconductor material (the value for the exciton Bohr radius can be calculated from data found in handbooks containing information on semiconductor properties, such as the CRC Handbook of Chemistry and Physics, 83rd ed., Lide, David R. (Editor), CRC Press, Boca Raton, Fla. (2002)).
- Quantum dots are known in the art, as they are described in references, such as Weller, Angew. Chem. Int.
- Quantum dots may e.g. be from about 1 nm to about 1000 nm diameter, e.g.
- a QD is capable of emitting electromagnetic radiation upon excitation (i.e., the QD is photoluminescent) and includes a "core" of one or more first semiconductor materials, and may be surrounded by a "shell” of a second semiconductor material.
- a QD core surrounded by a semiconductor shell is referred to as a "core/shell” QD.
- the surrounding "shell" material will preferably have a bandgap energy that is larger than the bandgap energy of the core material and may be chosen to have an atomic spacing close to that of the "core” substrate.
- the core and/or the shell can be a semiconductor material including, but not limited to, those of the groups ll-VI (ZnS, ZnSe, ZnTe, US, CdSe, CdTe, HgS, HgSe, HgTe, MgS, MgSe, MgTe, CaS, CaSe, CaTe, SrS, SrSe, SrTe, BaS, BaSe, BaTe, and the like) and lll-V (GaN, GaP, GaAs, GaSb, InN, InP, InAs, InSb, and the like) and IV (Ge, Si, and the like) materials, PbS, PbSe, and an alloy or a mixture thereof.
- ll-VI ZnS, ZnSe, ZnTe, US, CdSe, CdTe, HgS, HgSe, HgTe, MgS, MgSe, MgTe
- Preferred shell materials include ZnS.
- Quantum dots may e.g. be coupled to the inventive antibody or antigen-binding fragment thereof by any method known in the art such as the methods disclosed in Nanotechnology. 201 1 Dec 9;22(49):494006; Colloids and Surfaces B: Biointerfaces 84 (201 1 ) 360-368.
- the inventive antibody or antigen-binding fragment thereof may be coupled to a radioisotope such as 47 Ca, 14 C, 137 Cs, 157 Cr, 57 Co, 60 Co, 67 Cu, 67 Ga, 123 l, 125 l, 129 l, 131 1, 32 P, 75 Se, 85 Sr, 35 S, 201 Th, 3 H, preferably, the radioisotopes are incorporated into a further molecule, such as e.g. a chelator.
- a radioisotope such as 47 Ca, 14 C, 137 Cs, 157 Cr, 57 Co, 60 Co, 67 Cu, 67 Ga, 123 l, 125 l, 129 l, 131 1, 32 P, 75 Se, 85 Sr, 35 S, 201 Th, 3 H
- the radioisotopes are incorporated into a further molecule, such as e.g. a chelator.
- Typical chelators that may be used according to the invention are for example DPTA, EDTA (Ethylenediamine-tetraacetic acid), EGTA (Ethyleneglycol-O, 0'-bis(2- aminoethyl)-N, N, N', N'-tetraacetic acid, NTA (Nitrilotriacetic acid), HEDTA (N-(2- Hydroxyethyl)-ethylenediamine-N,N',N'-triacetic acid), DTPA (2-[Bis[2-
- the inventive antibody or antigen-binding fragment thereof is for use in detecting the presence or expression of an epitope comprised in SEQ ID NO: 1 in a sample.
- the inventive antibody or antigen-binding fragment thereof is for use in detecting the expression of an epitope comprised in the amino acid sequence according to SEQ ID NO: 1 , whereby SEQ ID NO: 1 corresponds to an intracellular portion of human PD-L1 spanning amino acid residues 260-290 of GenBank accession no. AAH69381 .
- the epitope comprised in the amino acid sequence according to SEQ ID NO: 1 (e.g. within the intracellular domain of human PD-L1 ) may e.g.
- epitope refers to a portion of SEQ ID NO: 1 having antigenic or immunogenic activity in an animal, preferably a mammal, and most preferably in a rabbit.
- the epitope comprised in SEQ ID NO: 1 according to the invention may e.g. be a linear epitope, or a conformational epitope.
- a conformational epitope may e.g.
- SEQ ID NO: 1 may be composed of discontinuous sections of the amino acid sequence of SEQ ID NO: 1 and may e.g. interact with the paratope of the inventive antibody, or antigen-binding fragment as disclosed above based on its 3-dimensional surface features and shape or tertiary structure of SEQ ID NO: 1.
- the epitope comprised in SEQ ID NO: 1 according to the invention may e.g. also be a linear epitope formed by a continuous sequence of amino acids of SEQ ID NO: 1 which interacts with the paratope of the inventive antibody or antigen-binding fragment thereof based on the primary amino acid sequence of SEQ ID NO: 1 (RLRKGRMMDVKKCGIQDTNSKK QSDTHLEET).
- the paratope of inventive antibody or antigen-binding fragment thereof may e.g. bind to a linear epitope comprised in the amino acid sequence according SEQ ID NO: 1 and may e.g. have a length of about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 to about 1 1 , 12, 13, 14, 15, 16, 17 , 18, 19, 20 amino acids, or of about 2 to about 3, 4, 5, 6, 7, 8, 9, 10 amino acids, or e.g.
- the linear epitope which interacts with the paratope of the inventive antibody or antigen-binding fragment thereof may comprise, or may be comprised in an amino acid sequences according to SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31 , SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 , SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO:
- the inventive antibody or antigen-binding fragment thereof as disclosed above may be used to detect the presence or expression of an epitope as disclosed above in a sample, which may e.g. be a biological sample such as a body fluid, or a blood sample.
- a biological sample such as a body fluid, or a blood sample.
- the biological sample, such as body fluid, or blood sample may be subjected to flow cytometry, or e.g. FACS using the inventive antibody or antigen-binding fragment thereof to detect the absence or presence of an epitope comprised in SEQ ID NO: 1 , or as comprised in e.g. any of the amino acid sequences according to SEQ ID NO: 19 - SEQ ID NO: 108 of the invention.
- cells obtained by a needle biopsy may be blocked for 10 minutes at room temperature with FcR blocker (e.g. TruStain FcXTM (Biolegend, San Diego; or e.g. Human BD Fc BlockTM, BD Biosciences) in a 1 :1000 dilution and then incubated with the inventive antibody or antigen-binding fragment thereof, whereby the inventive antibody or antigen-binding fragment thereof may be coupled to a fluorescent probe, e.g. phycoerythrin [PE] in a dilution of about 1 :50 to about 1 : 500, e.g.
- FcR blocker e.g. TruStain FcXTM (Biolegend, San Diego; or e.g. Human BD Fc BlockTM, BD Biosciences
- inventive antibody or antigen-binding fragment thereof may be coupled to a fluorescent probe, e.g. phycoerythrin [PE] in a dilution of about 1 :50 to about
- the cells may additionally be counterstained with carboxyfluorescein diacetate succinimidyl ester (CFSE, Biolegend, San Diego, CA) at a final concentration of 5 ⁇ for 10 minutes at 37°C in darkness, followed by two washes with RPMI- 1640 medium.
- CSE carboxyfluorescein diacetate succinimidyl ester
- the inventive antibody or antigen-binding fragment thereof may be used to detect the presence or expression of an epitope comprised in SEQ ID NO: 1 , e.g. comprised in a linear epitope in any one of the amino acid sequences according to SEQ ID NO: 19 - SEQ ID NO: 108, in a tissue sample, fixed tissue sample, or a formaldehyde- fixed paraffin-embedded (FFPE) tissue.
- tissue sample may e.g.
- a tumor tissue suspected to be a tumor refers to single cells derived from a tumor, or tissue suspected to be a tumor, or at least about 10 2 , 10 3 , 10 4 , 10 5 , 10 6 or more cells derived from a tumor tissue or tissue suspected to be a tumor which may e.g. also comprise cultured tumor cells, e.g. as described in Trends Biotechnol. 2013 June ; 31 (6): 347-354; Cancer Cell Culture: Methods and Protocols (Methods in Molecular Medicine); S.P. Langdon (Ed.), Humana Press, ISBN: 978-1588290793.
- the cells or tissue may e.g. be obtained by way of non-invasive means, including, but not limited to, fine needle aspiration and needle biopsy, or, alternatively, by e.g. an invasive method, including, but not limited to, surgical biopsy.
- the methods of obtaining the tissue sample do not form part of the present invention.
- the term "fixed tissue sample” according to the invention refers to a tissue sample which has been subjected to chemical tissue fixation.
- chemical fixation may include fixation with methanol, ethanol, acetone, methanol- acetone mix, buffered formalin solution, glutaraldehyde, or buffered paraformaldehyde.
- fixation may include treatment (fixation) of the tissue sample as disclosed above with 10% saturated aqueous formaldehyde buffered to pH 6.8-7.2 with 100 mM phosphate buffer, or 10% neutral buffered formalin (NBF) with varying times at temperatures ranging from 4°- 45°C, e.g. room temperature (20-25°C), or e.g. from about 5°C, 6°C, 7°C, 8°C, 9°C, 10°C to about 15°C, 17.5°C, 20°C, or from about 12°C, 15°C, 17.5C, 20°C to about 25°C, 27°C, 30°C, 35°C, 40°C, 45°C for varying amounts of time.
- fixation treatment of the tissue sample as disclosed above with 10% saturated aqueous formaldehyde buffered to pH 6.8-7.2 with 100 mM phosphate buffer, or 10% neutral buffered formalin (NBF) with varying times at temperatures ranging from 4°- 45°C,
- the tissue samples as disclosed above may be fixed for about 5 minutes to about 24 hours, or from about 10min, 15min, 30min, 45min, 60 min, 90min, 120min, 180min to about 15min, 30min, 45min, 1 h, 4h, 5h, 6h, 7h, 8h, 9h, 10h, 1 1 h, 12h, 14h, 16h, 18h, 20h, 24h, 48h.
- fixed tissue samples may include tissue samples that were fixed by immersion fixation with 10 % NBF for about 18-24h.
- a fixed tissue sample according to the invention may includes a tissue sample as disclosed above which has been fixed, or treated according to standard protocols available in the art, such as those provided on the website www.ihcworld.com, e.g. as described in Hopwood D. Fixatives and fixation: a review. Histochem J. 1969;1 (4):323-60, or e.g. as described in "Immunohistochemical Staining Methods", 5 th edition (2009), published by DAKO North America, Inc.
- formaldehyde-fixed paraffin-embedded (FFPE) tissues may be obtained by the following procedure: The tumor tissue as disclosed above may e.g.
- the tissue may e.g. for a 1 -2mm tissue sample, 2-3h at RT, for a 5-10mm thick tissue sample- 5h RT, or e.g. for a tissue sample >10mm in thickness 2-3h RT, or e.g. at 4°C overnight.
- the tissue may e.g.
- the histology cassettes may then e.g. be subjected to paraffin embedding using a commercial tissue processor 70% ethanol for 1 hour;95% ethanol (95% ethanol/5% methanol) for 1 hour; first absolute ethanol for 1 hour ; second absolute ethanol 1 1 ⁇ 2 hours; third absolute ethanol 1 1 ⁇ 2 hours; fourth absolute ethanol 2 hour; first clearing agent (xylene or substitute) 1 hour; second first clearing agent (xylene or substitute) 1 hour; first wax (Paraplast X-tra) at 58°C for 1 hour; second wax (Paraplast X-tra) at 58°C 1 hour.
- inventive antibody or antigen-binding fragment thereof as disclosed above is used in the detection of an epiotope comprised in the amino acid sequences according to SEQ ID NO: 1 , e.g. as comprised in any of the amino acid sequences according to SEQ ID NO: 19 - SEQ ID NO: 108 as disclosed above in a tissue sample, fixed tissue sample, or FFPE tissue sample derived from a tumor, e.g. the tissue obtained from a tumor by means of a biopsy as disclosed above.
- the term "derived from a tumor” according to the invention may e.g. also include tumor cells obtained by needle aspiration, or e.g. cells tumor cells obtained by needle aspiration which have been cultivated.
- the detection of the epitope comprised in the amino acid sequence according to SEQ ID NO:1 is done by means of immunohistochemistry (IHC), flow cytometry, ELISA, or western blotting.
- IHC immunohistochemistry
- the tissue sample, or tumor tissue sample according to the invention may be subjected to immunoblotting to detect the epitope comprised in SEQ ID NO: 1 using the antibody or antigen binding fragment thereof according to the invention as described in Current Protocols in Molecular Biology 10.8.1 -10.8.28, July 2008.
- an ELISA is used for the detection of the epitope comprised in SEQ ID NO: 1 using the inventive antibody or antigen-binding fragment thereof
- the ELISA may be done according to standard protocols, such e.g. as disclosed in Current Protocols in Molecular Biology (1991 ) 1 1.2.1 -1 1 .2.22.
- the epitope comprised in SEQ ID NO: 1 is detected by means of immunohistochemistry (IHC) on FFPE tissue samples using the inventive antibody, or an antigen binding fragment thereof (e.g. as primary antibody):
- IHC immunohistochemistry
- the FFPE tumor tissue sample may be deparaffinized by placing dry paraffin sections on slides in a 60°C oven for 1 hr. Subsequently, the slides may e.g.
- Slides may be placed in a Coplin jar with antigen retrieval solution such as e.g. Target Retrieval Solution, enhanced citrate buffer solution (Dako, S1699 or S1700), and Target Retrieval Solution, high pH (Dako, S3308), or 0.05M citrate buffer, pH 6, or e.g. Tris EDTA buffer, pH 8. Slides may e.g. then be allowed to equilibrate to 75° to 95°C in a water bath and incubated for about 40 minutes. The slides may e.g.
- the slides may then be allowed to cool at room temperature for 20 min after which the solution is decanted and the slides may then be placed in a staining dish containing TBS/0.6% Tween 20 for a minimum of 5 minutes.
- Antigen retrieval may e.g. also be dine using a PT link pretreatment module (DAKO) using Tris-EDTA buffer pH 9 at 97°C for 20 minutes.
- DAKO PT link pretreatment module
- the slides may then be subjected to the staining procedure using an automated instrument (e.g. Discovery XT ®, or AutostainerLink 48) following the manufacturer's instructions.
- the slides may also be manually processed as described in Current Protocols in Molecular Biology 14.6.1 -14.6.23, January 2008.
- the slides may be covered with 400 to 500 ⁇ of the antibody according to the invention diluted e.g. into commercially available antibody diluent (e.g. from DAKO) to a concentration of about O ⁇ g/ml to about 5 ⁇ g/ml, e.g.
- commercially available antibody diluent e.g. from DAKO
- the primary antibody may then be rinsed off with TBS/0.6% Tween 20®.
- the slides may e.g. then be gently drained and freed from any remaining wash solution.
- the secondary antibody for the detection of the inventive antibody may be added and incubated at room temperature for about 30 min.
- Secondary antibody dilution may e.g. be from about 1 :100 to about 1 :10.000, e.g.
- polyclonal goat anti-rabbit HRP-conjugated immunoglobulins at a dilution of about 1 :50, 1 :175, to about 1 :200, or e.g. goat anti-rabbit alkaline phosphatase (AP)- conjugated immunoglobulins at a dilution of about 1 :20, 1 :50, 1 :100 to about 1 :100, 1 :200, 1 :250, depending on the choice of the detection method and substrate employed, e.g. if Horseradish peroxidase (HRP)-conjugated secondary antibodies are used, 3,3'- diaminobenzidine (DAB) may e.g.
- HRP horseradish peroxidase
- DAB 3,3'- diaminobenzidine
- chromogenic detection or e.g. 2,2'-azino-bis(3- ethylbenzothiazoline-6-sulphonic acid) (ABTS), or e.g. 3,3',5,5'-Tetramethylbenzidine (TMB) may be used, or if e.g. AP-conjugated secondary antibodies are used, a substrate combination of nitro blue tetrazolium chloride (NBT) and 5-bromo-4-chloro-3-indolyl phosphate (BCIP) may be used.
- NBT nitro blue tetrazolium chloride
- BCIP 5-bromo-4-chloro-3-indolyl phosphate
- the slides may then be washed twice with TBS/0.6% Tween 20® by overlaying the slide with wash solution for about 5 minutes after which the chromogen solution may be added according to the manufacturer's recommended protocol and incubated for about 4 to 5 min.
- a counterstain may e.g. be made using Harris' hematoxylin for about 5 minutes after which the slides may be rinsed under running tap water followed by e.g. an additional rinse in TBS/0.6% Tween 20 for about 1 min.
- the sections may then e.g. be dehydrated by gently immersing the slides up and down for several seconds in each solution before transferring to the next: 70% ethanol 90% ethanol 100% ethanol two times in xylene.
- the sections may then e.g. be mounted using a mounting medium and coverslip.
- the present invention provides for a method of detecting the presence or expression of an epitope comprised in SEQ ID NO:1 in a sample, e.g. an epitope comprised in any of SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31 , SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 , SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, S
- the inventive method of detecting the presence or expression of an epitope comprised in SEQ ID NO:1 in a sample may comprise detection by means of immunohistochemstry, or by means of automated immunohistochemistry using commercially available IHC platforms, such as e.g. intelliPath FLX (Biocare Medical), WAVE RPD (Celerus Diagnostics), Omnis (DAKO), Autostainer Link 48 (DAKO), Benchmark XT (Ventana), or Benchmark Ultra (Ventana) according to the corresponding manufacturer's instructions and/or protocols.
- the inventive method may be used to detect the expression of human PD-L1 in a sample according to the invention.
- the inventive method may be used to detect the presence of human PD- L1 or any fragment thereof comprising the amino acid sequence according to SEQ ID NO: 1 in a sample, wherein the method comprises the step of contacting said sample with the inventive antibody or antigen binding fragment thereof and detecting the presence of bound antibody or antigen binding fragment thereof as disclosed above, e.g. by means of means of immunohistochemstry, or by means of automated immunohistochemistry.
- fragments of human PD-L1 according to the invention may comprise human PD-L1 which has been proteolytically cleaved, whereby the cleaved PD-L1 fragment comprises the amino acid sequence according to SEQ ID NO: 1.
- a fragment of human PD-L1 according to the invention may comprise human PD-L1 lacking the extracellular domain, e.g. only comprises the transmembrane domain and the intracellular domain (e.g. amino acids 239-290 of GenBank accession no. AAH69381 ), or e.g. PD-L1 fragments which may be detected using the inventive antibody may only comprise the intracellular domain of human PD-L1 (e.g. amino acids 260-290).
- the inventive antibody or antigen-binding fragment thereof is used to detect the presence or expression of an epitope comprised in SEQ ID NO:1 in a sample as disclosed above, e.g.
- the sample may be a biological sample, such as e.g. body fluid, or a blood sample.
- the presence or expression of an epitope comprised in SEQ ID NO:1 in a blood sample may be done using the inventive antibody or antigen-binding fragment as disclosed above.
- the blood sample used may e.g. of mammalian origin, preferably a human blood sample, preferably a blood sample from a cancer patient, or from an individual at risk of having cancer.
- the inventive antibody or antigen-binding fragment thereof may be used to e.g.
- tumor cells e.g. leukocytes, such as neutrophils, eosinophils, basophils, lymphocytes or monocytes.
- leukocytes such as neutrophils, eosinophils, basophils, lymphocytes or monocytes.
- a peripheral blood sample e.g. from a tumor patient, whereby the term "tumor” refers to neoplasms, i.e.
- abnormal growth of tissue which may also form a mass may be analyzed using phycoerythrin-Texas Red (ECD)-conjugated anti-CD3, phycoerythrin-Cyanin 5 (PC5)-conjugated anti-CD15 (BD Biosciences, San Diego, CA, USA), fluorescein isothiocyanate (FITC)-conjugated anti-CD80 (MIH clones, eBioscience, San Diego, CA, USA) in conjunction with the inventive antibody or antigen-binding fragment thereof conjugated to phycoerythrin (PE) to identify the cell types expressing the epitope comprised in SEQ I D NO: 1 .
- ECD phycoerythrin-Texas Red
- PC5 phycoerythrin-Cyanin 5
- FITC fluorescein isothiocyanate
- MIH clones MIH clones, eBioscience, San Diego, CA, USA
- neutrophils may be identified as CD15 + CD3 " cells, the labeling of which may e.g. be done by incubating 50 ⁇ _ of fresh heparinized whole blood simultaneously with 5 ⁇ _ ECD-conjugated anti-CD3, 5 ⁇ _ PC5-conjugated anti-CD15 on ice in the dark for 30 minutes.
- Cells incubated with PE- and FITC- conjugated mouse IgG may e.g. be used as isotype controls.
- the samples may then be analyzed using a cell sorter, e.g. a CYTOMICS FC 500 flow cytometer (Beckman Coulter Inc., Brea, CA, USA) and associated software programs (CXP) according to the manufacturer's instructions.
- a cell sorter e.g. a CYTOMICS FC 500 flow cytometer (Beckman Coulter Inc., Brea, CA, USA) and associated software programs (CXP) according to the manufacturer's instructions.
- CTCs circulating tumor cells
- inventive antibody or antigen-binding fragment thereof may e.g. be analyzed by flow cytometry as disclosed above using one or more of the following markers EpCAM, EphB4, EGFR, CEA, HER2, or MUC-1 in combination with the inventive antibody as disclosed above, whereby the one or more antibodies used to label the CTCs has a different fluorescent label than the inventive antibody as disclosed above.
- CTCs may e.g.
- the inventive antibody or antigen- binding fragment thereof conjugated to a fluorescent probe or detectable label as disclosed above may e.g. be used in a concentration from about O.O ⁇ g/ml to about 50 ⁇ g ml, e.g. from about 0.025Mg/ml, 0.05Mg/ml, 0.075Mg/ml, 0.1 mg/ml, 0.25Mg/ml,
- ⁇ ⁇ / ⁇ 17.5Mg/ml, 20Mg/ml, 22.5Mg/ml, 25Mg/ml, 30Mg/ml, 35Mg/ml, 37.5Mg/ml, 40Mg/ml, 45Mg/ml, 50 ⁇ g/ml, or e.g.
- the presence or expression of an epitope comprised in the amino acid sequence according to SEQ ID NO: 1 , or e.g. in any of the amino acid sequences according to SEQ ID NO: 19 - SEQ ID NO: 108, using the inventive antibody or antigen-binding fragment in a sample, such as a blood sample may be done by means of an ELISA.
- the inventive antibody may be used at a concentration of about 0.25 g/ml, ⁇ . ⁇ / ⁇ , 0.75Mg/ml, 1 g/ml, 1.5C ⁇ g/ml, 1 .75 g/ml, 2 g/ml.
- ⁇ / ⁇ 2.5Mg/ml, ⁇ / ⁇ , 3.5Mg/ml, 4 g/ml. 4.5 g/ml, ⁇ / ⁇ , ⁇ . ⁇ / ⁇ , ⁇ / ⁇ , 7 g/ml. ⁇ / ⁇ , 9 g/ml. ⁇ ⁇ / ⁇ , or a control antibody (e.g. mlgG2a at 2 g/ml in PBS) to coat an ELISA plate overnight at 4°C followed by blocking with PBS containing 10% FBS.
- Blood samples e.g. from a cancer patient, and/ from healthy individual as control or reference sample
- the wells may e.g. be washed six times in PBS with 0.1 % Tween-20.
- Bound inventive antibody may be detected by horseradish peroxidase-conjugated secondary anti-rabbit IgG Ab at a 1 :2.000 dilution incubated for 1.5 hour at room temperature and then reacted with tetramethylbenzidine followed by a measuring absorbance using a plate reader at a wavelength of 450 nm.
- Nonspecific binding of sera to plates coated with control Ig may e.g. be subtracted from the measurement of each sample for background correction.
- the inventive antibody or antigen-binding fragment thereof may be used to detect the presence or expression of an epitope comprised in SEQ ID NO: 1 , or e.g. in any of the amino acid sequences according to SEQ ID NO: 19 - SEQ ID NO: 108, in a tissue sample, fixed tissue sample, or a formaldehyde-fixed paraffin-embedded (FFPE) tissue as disclosed above.
- FFPE formaldehyde-fixed paraffin-embedded
- the formaldehyde-fixed paraffin-embedded (FFPE) tissue is a tumor tissue sample, or a tumor tissue-derived sample, e.g. tumor cells, cultured tumor cell lines, or tumor tissue which has been cultured as disclosed above.
- the inventive method may e.g.
- control tissue which does not express or only minor amounts of PD-L1 to the inventive method, preferably processed in parallel to the tissue sample as disclosed above.
- control tissue may comprise thyroid tissue or skeletal muscle tissue, or cultured PD-L1 negative cancer cells, such as e.g. A2760, Colo205 or IGROV-1 .
- minor amounts as used above refers to the expression of PD-L1 by a tumor cell or tumor tissue which is at least 5-, 10-, 20-, 25-, 40-, 50-, or 100-fold less than that of a PD-L1 positive tumor tissue or tumor cell (such as e.g.
- tissue sample, or tumor tissue sample as defined above may be subjected to RNA isolation and cDNA synthesis which may then e.g. be used in qPCR to determine the relative expression level of PD-L1 .
- the inventive antibody may e.g. be used on tissue samples mounted on a glas slide to form a tissue array in which different tumor tissue samples may be placed next to each other.
- a tissue array comprises at least one, two, three or four sections of each tissue sample mounted on a glas slide in different locations (e.g. to avoid detection artefacts).
- the tissue array may comprise at least 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 14, 16, 18, 20 to about 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 55 or 60, or form about 22, 24, 28, 30, 36, 40, 44, 48, 52, 56, 60 to about 64, 68, 72, 76, 78, 80, 82, 84, 86, 90, 100 different tissue samples.
- the tissue array may comprise at least one or more, e.g. 5, 10, 20, 30, 40, 50 or more, or e.g.
- the cancer cell lines as disclosed above may e.g. be obtained from ATCC, or e.g. DSMZ (Leipniz Institute DSMZ) and cultured according to established methods for each of the respective cell lines.
- Tissue arrays or tumor tissue arrays comprising at least one formaldehyde-fixed paraffin-embedded (FFPE) tissue sample, or FFPE tumor tissue sample as disclosed above may e.g. be manufactured according to the protocol as described in Nat Med. 1998 Jul;4(7):844-7.
- the formaldehyde-fixed paraffin-embedded (FFPE) tissue sample, or formaldehyde-fixed paraffin-embedded tumor tissue sample is derived from a subject being at risk of, or having cancer, T cell dysfunction, acute or chronic infection or showing tumor immunity.
- FFPE formaldehyde-fixed paraffin-embedded
- the term cancer as used for the inventive method refers to or describes the physiological condition in mammals, preferably in humans, that is typically characterized by unregulated cell growth/proliferation with the potential to invade or spread to other parts of the body.
- cancer examples include, but are not limited to, non-small-cell lung cancer (NSCLC), mesothelioma, unresectable mesothelioma, breast cancer, adenocarcinoma of stomach or GEJ, gastric, Thymoma, ovarian cancer, adenoid cystic carcinoma, metastatic adenoid cystic carcinoma, bladder cancer, clear cell kidney cancer, head/neck squamous cell carcinoma, lung squamous cell carcinoma, malignant melanoma, ovarian cancer, pancreatic cancer, prostate cancer, renal cell cancer, small-cell lung cancer (SCLC) or triple negative breast cancer, lymphoproliferative disorders, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), diffuse large B-cell lymphoma (DLBCL), EBV-positive DLBCL, primary mediastinal large B-cell lymphoma
- T cell dysfunction refers to a pathological state of CD8 T cells that e.g. can be caused if alterations in the tightly controlled differentiation process of a CD8 positive T cell occurs, such as e.g. changes in the nature, context and duration of antigen encounter which can result in substantial alterations in T cell activation and differentiation process that may also be referred to as T-cell exhaustion, tolerance, anergy or senescence.
- acute infection refers to an acute infection caused by bacteria, viruses or parasites and which e.g. has occurred about one, two, three, or four weeks prior to diagnosis.
- chronic infection refers to a situation in which pathogens are not quickly eliminated but rather persist for an extended period of time, e.g. for more than three, four, five, six, seven, eight, nine or ten weeks.
- the persistent pathogen exposure can result in chronic antigen stimulation and persistent inflammation which can result in exhaustion and/or clonal depletion of pathogen-specific CD8 T cells.
- Chronic infections may e.g. include viral infection such as hepatitis A, hepatitis C or hepatitis D, HIV infections, or e.g.
- the FFPE tissue sample, or FFPE tumor tissue sample is derived from a subject, e.g. a human, characterized by or having tumor immunity.
- tumor immunity refers to the process in which tumors evade immune recognition and clearance.
- Tumor-derived, or tumor-associated factors are believed to influence dendritic cell differentiation and preclude the development of cells with antigen-presenting function that ultimately result in tumor immunity.
- the expression of endogenous retroviruses (ERVs) in particular tumor-specific endogenous retroviruses (TERVs) has e.g. also been implicated in tumor immunity.
- Other factors that may contribute to tumor immunity are e.g. gene amplifications PD-L1 (CD274) and ALOX12B/15B, or e.g. mutations on any of the genes B2M, HLA-A, HLA-B, HLA-C, or CASP8 that result in a loss of antigen presentation (e.g.
- the present invention provides for a method of predicting that a mammal, preferably a human, suffering from a malignancy is a likely candidate for treatment with an immune check-point inhibitor, such as e.g. an anti-PD-L1 antibody, or an anti-PD-1 antibody which comprises detecting the presence or absence of an epitope comprised in SEQ NO: 1 , or e.g. comprised in any of SEQ ID NO: 19 - SEQ ID NO: 108, e.g.
- an immune check-point inhibitor such as e.g. an anti-PD-L1 antibody, or an anti-PD-1 antibody which comprises detecting the presence or absence of an epitope comprised in SEQ NO: 1 , or e.g. comprised in any of SEQ ID NO: 19 - SEQ ID NO: 108, e.g.
- SEQ ID NO: 20 SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 , SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51 , SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, S
- the method comprises e.g. flow cytometry, FACS, or preferably immunohistochemistry using the inventive antibody, wherein detecting the epitope comprised in SEQ ID NO: 1 , or e.g. comprised in any of SEQ ID NO: 19 to SEQ ID NO: 108, in e.g.
- immune checkpoint inhibitor has its general meaning in the art and refers to a molecule that is expressed by T cells in that either turn up a signal (stimulatory checkpoint molecules) or turn down a signal (inhibitory checkpoint molecules), such as for example the PD-1 /PD-L1 and CTLA-4/CD28 signaling pathways both of which are recognized in the art to constitute immune checkpoint pathways (see e.g. Pardoll, 2012. Nature Rev Cancer 12:252-264).
- Anti-PD-L1 antibodies that may e.g. be administered to patients that have been identified as likely candidates for the treatment with an immune checkpoint inhibitor using the inventive method as disclosed above include e.g.
- PD-L1 positive cells in the sample according to the invention may e.g. include tumor cells, or immune cells, such as tumor infiltrating lymphocytes (TILs) (e.g. CD8-positive T cells, macrophages, NK cells, or B-cells).
- TILs tumor infiltrating lymphocytes
- different methods for determining the relative abundance of PD-L1 positive cells in a sample may be used.
- PD-L1 scoring may include determining the relative abundance of PD-L1 positive tumor cells, or the relative abundance of PD-L1 positive TILs in the sample, or e.g. determining the combined relative abundance of PD-L1 positive tumor cells and TILs.
- the total number of cells in the sample, or any subfraction thereof which is used for determining the number of PD-L1 positive cells may e.g. be obtained by counterstaining the sample using hematoxylin to visualize cell nuclei and cytoplasms, or e.g.
- PD-L1 positive cells refers to cells which detectably express an epitope comprised in the amino acid sequence according to SEQ ID NO: 1 to which the inventive antibody specifically binds and which then may be detected with e.g. HRP- or AP-coupled secondary antibodies which specifically bind to the inventive antibody and allow chromogenic or fluorescent detection when reacted with the corresponding substrate (e.g. as disclosed above).
- HRP-coupled secondary antibodies may be used and incubated with DAB as substrate to label PD-L1 positive cells.
- the scoring of PD-L1 positive cells may e.g. include counting individual cells or nuclei, to determine the number of PD-L1 positive cells and total cell number in the FFPE tumor tissue sample analyzed (or e.g. in any subsection thereof).
- the surface area of PD-L1 positive cells and hematoxylin stained cells may e.g. be used to determine the relative abundance of PD-L1 positive cells.
- the inventive method as disclosed above may be used to identify likely candidates for a treatment with an anti-PD-L1 antibody whereby the malignancy according to the invention may be one of non-small-cell lung cancer (NSCLC), mesothelioma, unresectable mesothelioma, breast cancer, adenocarcinoma of stomach or GEJ, gastric, Thymoma, ovarian cancer, adenoid cystic carcinoma, metastatic adenoid cystic carcinoma, bladder cancer, clear cell kidney cancer, head/neck squamous cell carcinoma, lung squamous cell carcinoma, malignant melanoma, ovarian cancer, pancreatic cancer, prostate cancer, renal cell cancer, small-cell lung cancer (SCLC) or triple negative breast cancer, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), diffuse large B-cell lymphoma (DL
- the inventive method may be used to identify or predict likely candidates (e.g. cancer patients who will respond to a treatment with an immune checkpoint inhibitor, such as an anti-PD-L1 antibody, or anti-PD-1 antibody with one of the following anti-PD-L1 antibodies avelumab, atezolizumab, durvalumab, LY300054, BMS- 936559, or anti-PD-1 antibodies pembrolizumab, nivolumab, or Pf-06801591.
- an immune checkpoint inhibitor such as an anti-PD-L1 antibody, or anti-PD-1 antibody with one of the following anti-PD-L1 antibodies avelumab, atezolizumab, durvalumab, LY300054, BMS- 936559, or anti-PD-1 antibodies pembrolizumab, nivolumab, or Pf-06801591.
- an immune checkpoint inhibitor such as an anti-PD-L1 antibody, or anti-PD-1 antibody with one of the following anti-PD-L
- a human patient suffering from a malignancy as disclosed above, or a human at risk of having cancer by applying the above inventive method is found to be a likely candidate for the treatment with an anti-PD-L1 antibody, e.g. one of avelumab, atezolizumab, durvalumab, LY300054, BMS-936559, or with an anti-PD-1 antibody, e.g.
- one of pembrolizumab, nivolumab, or Pf-06801591 may be administered alone or in combination with other anti-cancer agents in a dose from about 0.1 mg/kg to about 50 mg/kg, from about 0.5 mg/kg, 0.75 mg/kg, 1 mg/kg, 1.5 mg/kg, 2.5 mg/kg, 5 mg/kg, 7.5 mg/kg, 10 mg/kg, to about 12.5 mg/kg, 15 mg/kg, 17.5 mg/kg, 20 mg/kg, 25 mg/kg, 27.5 mg/kg, 30 mg/kg, 35 mg/kg, 37.5 mg/kg, 40 mg/kg, 42.5 mg/kg, 45 mg/kg, or e.g.
- the anti-PD-L1 antibodies avelumab, atezolizumab, durvalumab, or e.g. the anti PD-1 antibodies pembrolizumab, nivolumab, or Pf-06801591 may e.g. be administered to likely candidates which have been identified by applying the inventive method as disclosed above in a flat dosing regimen, e.g.
- avelumab may be administered at flat dosing regimen of 500-800 mg every week, e.g. from about 600 mg - 750 mg every week, or e.g. from about 650-850 mg every week, or e.g. from about 700 - 900 mg every week, or e.g. 525 mg every week, 550 mg every week, 600 mg every week, 625 mg every week, 650mg every week, 700 mg every week, 725 mg every week, 750 mg every week, or e.g. from about 900 to about 1600 mg every two weeks, e.g.
- q2w from about 1000 mg to about 1500 mg every two weeks (q2w), or from about 1250 mg to about 1400 mg q2w, or from about 1000 mg q2w to about 1250 mg q2w, e.g. 925 mg q2w, 950 mg q2w, 1000 mg q2w, 1 125 mg q2w, 1200 mg q2w, 1250 mg q2w, 1300 mg q2w, 1350 mg q2w, 1400 mg q2w, 1450 mg q2w, 1500 mg q2w, 1550 mg q2w, or e.g.
- the term "mg/kg” as used above refers to milligrams of anti-PD-L1 or anti- PD-1 antibody per kilogram body weight of a patient that will be subject to treatment with the respective antibody.
- the terms "q2w” and “q3w” as used herein shall indicate an administration every two weeks, or every three weeks.
- the term “mg/kg” as used above refers to milligrams of anti-PD-L1 (or e.g. anti-PD-1 ) antibody per kilogram body weight.
- the present invention pertains to the use of the inventive antibody or antigen binding fragment thereof in the inventive method for predicting that a patient suffering from a malignancy is a likely candidate for treatment with an anti-PD-L1 antibody, or anti-PD- 1 antibody.
- the inventive antibody or antigen-binding fragment may be used in immunohistochemistry to detect PD-L1 expression in the FFPE tumor tissue sample and subsequently subjecting the sample to visual assessment of PD-L1 expression (scoring) to determine the number of PD-L1 positive cells, e.g. tumor cells, or TILs as disclosed above.
- the inventive antibody or antigen-binding fragment thereof may e.g. also be used in dual-color immunofluorescence to label TILs.
- dual color fluorescence may include the inventive antibody and one of an anti-CD8 antibody, anti-CD163 antibody, anti-CD3 antibody, anti-CD1 1 c antibody, anti-CD56 antibody, anti-CD68 antibody, anti-Granzyme B antibody, or anti-FoxP3 antibody, whereby the antibodies are derived from different species to allow detection of both, the inventive antibody and of the TIL-specific antibody.
- Dual immunofluorescence may e.g. be carried out utilizing commercial kits, such as Novocastra PowerVision Poly-HRP IHC detection system and subsequent use of Alexa Fluor 594-, or Alexa Fluor 488 Tyramide Signal Amplification (TSA) Kit according to the manufacturer's instructions.
- the scoring of PD-L1 positive cells may e.g.
- IHC scores based on PD-L1 positive tumor cells, PD-L1 positive immune cells (e.g. TILs, macrophages), or the aggregate score of PD-L1 positive tumor and immune cells e.g. with IHC scores of 0, 1 , 2, or 3 corresponding to ⁇ 1 % PD-L1 positive cells (IHC score of 0), >1 %, but ⁇ 5% (IHC score of 1 ), >5%, but ⁇ 10% (IHC score of 2), or >10% (IHC score of 3).
- IHC score of 0 ⁇ 1 % PD-L1 positive cells
- IHC score of 1 >1 %
- IHC score of 2 >10%
- the IHC score may be the average score of the samples analyzed, or e.g. the IHC score may correspond to the IHC score of the sample that has the highest IHC score.
- the IHC score may e.g. also be determined by scoring both tumor cells expressing PD-L1 using the inventive antibody or antigen-binding fragment thereof as a percentage of total tumor cells and tumor- infiltrating immune cells expressing PD-L1 as a percentage of tumor area. Samples may e.g.
- the present invention provides for a method of treatment of cancer in a patient who has been identified as a likely candidate to respond to the treatment with an immune checkpoint inhibitor by applying the inventive method as disclosed above to a sample obtained or derived from said patient and determining PD-L1 expression in that sample and in a second step comparing the expression of PD-L1 in that sample to the PD-L1 expression in a reference sample, and in a third step administering an immune checkpoint inhibitor, such as an anti-PD-L1 , or anti-PD-1 antibody to said patient if the PD-L1 expression in the sample of said patient is found to be increased or above a certain threshold.
- an immune checkpoint inhibitor such as an anti-PD-L1 , or anti-PD-1 antibody
- the threshold refers to a relative abundance of PD-L1 expression in the patient-derived sample compared to that of the reference sample as determined by the inventive method as disclosed above.
- the threshold may be defined as the relative increase in PD-L1 positive cells in the patient sample compared to the reference sample, or e.g. may be defined as an absolute or relative number of PD-L1 positive cells in said sample, e.g. 0.5%, 1 %, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 40%, 50%, 75%, 80%, >1 %, >5%, >10%, >20%, >50%, >75%, >80% of the cells in the sample, or e.g.
- the threshold may be based on IHC score or scoring method as disclosed above.
- the reference sample used in the inventive method of treatment may e.g. be derived from a healthy donor who is not inflicted with cancer and which is subjected to the same method of detection of PD- L1 expression using the inventive antibody or antigen-binding fragment as disclosed above, such as e.g. IHC on FFPE tissue samples.
- the reference sample may be obtained from the corresponding tissue and location as the sample obtained from the patient and is preferably processed in parallel to the sample from said patient.
- the reference sample may e.g. may also be derived from the same tissue or organ as the tumor tissue sample if it is obtained from an area or location that is not diseased., or e.g.
- Anti-PD-L1 that may e.g. be administered to a patient according to the inventive method of treatment include avelumab, atezolizumab, durvalumab, or e.g. anti-PD-1 antibodies such as pembrolizumab, nivolumab, or Pf-06801591.
- the anti-PD-L1 or anti-PD-1 antibodies are administered as disclosed above, e.g. in a dose of from about 5mg/kg to about 30 mg/kg, or e.g.
- the anti-PD-L1 antibody (e.g. avelumab) may also be administered as a flat dose every week, or every second week, or every three weeks as disclosed above, e.g. in a flat dose of 500-800 mg every week, or 900-1600 mg every two weeks, or 1250 - 2400 mg every three weeks.
- the present invention provides an isolated polynucleotide encoding the antibody or antigen binding fragment thereof.
- isolated polynucleotide refers to a polynucleotide which is at least 70%, 75%, 80%, 85%, 90%, preferably 95%, 96%, 97%, 98%, 99% pure and free of contaminants, such as e.g. proteins and/or lipids.
- inventive antibody or antigen-binding fragment thereof may e.g. be encoded by two isolated polynucleotides encoding the light chain and the heavy chain of the inventive antibody.
- the isolated polynucleotides may e.g.
- polynucleotide sequences according to SEQ ID NO: 17 and SEQ ID NO: 18 may be codon optimized to allow for a better expression of the inventive polynucleotides resulting in higher yields of the inventive antibody in a respective expression system. Codon optimization may e.g. be done using available codon usage tables as published in Nucleic Acids Res. 1988 Mar 1 1 ;16(5):1715-28, Nucleic Acids Res.
- the present invention provides for an expression vector comprising the inventive polynucleotide as disclosed above.
- expression vector refers to nucleic acid vector that comprises a gene expression control sequence, such as e.g.
- the expression vector according to the invention may comprise the polynucleotide according to SEQ ID NO: 17, or SEQ ID NO: 18, or may comprise both polynucleotides according to SEQ ID NO: 17 and SEQ ID NO: 18.
- Nucleic acid sequences necessary for expression in prokaryotes include a promoter, a ribosome binding site, optionally an operator sequence and possibly other sequences. Eukaryotic cells utilize promoters, such as e.g.
- a CMV promoter SV40 promoter, EF1 a, or CAG promoter and often enhancers and polyadenlyation signals.
- exemplary mammalian expression vectors are pCMV, pCMV- SPORT, pcDNA, or e.g. the plasmid-based multigene expression system as described in Nat Commun. 2010 Nov 16;1 :120, or e.g. if viral expression of the inventive antibody or antigen- binding fragment thereof is intended, pLKO.I -hygro, pBABE-hygro, pBABE-puro, pBABE-zeo, pLenti CMV/TO zeo DEST, pCW57.1 .
- the expression vector in eukaryotes may comprise an internal ribosomal entry site (IRES) between the inventive polynucleotide sequences providing for a bicistronic expression construct to allow expression of both polynucleotides according to SEQ ID NO: 17 and SEQ IS NO: 18 from one expression vector.
- IRES sequences that e.g. may be used may include those published in PLoS One. 2013 Dec 9;8(12):e82100, e.g. 5' AU GAU AAU AU GGCCACAACCAU G.
- Suitable expression vectors that may e.g.
- inventive polynucleotides may comprise pCMV- based expression vectors, or pD912-based vectors and variants thereof, Gateway® expression vectors, pcDNA-based expression vectors, or pJQ vectors (see e.g. Nucleic Acids Research, Vol. 18, No. 4), or vectors which may be used for retroviral or lentiviral production (see e.g. Front Biosci. 1999 Jun 1 ;4:D481 -96.).
- Suitable yeast expression vectors may e.g. utilize GAL4, PGK, ADH1 , ADE2 or TRP1 promoters for the expression of the inventive polynucleotides, e.g.
- inventive polynucleotides as disclosed above may e.g. also be expressed in insect cells using expression vectors comprising a polyhedrin promoter such as e.g.
- the expression vector comprising the inventive polynucleotide is a mammalian expression vector.
- the present invention pertains to the use of an expression vector according to the invention in producing the inventive antibody comprising the amino acid sequences according to SEQ ID NO: 15 and SEQ ID NO: 16.
- the at least on vector according to the invention which comprises polynucleotides encoding the amino acid sequences according to SEQ ID NO: 15 and SEQ ID NO: 16 may be used in a transient expression system to express the inventive antibody.
- the transient expression system as disclosed in Methods. 2014 Jan 1 ;65(1 ):5-10 may be used.
- the inventive expression vector or at least one expression vector according to the invention may e.g. also be used for the generation of stable cell lines expressing the inventive antibody.
- the process for development of a stable cell line may e.g.
- transfected cells may be incubated at suitable growth conditions for24h-72h to allow expression of the inventive antibody, and screening for cells that have high productivity of the inventive antibody following growth recovery, serum-free suspension adaptation and amplification and clone selection.
- the inventive expression vector or e.g. the at least one expression vector of the invention comprising the polynucleotides according to SEQ ID NO:17 and/or SEQ ID NO: 18 may be used to produce or manufacture the inventive antibody as disclosed above.
- the expression vector comprising the inventive polynucleotides comprising the sequences according to SEQ ID NO:17 and/or SEQ ID NO:18 may be used to transfect at least one suitable host cell for the expression of the inventive antibody as disclosed above.
- the inventive polynucleotides according to SEQ ID NO:17 and SEQ ID NO:18 may be comprised in one expression vector, or e.g. may be comprised in two separate expression vectors that together are used in the production of the inventive antibody.
- Polynucleotides comprising the nucleotide sequences according to SEQ ID NO: 17 and SEQ ID NO:18 may e.g. be used in retroviral, or lentiviral vectors to transduce at least one suitable host cell for the expression of the inventive polynucleotides.
- the polynucleotide encoding the light chain amino acid sequence according to SEQ ID NO:15 and the polynucleotide encoding the heavy chain amino acid sequence according to SEQ ID NO:16 may be comprised on two separate expression vectors, such that both of the expression vectors have to be transfected into a suitable host cell for the production or manufacture of the inventive antibody.
- the transfection method used may e.g.
- inventive expression vector, or the at least one expression vector according to the invention may be used in recombinase-mediated cassette exchange (RMCE) using CHOK1 SV cells to generate stable cell lines for the manufacture of the inventive antibody, e.g. according to the method described in Biotechnol Prog. 2015 Nov-Dec;31 (6):1645-56.
- RMCE recombinase-mediated cassette exchange
- the present invention provides a host cell which comprises at least one expression vector as disclosed above.
- the host cell according to the invention may comprise at least one expression vector as disclosed above which encodes the inventive antibody comprising the amino acid sequences according to SEQ ID NO: 17 and SEQ ID NO:18, e.g. the host cell may comprise one expression vector as disclosed above encoding the amino acid sequence according to SEQ ID NO: 17 and a second expression vector as disclosed above which encodes the amino acid sequence according to SEQ ID NO: 18.
- the expression vectors may comprise selectable markers, e.g. antibiotic resistance genes, such as e.g. G418, zeocin, blasticidin, hygromycin B, mycophenolic acid, or puromycin.
- the inventive antibody may e.g. also be encoded by more than one expression vector of the invention, each of may comprise a different selectable marker to allow the selection of host cells which have been transfected with at least one of each of the expression vectors.
- a first expression vector if the invention comprising the polynucleotide according to SEQ ID NO: 17 may comprise a neoR gene and a second inventive expression vector may comprise bsd gene which confers resistance against blasticidin.
- a host cell which comprises both expression vectors of the invention will confer resistance to G418 and blasticidine and may be selected in growth medium containing both antibiotics.
- the host cell according to the invention may comprise the inventive polynucleotides as disclosed above stably integrated into the host cell genome, e.g. by viral transduction of the polynucleotides according to SEQ ID NO:15 and SEQ ID NO:16 including at least one, two or more selectable markers.
- the host cell according to the invention may comprise the inventive polynucleotides according to SEQ ID NO: 15 and SEQ ID NO:16 as episomes, e.g. with at least one, two different selectable markers.
- the host cell according to the invention may be a bacterial cell, insect cell, yeast cell or mammalian cell.
- a host cell according to the invention comprising at least one inventive polynucleotide or an expression vector according to the invention as disclosed above refers to any type of cell that can contain the vector according to the invention.
- the host cell can be a eukaryotic cell, e.g., plant, animal, fungi, or algae (e.g. Phaeodactylum tricornutum, Chlamydomonas reinhardtii) or can be a prokaryotic cell, e.g., bacteria or protozoa.
- the host cell can be a cultured cell or a primary cell, i.e., isolated directly from an organism, e.g., a human.
- the host cell may e.g.
- a host cell according to the invention may e.g. include Saccharomyces cerevisiae, Hansenula polymorpha, Schizosaccharomyces pombe, Schwanniomyces occidentalis, Kluyveromyceslactis, Yarrowia lipolytica and Pichia pastoris, or e.g. Sf9, Sf21 , S2, Hi5, or BTI-TN-5B1 -4 cells, or e.g. DH5a E.coli.
- the host cell according to the invention is one of HEK293, HEK293T, HEK293E, HEK 293F, NS0, per.C6, MCF-7, HeLa, Cos-1 , Cos-7, PC-12, 3T3, Vero, vero-76, PC3, U87, SAOS-2, LNCAP, DU145, A431 , A549, B35, H1299, HUVEC, Jurkat, MDA-MB-231 , MDA-MB-468, MDA-MB-435, Caco- 2, CHO, CHO-K1 , CHO-B1 1 , CHO-DG44, BHK, AGE1 .HN, Namalwa, WI-38, MRC-5, HepG2, L-929, RAB-9, SIRC, RK13, 1 1 B1 1 , 1 D3, 2.4G2, A-10, B-35, C-6, F4/80, IEC-18, L2, MH1 C1 , NR
- the present invention provides for the use of a host cell of the invention as disclosed above in the manufacture of the inventive antibody, e.g. the inventive antibody comprising the amino acid sequences according to SEQ ID NO: 15 (light chain) and SEQ ID NO:16 (heavy chain).
- a host cell according to invention in the manufacture of the inventive antibody may comprise culturing at least one host cell comprising at least one expression vector or polynucleotide of the invention comprising the polynucleotide sequences according to SEQ ID NO: 15 and/or SEQ ID NO:16 under suitable conditions that allow the expression of the inventive antibody.
- the at least one host cell of the invention comprises the polynucleotides according to SEQ ID NO: 17 and SEQ ID NO: 18 including regulatory sequences required for the expression of the polynucleotides, stably integrated into the host cell's genome.
- the at least one host cell of the invention may be allowed to grow in DMEM containing 10% FBS at 37 °C in a 10% C0 2 atmosphere or e.g. in serum-free culture medium to aid in the subsequent isolation and purification such as e.g. FreeStyleTM 293 expression medium, or OptiCHOTM medium.
- DMEM fetal calf serum
- serum-free culture medium e.g. fetal calf serum
- Grace's insect medium express Five ® SFM (Life Technologies), or High Five ® medium (Life Technologies) may be used if the at least one host cells of the invention is an insect cell as disclosed above, or YNM medium, YPD broth, or e.g.
- suitable growth conditions may comprise allowing the at least one host cell of the invention to grow between 12-408h, e.g. for about 12 to about 400h, e.g. between 14h, 16h, 18h, 20h, 24h, 36h, 48h, 72h, 96h to about 120h, 144h, 168h, 192, 216h, 240h, 264h, 288h, 312h, 336h, 360h, 384h, 408h.
- the inventive antibody or antigen binding fragment as disclosed above may be isolated and purified.
- the antibody or antigen-binding fragment of the invention may be purified and isolated by chromatography, e.g. ion-exchange chromatography, size-exclusion chromatography, ammonium sulfate precipitation, ultrafiltration, or purified using protein A sepharose, e.g. as described in Current Protocols in Molecular Biology (1997) 1 1.1 1.1 -1 1.1 1.5.
- chromatography e.g. ion-exchange chromatography, size-exclusion chromatography, ammonium sulfate precipitation, ultrafiltration, or purified using protein A sepharose, e.g. as described in Current Protocols in Molecular Biology (1997) 1 1.1 1.1 -1 1.1 1.5.
- the inventive monoclonal rabbit antibody directed against a KLH-coupled carboxyterminal peptide of PD-L1 (SEQ ID NO: 1 , RLRKGRMMDVKKCGIQDTNSKKQSDTHLEET) was generated using the same basic principal for making monoclonal antibodies as for mouse monoclonal antibodies.
- the generation of the inventive rabbit monoclonal antibody followed a four-step procedure:
- the supernatants of multiclones, subclones and recombinant antibodies were screened for binding to a PD-L1 antigen having the amino acid sequence according to SEQ ID NO: 1 by enzyme-linked immunosorbent assay ( Figure 1 ).
- the initial screen resulted in the identification of one antibody clone MKP1A07310 which was then further characterized by means of Western blotting and immunohistochemistry on FFPE tissue sections.
- A549 and MDA-MB 231 cell lines were retrieved from the cell bank at Merck KGaA, Darmstadt.
- the knockdown of human PD-L1 in MDA-MB 231 cells was performed at Merck, Darmstadt using siRNA against PD-L1 (siGENOME SMARTpool, Dharmacon).
- Primary rabbit antibodies were detected with Alexa Fluor conjugated goat anti- rabbit antibody (Invitrogen, catalog no. 21076).
- Western Blots were scanned using Odyssey scanner (LI-COR, USA). Western blotting was performed on cell lysates of PD-L1 transfected HEK293, PD-L1 expressing MDA-MB 231 , siRNA PDL1 knockdowns of MDA-MB 231 and the PD-L1 low cell line A549.
- the Western Blots showed a specific labeling of PD-L1 , that was reduced in the siRNA PD-L1 knockdown MDA-MB 231 (see Figure 2).
- PD-L1 protein has a MW of approximately 40kDa. Due to a high degree of glycosylation the MW of glycosylated PD-L1 is ⁇ 52kDa.
- the polyclonal positive control antibody (anti-CD274, diluted 1 :250) showed several bands in addition to the specific 52 kDa band indicating that this antibody has a low selectivity for PD-L1. In comparison to the polyclonal antibody, the monoclonal recombinant antibody is highly selective.
- Example 3 Antibody cloning mRNA from hybridoma cells of the inventive clone MKP1A07310 was isolated using TurboCapture Kit (Qiagen: Catalog #72232) following the manufacturer's recommendations and reverse transcribed into cDNA using oligo-dT primer.
- the variable region of heavy chain (VH) was PCR amplified using proprietary Epitomics primers OYZ64-2 and OYZvh3.
- the entire light chain (LC) was PCR amplified using proprietary primers OYZ62 and OYZ71.
- the VH region of PCR fragments was digested using restriction enzyme Hindlll and Kpnl.
- the LC PCR fragments were digested using Hindlll and Notl.
- the resulting fragments were purified using a Qiagen PCR cleaning up kit (catalog #28016) and the resulting purified VH and LC fragments were ligated into the corresponding heavy or light chain a proprietary pTT expression vector and transformed into competent E. coli DH5 cells (MC Lab, catalog #DA-100). Resulting bacterial colonies were picked and inserts were confirmed (by expected size: approximately 440 bp for VH and 740 bp for LC) using the corresponding restriction enzymes. Plasmids with inserts of the expected size were sequenced using TT5- specific sequencing primers. Following sequence verification the entire light chain and heavy chain fragments were excised from the corresponding vector with Hindlll and Notl and subsequently purified using Qiagen PCR cleaning up kit.
- tissue microarray generated out of positive and negative control tissue with known PD-L1 protein expression was used.
- tissue microarray human normal and tumor tissue with different PD-L1 expression levels were selected.
- the expression of PD-L1 was analyzed previously on a frozen tissue microarray of human organs (BioChip, Indivumed GmbH) and on frozen human tumors using the inventive anti-PD-L1 antibody. Paraffin blocks of PD-L1 positive and negative normal human tissues were purchased from provitro GmbH (Germany).
- NSCLC non-small-cell lung carcinoma
- Sections of 3 ⁇ of FFPE tissue or tissue/cell microarrays were mounted on positively charged SuperFrostOPIus slides (Menzel-Glaser, Braunschweig, Germany).
- the immunohistochemical staining procedure, starting with the deparaffinization of sections was done with the staining instrument DiscoveryTM, or Discovery® XT (Ventana MedicalSystems, Inc., Arlington, USA; see diagram below).
- sections were heated for epitope retrieval in Tris-EDTA buffer pH 8. Endogenous peroxidase was blocked by incubation in 3% hydrogen peroxide (part of OmniMapTM Kit, Ventana Medical Systems).
- Sections were incubated with in PBS diluted antibodies and then with the secondary antibody, the HRP conjugated polymers of the OmniMap Kit, for 16 min at 37°C.
- Horseradish peroxidase (HRP) catalyzes the 3,3'- diaminobenzidine tetrahydrochloride (DAB) H202 reaction to produce an insoluble dark brown precipitate that can be visualized.
- a monoclonal rabbit IgG antibody served as negative control. Sections were counterstained with hematoxylin. Slides were washed in tap water, dehydrated, and mounted with glass coverslips in permanent mounting media Entellan® Neu (VWR, Germany). Immunohistochemical staining procedure on DiscoveryTM Instruments
- Tissue/Probe Human tissue, cancer cell lines in vitro,
- Blocking blocking of endogene peroxidase is prior to proteinase antigen retrieval and after heat antigen retrieval in the Discovery staining instrument
- PDL1 inventive antibody MKP1A07310
- Isotype rabbit monoclonal recombinant
- VMSI Dispenser VMSI Dispenser (unknown)
- the MiraxScan instruments calibrates brightness for every slide prior to scanning. Images were taken with the help of the MiraxViewer software. The scannings were analysed with the image analysis software Visiopharm Integrator System (VIS). Viable tissue area was outlined avoiding obvious necrotic areas and connective tissue.
- VIS Visiopharm Integrator System
- Example 5 Intra- and Inter-run variability of MKP1A07310 and MKP1 B19610
- the inventive antibody MKP1A07310 and the antibody MKP1 B19610 were characterized in two concentrations each on a cancer cell line array out of 70 cell lines to compare their binding characteristics and determine the optimum concentrations for further studies.
- the cancer cell line array CAX09_70 showed a continuous range of binding of the antibodies. In ⁇ 50% of the cell lines the signal was zero or very low. The highest binding of the antibodies showed Hs746T cells (Met amplified cell line).
- the antibody MKP1A07310 showed only minor increase of signal intensity upon increasing its concentration from 1 to 2 ⁇ g/ml, indicating that 1 ⁇ g/ml was already near the saturating concentration.
- Antibody MKP1 B19610 showed substantial increase in signal from 5 to 10 ⁇ g/ml.
- the TMA_PDL1_1 1 was used for the selection of the antibodies generated. Sections of 3 ⁇ of formaldehyde fixed paraffin embedded (FFPE) tissue or tissue/cell microarrays were mounted on positively charged SuperFrostOPIus slides (Menzel- Glaser, Braunschweig, Germany).
- FFPE formaldehyde fixed paraffin embedded
- Antibodies used Primary antibodies: The inventive antibody MKP1A07310 ("7310 mAb") and MKP1 B19610 were used diluted into PBS: MKP1A07310 was used concentrations of 1 , 2 and 5 ⁇ g ml; antibody MKP1 B19610 was used at concentrations of 2, 5, and 10 ⁇ g ml;
- Antigen retrieval was done as follows: For the Discovery XT antigen retrieval was done using "High pH” antigen retrieval conditions (Tris-EDTA pH 8), for the AutostainerLink, testing started by using “High pH” (Tris-EDTA buffer, pH 9) antigen retreival. For antibody PD-L1 MKP1 B19610) in addition “Low pH” (Citrate buffer, pH 6.1 ) antigen retreival was used.
- HRP Horseradish peroxidase
- DAB 3,3'-diaminobenzidinetetrahydorchloride
- H2C H2C>2 reaction
- Sections were counterstained with hematoxylin.
- the inventive anti-PD-L1 antibody was used in concentrations of 1 , 2 and 5 ⁇ g/ml; antibody MKP1 B19610 was used at 2, 5, and 10 ⁇ g/m I ; for both antibodies detection was done using OmniMap anti-rabbit HRP (#760-431 1 ,VMSI) and ChromoMap (#760-159).
- HRP Horseradish peroxidase
- DAB 3,3'- diaminobenzidine tetrahydrochloride
- H2C>2 reaction horseradish peroxidase
- Sections were counterstained with hematoxylin. Slides were subsequently washed in tap water, dehydrated, and mounted with glass coverslips in permanent mounting media Entellan® Neu (VWR, Germany).
- MKP1A07310 was used at concentration sof 0.5, 1 and 2 ⁇ g ml
- MKP1 B19610 at concentrations of 0.2, 0.5, 1 , 2, and 5 g/ml.
- the inventive antibody directed against the cytoplasmic domain of PD-L1 did show the same binding characteristics in 55 FFPE cancer cell lines as on the Discovery XT staining platform from Ventana Medical Systems.
- additional binding sites of the antibody MKP1 B19610, generated against the extracellular domain were unmasked using the AutostainerLink instead of the Discovery XT.
- the inventive antibody can surprisingly be used on both widely used commercial I HC platforms, the AutostainerLink platform (DAKO) as well as on the Discovery XT staining platform from Ventana Medical Systems.
- the inventive antibody thus meets the unmet need of an anti-PD-L1 antibody which is able to reliably detected PD-L1 expression in FFPE tumor tissue samples (e.g. derived from biopsies) that are routinely used in pathology on two commonly used IHC platforms (e.g. Discovery XT® System, Ventana and AutostainerLink, Dako).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Biochemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Enzymes And Modification Thereof (AREA)
- Oncology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201780071407.5A CN109963872B (zh) | 2016-09-20 | 2017-09-20 | 诊断抗pd-l1抗体及其用途 |
| IL265485A IL265485B2 (en) | 2016-09-20 | 2017-09-20 | Diagnostic anti-PD-L1 antibody and its use |
| AU2017329780A AU2017329780B2 (en) | 2016-09-20 | 2017-09-20 | Diagnostic anti-PD-L1 antibody and use thereof |
| JP2019515405A JP7525261B2 (ja) | 2016-09-20 | 2017-09-20 | 診断用抗pd-l1抗体およびその使用 |
| CA3037230A CA3037230A1 (en) | 2016-09-20 | 2017-09-20 | Diagnostic anti-pd-l1 antibody and use thereof |
| US16/334,699 US10738120B2 (en) | 2016-09-20 | 2017-09-20 | Diagnostic anti-PD-L1 antibody and use thereof |
| EP17778222.4A EP3515942B1 (en) | 2016-09-20 | 2017-09-20 | Diagnostic anti-pd-l1 antibody and use thereof |
| ES17778222T ES3049875T3 (en) | 2016-09-20 | 2017-09-20 | Diagnostic anti-pd-l1 antibody and use thereof |
| JP2022158138A JP2023011568A (ja) | 2016-09-20 | 2022-09-30 | 診断用抗pd-l1抗体およびその使用 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP16189804 | 2016-09-20 | ||
| EP16189804.4 | 2016-09-20 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018054940A1 true WO2018054940A1 (en) | 2018-03-29 |
Family
ID=56979447
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2017/073712 Ceased WO2018054940A1 (en) | 2016-09-20 | 2017-09-20 | Diagnostic anti-pd-l1 antibody and use thereof |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US10738120B2 (OSRAM) |
| EP (1) | EP3515942B1 (OSRAM) |
| JP (2) | JP7525261B2 (OSRAM) |
| CN (1) | CN109963872B (OSRAM) |
| AU (1) | AU2017329780B2 (OSRAM) |
| CA (1) | CA3037230A1 (OSRAM) |
| ES (1) | ES3049875T3 (OSRAM) |
| IL (1) | IL265485B2 (OSRAM) |
| WO (1) | WO2018054940A1 (OSRAM) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3522923A1 (en) * | 2016-10-06 | 2019-08-14 | Pfizer Inc | Dosing regimen of avelumab for the treatment of cancer |
| US10604576B2 (en) | 2016-06-20 | 2020-03-31 | Kymab Limited | Antibodies and immunocytokines |
| US11168144B2 (en) | 2017-06-01 | 2021-11-09 | Cytomx Therapeutics, Inc. | Activatable anti-PDL1 antibodies, and methods of use thereof |
| JP2022518478A (ja) * | 2019-01-23 | 2022-03-15 | タユー ファシャ バイオテック メディカル グループ カンパニー, リミテッド | 抗pd-l1ダイアボディおよびその使用 |
| US11753479B2 (en) | 2014-03-04 | 2023-09-12 | Kymab Limited | Nucleic acids encoding anti-OX40L antibodies |
| US11779604B2 (en) | 2016-11-03 | 2023-10-10 | Kymab Limited | Antibodies, combinations comprising antibodies, biomarkers, uses and methods |
| WO2024160721A1 (en) | 2023-01-30 | 2024-08-08 | Kymab Limited | Antibodies |
| US12144875B2 (en) | 2018-06-01 | 2024-11-19 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Compositions and methods for imaging |
| US12209128B2 (en) | 2016-06-20 | 2025-01-28 | Kymab Limited | Anti-PD-L1 antibodies |
| USRE50880E1 (en) | 2015-04-30 | 2026-05-05 | Kymab Limited | Anti-human OX40L antibodies and methods of treatment |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018209270A1 (en) | 2017-05-11 | 2018-11-15 | Northwestern University | Adoptive cell therapy using spherical nucleic acids (snas) |
| CN116400075B (zh) * | 2022-10-14 | 2024-01-05 | 江西烈冰生物科技有限公司 | 检测狼疮性肾炎标志物的试剂及方法 |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5892019A (en) | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
| WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| US7732168B2 (en) | 2005-07-05 | 2010-06-08 | Epitomics, Inc | Fusion partner for production of monoclonal rabbit antibodies |
| WO2014165422A1 (en) | 2013-04-02 | 2014-10-09 | Merck Sharp & Dohme Corp. | Immunohistochemical assay for detecting expression of programmed death ligand 1 (pd-l1) in tumor tissue |
| WO2015181342A1 (en) * | 2014-05-29 | 2015-12-03 | Spring Bioscience Corporation | Pd-l1 antibodies and uses thereof |
| WO2016007235A1 (en) | 2014-07-11 | 2016-01-14 | Genentech, Inc. | Anti-pd-l1 antibodies and diagnostic uses thereof |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2612241C (en) * | 2005-07-01 | 2018-11-06 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| AU2013263076B2 (en) * | 2012-05-15 | 2017-08-31 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting PD-1/PD-L1 signaling |
| AR093984A1 (es) * | 2012-12-21 | 2015-07-01 | Merck Sharp & Dohme | Anticuerpos que se unen a ligando 1 de muerte programada (pd-l1) humano |
| WO2016124558A1 (en) * | 2015-02-03 | 2016-08-11 | Ventana Medical Systems, Inc. | Histochemical assay for evaluating expression of programmed death ligand 1 (pd-l1) |
-
2017
- 2017-09-20 JP JP2019515405A patent/JP7525261B2/ja active Active
- 2017-09-20 AU AU2017329780A patent/AU2017329780B2/en active Active
- 2017-09-20 US US16/334,699 patent/US10738120B2/en active Active
- 2017-09-20 CN CN201780071407.5A patent/CN109963872B/zh active Active
- 2017-09-20 IL IL265485A patent/IL265485B2/en unknown
- 2017-09-20 WO PCT/EP2017/073712 patent/WO2018054940A1/en not_active Ceased
- 2017-09-20 EP EP17778222.4A patent/EP3515942B1/en active Active
- 2017-09-20 CA CA3037230A patent/CA3037230A1/en active Pending
- 2017-09-20 ES ES17778222T patent/ES3049875T3/es active Active
-
2022
- 2022-09-30 JP JP2022158138A patent/JP2023011568A/ja active Pending
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5892019A (en) | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
| US7732168B2 (en) | 2005-07-05 | 2010-06-08 | Epitomics, Inc | Fusion partner for production of monoclonal rabbit antibodies |
| WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| WO2014165422A1 (en) | 2013-04-02 | 2014-10-09 | Merck Sharp & Dohme Corp. | Immunohistochemical assay for detecting expression of programmed death ligand 1 (pd-l1) in tumor tissue |
| WO2015181342A1 (en) * | 2014-05-29 | 2015-12-03 | Spring Bioscience Corporation | Pd-l1 antibodies and uses thereof |
| WO2016007235A1 (en) | 2014-07-11 | 2016-01-14 | Genentech, Inc. | Anti-pd-l1 antibodies and diagnostic uses thereof |
Non-Patent Citations (60)
| Title |
|---|
| "Antibodies: A Laboratory Manual", CSH PRESS |
| "Cancer Cell Culture: Methods and Protocols (Methods in Molecular Medicine", HUMANA PRESS |
| "Curr Protoc Mol Biol", May 2001 |
| "GenBank", Database accession no. AAH69381 |
| "Immunohistochemical Staining Methods", 2009, DAKO NORTH AMERICA, INC |
| "the CRC Handbook of Chemistry and Physics", 2002, CRC PRESS |
| ALIVISATOS, J. PHYS. CHEM., vol. 100, 1996, pages 13226 - 13239 |
| ALIVISATOS, SCIENCE, vol. 271, 1996, pages 933 - 937 |
| BIOINFORMATICS, vol. 30, no. 15, 1 August 2014 (2014-08-01), pages 2210 - 2 |
| BIOTECHNOL PROG, vol. 31, no. 6, November 2015 (2015-11-01), pages 1645 - 56 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 |
| CANCER IMMUNOL RES, vol. 2, no. 4, April 2014 (2014-04-01), pages 361 - 370 |
| CANCER RESEARCH, vol. 54, 1 December 1994 (1994-12-01), pages 6176 - 618 |
| CANCER, vol. 117, 2011, pages 2192 - 201 |
| CANCER, vol. 117, no. 10, 15 May 2011 (2011-05-15), pages 2192 - 201 |
| CARVAJAL-HAUSORF ET AL., LABORATORY INVESTIGATION, vol. 95, 2015, pages 385 - 396 |
| CELL BIOL, vol. 63, 2001, pages 185 - 204 |
| CHEM COMMUN (CAMB, vol. 695, no. 7, 21 February 2007 (2007-02-21), pages 7 |
| CHOWDHURY ET AL., ONCOTARGET, 12 April 2016 (2016-04-12) |
| COLLOIDS; SURFACES B, BIOINTERFACES, vol. 84, 2011, pages 360 - 368 |
| CURRENT PROTOCOLS IN IMMUNOLOGY, November 2013 (2013-11-01), pages 21.4.21 - 21.4.26 |
| CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1991, pages 11.2.1 - 11.2.22 |
| CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1997, pages 11.11.1 - 11.11.5 |
| CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, January 2008 (2008-01-01), pages 14.6.1 - 14.6.23 |
| CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, July 2008 (2008-07-01), pages 10.8.1 - 10.8.28 |
| FRONT BIOSCI, vol. 4, 1 June 1999 (1999-06-01), pages D481 - 96 |
| GANDINI ET AL., CRIT REV ONCOL HEMATOL, vol. 100, April 2016 (2016-04-01), pages 88 - 98 |
| HEMATOLOGY, vol. 31, March 2016 (2016-03-01), pages 1 - 6 |
| HERBST ET AL., NATURE, vol. 515, no. 7528, 27 November 2014 (2014-11-27), pages 563 - 7 |
| HO ET AL., GENE, vol. 77, 1989, pages 51 |
| HOPWOOD D.: "Fixatives and fixation: a review", HISTOCHEM J., vol. 1, no. 4, 1969, pages 323 - 60 |
| JACQUELYN SMITH ET AL: "Quantitative and qualitative characterization of Two PD-L1 clones: SP263 and E1L3N", DIAGNOSTIC PATHOLOGY, vol. 11, no. 1, 18 May 2016 (2016-05-18), XP055426740, DOI: 10.1186/s13000-016-0494-2 * |
| JAN TRØST JØRGENSEN: "Companion diagnostic assays for PD-1/PD-L1 checkpoint inhibitors in NSCLC", EXPERT REVIEW OF MOLECULAR DIAGNOSTICS, vol. 16, no. 2, 27 November 2015 (2015-11-27), GB, pages 131 - 133, XP055426614, ISSN: 1473-7159, DOI: 10.1586/14737159.2016.1117389 * |
| JIAN HONG ET AL: "Frequent PD-L1 expression in thymic squamous cell carcinoma of Chinese patients", JOURNAL OF THORACIC DISEASE J THORAC DIS, 1 January 2015 (2015-01-01), pages S181, XP055426574, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4700338/pdf/jtd-07-S3-AB056.pdf> [retrieved on 20171120], DOI: 10.3978/j.issn.2072-1439.2015.AB055 * |
| JOURNAL OF IMMUNOLOGICAL METHODS, vol. 345, 2009, pages 40 - 48 |
| JOURNAL OF IMMUNOLOGICAL METHODS, vol. 353, 2010, pages 148 - 150 |
| KAUFMAN HOWARD L ET AL: "Avelumab in patients with chemotherapy-refractory metastatic Merkel cell carcinoma: a multicentre, single-group, open-label, phase 2 trial", THE LANCET ONCOLOGY, ELSEVIER, AMSTERDAM, NL, vol. 17, no. 10, 1 September 2016 (2016-09-01), pages 1374 - 1385, XP029757502, ISSN: 1470-2045, DOI: 10.1016/S1470-2045(16)30364-3 * |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 |
| LLIE ET AL., ANNALS OF ONCOLOGY, vol. 27, 2016, pages 147 - 153 |
| METHODS CELL BIOL., vol. 36, 1991, pages 675 - 7 |
| METHODS MOL BIOL, vol. 588, 2010, pages 43 - 8 |
| METHODS, vol. 65, no. 1, 1 January 2014 (2014-01-01), pages 5 - 10 |
| MILENIC ET AL., CANCER RESEARCH, vol. 51, 1991, pages 6363 |
| N ENGL J MED, vol. 366, 2012, pages 2443 - 54 |
| NANOTECHNOLOGY, vol. 22, no. 49, 9 December 2011 (2011-12-09), pages 494006 |
| NAT COMMUN, vol. 1, 16 November 2010 (2010-11-16), pages 120 |
| NAT MED., vol. 4, no. 7, July 1998 (1998-07-01), pages 844 - 7 |
| NUCLEIC ACIDS RES., vol. 16, no. 17, 12 September 1988 (1988-09-12), pages 8207 - 11 |
| NUCLEIC ACIDS RES., vol. 16, no. 5, 11 March 1988 (1988-03-11), pages 1715 - 28 |
| NUCLEIC ACIDS RESEARCH, vol. 18, no. 4 |
| PANTOLIANO ET AL., BIOCHEMISTRY, vol. 30, 1991, pages 10117 |
| PARDOLL, NATURE REV CANCER, vol. 12, 2012, pages 252 - 264 |
| PLOS ONE, vol. 11, no. 3, 29 March 2016 (2016-03-29), pages e0152282 |
| PLOS ONE, vol. 8, no. 12, 9 December 2013 (2013-12-09), pages e82100 |
| PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 9348 - 9352 |
| PROTEIN ENGINEERING, DESIGN & SELECTION, vol. 23, no. 4, 2010, pages 195 - 202 |
| TAKKINEN ET AL., PROTEIN ENGINEERING, vol. 4, 1991, pages 837 |
| TRENDS BIOTECHNOL, vol. 31, no. 6, June 2013 (2013-06-01), pages 347 - 354 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 46 |
| WELLER, ANGEW. CHEM. INT. ED. ENGL., vol. 32, 1993, pages 41 - 53 |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11753479B2 (en) | 2014-03-04 | 2023-09-12 | Kymab Limited | Nucleic acids encoding anti-OX40L antibodies |
| US11773175B2 (en) | 2014-03-04 | 2023-10-03 | Kymab Limited | Antibodies, uses and methods |
| USRE50880E1 (en) | 2015-04-30 | 2026-05-05 | Kymab Limited | Anti-human OX40L antibodies and methods of treatment |
| US10604576B2 (en) | 2016-06-20 | 2020-03-31 | Kymab Limited | Antibodies and immunocytokines |
| US12209128B2 (en) | 2016-06-20 | 2025-01-28 | Kymab Limited | Anti-PD-L1 antibodies |
| EP3522923A1 (en) * | 2016-10-06 | 2019-08-14 | Pfizer Inc | Dosing regimen of avelumab for the treatment of cancer |
| US11779604B2 (en) | 2016-11-03 | 2023-10-10 | Kymab Limited | Antibodies, combinations comprising antibodies, biomarkers, uses and methods |
| US11168144B2 (en) | 2017-06-01 | 2021-11-09 | Cytomx Therapeutics, Inc. | Activatable anti-PDL1 antibodies, and methods of use thereof |
| US12144875B2 (en) | 2018-06-01 | 2024-11-19 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Compositions and methods for imaging |
| JP7538130B2 (ja) | 2019-01-23 | 2024-08-21 | タユー ファシャ バイオテック メディカル グループ カンパニー, リミテッド | 抗pd-l1ダイアボディおよびその使用 |
| US12263234B2 (en) | 2019-01-23 | 2025-04-01 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Anti-PD-L1 diabodies and the use thereof |
| JP2022518478A (ja) * | 2019-01-23 | 2022-03-15 | タユー ファシャ バイオテック メディカル グループ カンパニー, リミテッド | 抗pd-l1ダイアボディおよびその使用 |
| WO2024160721A1 (en) | 2023-01-30 | 2024-08-08 | Kymab Limited | Antibodies |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2019532633A (ja) | 2019-11-14 |
| AU2017329780A1 (en) | 2019-05-02 |
| EP3515942B1 (en) | 2025-07-30 |
| CN109963872B (zh) | 2023-04-11 |
| IL265485A (en) | 2019-05-30 |
| IL265485B2 (en) | 2024-07-01 |
| IL265485B1 (en) | 2024-03-01 |
| CA3037230A1 (en) | 2018-03-29 |
| JP2023011568A (ja) | 2023-01-24 |
| US10738120B2 (en) | 2020-08-11 |
| CN109963872A (zh) | 2019-07-02 |
| EP3515942A1 (en) | 2019-07-31 |
| JP7525261B2 (ja) | 2024-07-30 |
| AU2017329780B2 (en) | 2024-11-14 |
| ES3049875T3 (en) | 2025-12-18 |
| US20190211104A1 (en) | 2019-07-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10738120B2 (en) | Diagnostic anti-PD-L1 antibody and use thereof | |
| AU2014339900B2 (en) | Anti-PD-L1 monoclonal antibodies and fragments thereof | |
| EP2501724B1 (en) | Monoclonal antibodies and diagnostic uses thereof | |
| EP3149042B1 (en) | Pd-l1 antibodies and uses thereof | |
| EP3029069B1 (en) | Anti-human cd26 monoclonal antibody or antigen-binding fragment thereof | |
| WO2014165082A2 (en) | Antibodies and methods of detection | |
| JP2006517109A (ja) | アンフィレグリン抗体ならびに癌および乾癬を処置するためのその使用 | |
| JP2006517109A5 (OSRAM) | ||
| WO2009067546A2 (en) | Lung cancer markers and uses thereof | |
| JP6944925B2 (ja) | 組織浸潤nk細胞を検出する方法 | |
| KR20110005812A (ko) | 항-글리피칸-3 항체를 사용하여 간암 세포를 검출하는 방법 | |
| JP2023526044A (ja) | 免疫療法のための腫瘍バイオマーカー | |
| Zhang et al. | Dysfunctional antibodies in the tumor microenvironment associate with impaired anticancer immunity | |
| CA2729593A1 (en) | B7-h3 as a biomarker for diagnosing the progression and early lymph node metastasis of cancer | |
| WO2021037319A1 (en) | Immunohistochemical assessment of b7-h3 expression | |
| CN121240891A (zh) | 使用抗c-met抗体药物缀合物的治疗方法 | |
| WO2026085565A1 (en) | Antigen-binding molecules and uses thereof | |
| JP2023540452A (ja) | 抗体を使用した細胞表面mica及びmicbの検出 | |
| HK1176940B (en) | Monoclonal antibodies and diagnostic uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17778222 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3037230 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019515405 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017778222 Country of ref document: EP Effective date: 20190423 |
|
| ENP | Entry into the national phase |
Ref document number: 2017329780 Country of ref document: AU Date of ref document: 20170920 Kind code of ref document: A |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2017778222 Country of ref document: EP |