WO2018049237A1 - Methods and compositions for treatment of lafora disease - Google Patents

Methods and compositions for treatment of lafora disease Download PDF

Info

Publication number
WO2018049237A1
WO2018049237A1 PCT/US2017/050787 US2017050787W WO2018049237A1 WO 2018049237 A1 WO2018049237 A1 WO 2018049237A1 US 2017050787 W US2017050787 W US 2017050787W WO 2018049237 A1 WO2018049237 A1 WO 2018049237A1
Authority
WO
WIPO (PCT)
Prior art keywords
chimeric polypeptide
antibody
amino acid
seq
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/050787
Other languages
English (en)
French (fr)
Inventor
Dustin D. Armstrong
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Valerion Therapeutics LLC
Original Assignee
Valerion Therapeutics LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Valerion Therapeutics LLC filed Critical Valerion Therapeutics LLC
Priority to AU2017322483A priority Critical patent/AU2017322483A1/en
Priority to EP17849664.2A priority patent/EP3509614A4/en
Priority to CN201780069052.6A priority patent/CN109963576A/zh
Priority to JP2019513898A priority patent/JP2019535645A/ja
Priority to CA3036524A priority patent/CA3036524A1/en
Priority to US16/332,331 priority patent/US10781433B2/en
Publication of WO2018049237A1 publication Critical patent/WO2018049237A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/44Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2405Glucanases
    • C12N9/2408Glucanases acting on alpha -1,4-glucosidic bonds
    • C12N9/2411Amylases
    • C12N9/2414Alpha-amylase (3.2.1.1.)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • Glycogen storage diseases and glycogen metabolism disorders are a series of diseases that are caused by defects in basic metabolizing enzymes, thereby resulting in defects in glycogen synthesis or breakdown within muscles, liver, neurons and other cell types.
  • Glycogen storage diseases may be either genetic (usually as autosomal recessive disorders) or acquired (e.g., by intoxication with alkaloids) (Monga et al.,).
  • Lafora Disease also called Lafora progressive myoclonic epilepsy or MELF
  • MELF Lafora progressive myoclonic epilepsy
  • Lafora Disease The prevalence of Lafora Disease is unknown. While this disease occurs worldwide, it is most common in Mediterranean countries, parts of Central Asia, India, Pakistan, North Africa and the Middle East. In Western countries, the prevalence is estimated to be below 1/1,000,000.
  • Lafora Disease is an autosomal recessive disorder caused by mutations in one of two genes: EPM2A and EPM2B.
  • EPM2A encodes for the 331 amino acid protein known as laforin, which comprises an amino-terminal carbohydrate binding module and a carboxy- terminal dual specificity phosphatase domain.
  • EPM2B encodes for the E3 ubiquitin ligase known as malin.
  • laforin and malin make up a functional complex which is believed to be involved in negatively regulating glucose uptake by modulating the subcellular localization of glucose transporters.
  • references to clearing glycogen build-up or decreasing glycogen accumulation encompass, unless otherwise specified, clearing or decreasing excess (e.g., beyond normal physiological level) glycogen, including clearing or decreasing excess glycogen present in an abnormal form ⁇ e.g., polyglucosan).
  • the disclosure provides methods of clearing or decreasing excess polyglucosan ⁇ e.g., clearing or decreasing polyglucosan accumulation), such as in cytoplasm, such as in one or more of muscle cells (skeletal and/or cardiac) , diaphragm, or neurons.
  • clearing glycogen build-up or decreasing glycogen accumulation refers to doing so in, at least, cytoplasm of one or more affected cells.
  • clearing glycogen build-up or decreasing glycogen accumulation such as in, at least, cytoplasm
  • Such methods and compositions would improve treatment of diseases or disorders such as Lafora Disease, particularly in patients whose disease is severe enough and/or advanced enough to have significant abnormal cytoplasmic glycogen accumulation (e.g., of normal and/or abnormal glycogen).
  • the present disclosure provides such methods and compositions.
  • the methods and compositions provided herein decrease glycogen build-up (e.g., such as clear glycogen build-up or decrease glycogen accumulation) in, at least, the cytoplasm.
  • the methods and compositions of the present disclosure decrease polyglucosan build-up (e.g., build-up in, at least, the cytoplasm of cell(s), such as muscle and/or liver and/or diaphragm, and/or neuronal cell(s)).
  • the methods and compositions of the present disclosure decrease glycogen, such as polyglucosan, build-up in, at least, cytoplasm of, at least muscle and/or neuronal cells.
  • the disclosure provides for a chimeric polypeptide comprising: (i) an alpha-amylase polypeptide, and (ii) an internalizing moiety; wherein the alpha-amylase polypeptide comprises the amino acid sequence of SEQ ID NO: 1 ; and wherein the internalizing moiety is an antibody or antigen binding fragment, wherein the antibody or antigen binding fragment comprises a heavy chain variable domain and a light chain variable domain; wherein the heavy chain variable domain comprises the amino acid sequence of SEQ ID NO: 2; and wherein the light chain variable domain comprises the amino acid sequence of SEQ ID NO: 3.
  • the disclosure provides for a chimeric polypeptide comprising: (i) an alpha-amylase polypeptide, and (ii) an internalizing moiety; wherein the alpha-amylase polypeptide comprises the amino acid sequence of SEQ ID NO: 1, but wherein the alpha-amylase polypeptide does not comprise the full-length alpha-amylase polypeptide of SEQ ID NO: 36; and wherein the internalizing moiety is an antibody or antigen binding fragment, wherein the antibody or antigen binding fragment comprises a heavy chain comprising a heavy chain variable domain and a light chain comprising a light chain variable domain; wherein the heavy chain variable domain comprises the amino acid sequence of SEQ ID NO: 2; and wherein the light chain variable domain comprises the amino acid sequence of SEQ ID NO: 3.
  • the alpha-amylase polypeptide consists of the amino acid sequence of SEQ ID NO: 1.
  • the heavy chain comprises the leader sequence of SEQ ID NO: 4.
  • the light chain comprises the leader sequence of SEQ ID NO: 5.
  • the chimeric polypeptide has alpha- 1,4-glucosidic bonds hydrolytic activity.
  • the chimeric polypeptide is capable of hydrolyzing alpha-1,4- glucosidic bonds in a cell-free system.
  • the chimeric polypeptide is capable of hydrolyzing alpha- 1,4-glucosidic bonds in a cell from a subject having Lafora Disease.
  • the subject is a non-human animal. In some embodiments, the non-human animal is a mouse. In some embodiments, the subject is a human. In some embodiments, the cell is in vitro. In some embodiments, the cell is a muscle cell. In some embodiments, the cell is a diaphragm muscle cell. In some embodiments, the cell is a brain cell. In some embodiments, the cell is a neuron. In some embodiments, the alpha-amylase polypeptide is chemically conjugated to the internalizing moiety. In some embodiments, the chimeric polypeptide comprises a fusion protein comprising the alpha-amylase polypeptide and all or a portion of the internalizing moiety.
  • the chimeric polypeptide does not include a linker interconnecting the alpha-amylase polypeptide to the internalizing moiety.
  • the fusion protein comprises a linker.
  • the linker conjugates or joins the alpha-amylase polypeptide to the internalizing moiety.
  • the linker is a cleavable linker.
  • the linker comprises the amino acid sequence of SEQ ID NO: 6.
  • all or a portion of the internalizing moiety is conjugated or joined, directly or via a linker, to the N-terminal amino acid of the alpha-amylase polypeptide.
  • the internalizing moiety promotes delivery of the chimeric polypeptide into cells via an equilibrative nucleoside transporter (ENT) transporter. In some embodiments, the internalizing moiety promotes delivery of the chimeric polypeptide into cells via ENT2. In some embodiments, the internalizing moiety promotes delivery of the chimeric polypeptide into a muscle cell.
  • ENT equilibrative nucleoside transporter
  • the muscle cell is a diaphragm muscle cell.
  • the internalizing moiety promotes delivery of the chimeric polypeptide into a neuronal cell.
  • the neuronal cell is a brain neuronal cell.
  • the internalizing moiety comprises an antibody.
  • the antibody is a monoclonal antibody.
  • the internalizing moiety comprises an antigen-binding fragment.
  • the antigen-binding fragment is a Fab.
  • the antigen-binding fragment is a Fab'.
  • the antigen-binding fragment is an scFv.
  • the chimeric polypeptide is produced recombinantly. In some embodiments, the chimeric polypeptide is produced in a prokaryotic or eukaryotic cell. In some embodiments, the eukaryotic cell is selected from a yeast cell, an avian cell, an insect cell, or a mammalian cell. In some embodiments, one or more glycosylation groups are conjugated to the chimeric polypeptide. In some embodiments, the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO: 7. In some embodiments, the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO: 8. In some embodiments, the chimeric polypeptide comprises the amino acid sequence of SEQ ID NOs: 7 and 8.
  • the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO: 9. In some embodiments, the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO: 10. In some embodiments, the chimeric polypeptide comprises the amino acid sequence of SEQ ID NOs: 9 and 10. In some embodiments, the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO: 43. In some embodiments, the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO: 8. In some embodiments, the chimeric polypeptide comprises the amino acid sequences of SEQ ID NOs: 8 and 43.
  • the disclosure provides for a nucleic acid construct, comprising a nucleotide sequence that encodes any of the chimeric polypeptides disclosed hereing as a chimeric polypeptide comprising a fusion protein.
  • the nucleotide sequence is codon optimized for expression in a mammalian cell.
  • the mammalian cell is a CHO cell or a HEK-293 cell.
  • the disclosure provides for a set of nucleic acid constructs, together comprising nucleotide sequences that encode any of the chimeric polypeptides disclosed herein.
  • the nucleotide sequences are codon optimized for expression in a mammalian cell.
  • the mammalian cell is a CHO cell or a HEK-293 cell.
  • the disclosure provides for a vector comprising any of the nucleic acid constructs disclosed herein. In some embodiments, the disclosure provides for a set of vectors comprising any of the sets of nucleic acid constructs disclosed herein..
  • the disclosure provides for a host cell comprising any of the vectors or sets of vectors disclosed herein.
  • the disclosure provides for a method for delivering alpha- amylase activity into a cell from or of a subject having Lafora Disease, comprising contacting the cell with any of the chimeric polypeptides disclosed herein.
  • the subject is a non-human animal.
  • the non-human animal is a mouse.
  • the subject is a human.
  • the cell is in the subject.
  • the cell is a muscle cell.
  • the cell is a diaphragm muscle cell.
  • the cell is a brain cell.
  • the cell is a neuron.
  • the cell is in vitro.
  • the disclosure provides for a method for treating a subject having Lafora disease, comprising administering to the subject a therapeutically effective amount of any of the chimeric polypeptides disclosed herein.
  • the subject is a non-human animal.
  • the subject is a mouse.
  • the subject is a human.
  • the patent or application file contains at least one drawing executed in color.
  • FIG. 1 demonstrates dose dependent uptake of Fab-amylase in ENT2+ C2C12 myotubes.
  • a comparison of -Fab-amylase and +Fab-amylase at 0.01 mg/ml and 0.1 mg/ml is provided. (Notes: Anti-H3L2, Rabbit pAb, 1 : 100; Donkey Anti-Rabbit-HRP, 1 :20000).
  • FIG. 2 is a graph demonstrating glycogen reduction in ENT2+ C2C12 myotubes.
  • FIGS. 3 A-3F summarize the results of a Lafora body purification scheme. The scheme includes (1) homogenizing tissue, resuspending and centrifuging; (2) digesting overnight with Proteinase K; (3) filtering; and (4) washing with SDS and buffer.
  • FIGS. 3 A- 3D are images showing Lafora bodies in the brain (FIG. 3A and FIG. 3C), heart (FIG. 3B), and skeletal muscle (FIG. 3D).
  • FIG. 3A and FIG. 3C the brain
  • FIG. 3B heart
  • FIG. 3D skeletal muscle
  • FIG. 3E is a graph showing the yield (mg per g tissue) of Lafora bodies isolated from the homogenate, pellet and final sample from the brain, heart and skeletal muscle of a Lafora knock out mouse.
  • FIG. 3F is a graph showing the yield (mg per g tissue) of iodine (indicating glycogen) and total glucose from samples of the brain, heart and skeletal muscle.
  • FIGS. 4A-4B show purified Lafora bodies can be degraded by Fab-amylase but not by Fab-glucosidase.
  • FIG. 4A is a graph showing the percent of degradation of Lafora bodies from the brain, heart, and skeletal muscle when treated with Fab-amylase, Fab- glucosidase or control.
  • FIG. 4B is a graph showing the Lafora body content ⁇ g per mL extract) of WT and KO mice treated with -Fab-amylase and +Fab-amylse.
  • FIGS. 5A-5B demonstrate injected Fab-amylase is active in the muscle and brain.
  • FIG. 5 A is a graph showing amylase activity in the muscle 1 hr post-injection, 2 hrs post- injection, 4 hrs post-injection, and 24 hrs post-injection.
  • FIG. 5B shows amylase activity (lower panel) for samples of the brain identified (upper panel) immediately post-injection and 1 hour post-injection.
  • FIG. 6 shows Periodic acid-Schiff (PAS) staining of the Tibialis anterior (TA) muscle of an 8.5 month old female mouse injected with a vehicle (PBS) in the left leg (left panel) and Fab-Amylase in the right leg (right panel).
  • PBS Periodic acid-Schiff
  • FIGS. 7 shows Periodic acid-Schiff (PAS) staining of the Tibialis anterior (TA) muscle of an 8.5 month old female mouse injected with a vehicle (PBS) in the left leg (left panel) and Fab-Amylase in the right leg (right panel).
  • PBS Periodic acid-Schiff
  • FIGS. 8 shows Periodic acid-Schiff (PAS) staining of the Tibialis anterior (TA) muscle of an 8.5 month old female mouse injected with a vehicle (PBS) in the left leg (left panel) and a vehicle (PBS) in the right leg (right panel).
  • PBS Periodic acid-Schiff
  • FIGS. 9 shows Periodic acid-Schiff (PAS) staining of the Tibialis anterior (TA) muscle of a 4 month old female mouse injected with a vehicle (PBS) in the left leg (left panel) and Fab-Amylase in the right leg (right panel).
  • PBS Periodic acid-Schiff
  • Glycogen is a complex polysaccharide that provides a ready store of glucose to cells in the human body. Glycogen is found principally in the liver, where it is hydrolyzed and released into the bloodstream to provide glucose to other cells, and in muscle, where the glucose resulting from glycogen hydrolysis provides energy for muscle cells.
  • the proteins laforin, malin and alpha-amylase are believed to play a role in glycogen clearance.
  • the disclosure provides for a polypeptide comprising any of the amino acid sequences disclosed herein. In some embodiments, the disclosure provides for a polypeptide comprising an amino acid sequence that is at least 85%, 90%, 91%, 92%,
  • the non-internalizing moiety polypeptide portion of a chimeric polypeptide of the disclosure is an alpha-amylase polypeptide ⁇ e.g., a salivary or pancreatic alpha- amylase).
  • alpha-amylase-containing chimeric polypeptides are provided.
  • Exemplary alpha-amylase ⁇ e.g., a mature alpha-amylase) polypeptides for use in the methods and compositions of the disclosure are provided herein.
  • the alpha-amylase ⁇ e.g., a mature alpha-amylase) polypeptides have utility in clearing excess glycogen in diseased cells.
  • the diseased cells are the cells of a subject having a glycogen storage disease or a glycogen metabolic disorder.
  • the diseased cells are from a subject having Pompe Disease, Andersen Disease, von Gierke Disease, Lafora Disease and/or Forbes-Cori Disease.
  • the diseased cells are from a subject having Lafora Disease and/or Forbes-Cori Disease.
  • the diseased cells are from a subj ect having Lafora Disease.
  • the alpha-amylase ⁇ e.g., a mature alpha-amylase is a monomer. In some embodiments, the alpha-amylase is a dimer or a trimer. In some embodiments, the alpha-amylase has been mutated such that it is incapable of
  • the alpha-amylase has been mutated such that it is incapable of dimerizing or trimerizing).
  • the alpha-amylase has been treated with an agent that inhibits multimerization ⁇ e.g., dimerization or trimerization) of the alpha- amylase.
  • the agent is a small molecule.
  • the alpha-amylase polypeptides include various functional fragments and variants, fusion proteins, and modified forms of the wildtype alpha-amylase polypeptide.
  • the alpha-amylase is a mature alpha-amylase.
  • the alpha-amylase or fragment or variant thereof is a salivary alpha- amylase or fragment or variant thereof.
  • the alpha-amylase or fragment or variant thereof is a pancreatic alpha-amylase or fragment or variant thereof.
  • the alpha-amylase or fragment or variant thereof is a mammalian alpha- amylase or fragment or variant thereof.
  • the alpha- amylase or fragment or variant thereof is a human alpha- amylase or fragment or variant thereof.
  • Such functional fragments or variants, fusion proteins, and modified forms of the alpha-amylase polypeptides have at least a portion of the amino acid sequence of substantial sequence identity to the native alpha-amylase polypeptide, and retain the function of the native alpha-amylase polypeptide (e.g., ability to hydrolyze alpha- 1,4- glucosidic bonds). It should be noted that "retain the function" does not mean that the activity of a particular fragment must be identical or substantially identical to that of the native protein although, in some embodiments, it may be.
  • retaining the native activity should be at least 50%, at least 60%>, at least 70%, at least 75%, at least 80%>, at least 85%>, at least 90%, at least 95% that of the native protein to which such activity is being compared, with the comparison being made under the same or similar conditions.
  • retaining the native activity may include scenarios in which a fragment or variant has improved activity versus the native protein to which such activity is being compared, e.g., at least 105%, at least 110%, at least 120%, or at least 125%), with the comparison being bade under the same or similar conditions.
  • a functional fragment, variant, or fusion protein of an alpha-amylase polypeptide comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an alpha-amylase polypeptide, such as a mature alpha-amylase polypeptide (e.g., at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 1), or fragments thereof.
  • the alpha-amylase polypeptide for use in the chimeric polypeptides and methods of the disclosure is a full length or substantially full length alpha- amylase polypeptide, or a mature form of a full-length alpha-amylase.
  • the alpha-amylase polypeptide for use in the chimeric polypeptide and methods of the disclosure is a functional fragment that has alpha- 1,4-glucosi die bond hydrolytic activity.
  • the alpha-amylase portion of the chimeric polypeptide of the disclosure comprises an alpha-amylase polypeptide (e.g., a mature form) , which in certain embodiments may be a functional fragment of an alpha- amylase polypeptide or may be a substantially full length alpha-amylase polypeptide.
  • the alpha-amylase is the mature form of an alpha-amylase.
  • the mature form of the alpha-amylase corresponds to amino acids 16-511 of SEQ ID NO: 36 (Genbank accession number NP 000690).
  • the mature form of the alpha-amylase corresponds to an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 1, or functional fragments thereof.
  • Suitable alpha-amylase polypeptides or functional fragments thereof for use in the chimeric polypeptides and methods of the disclosure have alpha- 1,4-glucosidic bond hydrolytic activity, as evaluated in vitro or in vivo.
  • Exemplary functional fragments comprise, at least 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, or 51 1 consecutive amino acid residues of a full length alpha-amylase polypeptide (e.g., SEQ ID NO: 36).
  • the functional fragment comprises 100-150, 100-200, 100-250, 100-300, 100-400, 100-450, 100-495, 200-495, 300- 495, 400-495, 450-495, 475-495 consecutive amino acids of a mature alpha-amylase polypeptide (e.g., SEQ ID NO: 1).
  • a mature alpha-amylase polypeptide e.g., SEQ ID NO: 1
  • the disclosure contemplates chimeric proteins where the alpha-amylase portion is a variant of any of the foregoing alpha-amylase polypeptides or bioactive fragments. Exemplary variants have an amino acid sequence at least 90%, 92%, 95%, 96%, 97%, 98%, or at least 99% identical to the amino acid sequence of a native (e.g.
  • alpha-amylase polypeptide or functional fragment thereof retain the alpha-amylase variant' s alpha- 1,4-glucosidic bond hydrolytic activity.
  • the disclosure contemplates chimeric polypeptides and the use of such polypeptides wherein the alpha-amylase portion comprises any of the alpha-amylase polypeptides, fragments, or variants described herein in combination with any internalizing moiety described herein.
  • the alpha-amylase portion of any of the foregoing chimeric polypeptides may, in certain embodiments, be a fusion protein. Any such chimeric polypeptides comprising any combination of alpha-amylase portions and internalizing moiety portions, and optionally including one or more linkers, one or more tags, etc., may be used in any of the methods of the disclosure.
  • fragments or variants of the alpha-amylase polypeptides can be obtained by screening polypeptides recombinantly produced from the corresponding fragment of the nucleic acid encoding an alpha-amylase polypeptide.
  • fragments or variants can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry.
  • the fragments or variants can be produced (recombinantly or by chemical synthesis) and tested to identify those fragments or variants that can function as a native alpha-amylase polypeptide, for example, by testing their ability to treat Lafora Disease in vivo and/or by confirming in vitro (e.g., in a cell free or cell based assay) that the fragment or variant has alpha- 1,4-glucosidic bond hydrolytic activity.
  • An example of an in vitro assay for testing for activity of the alpha- amylase polypeptides disclosed herein would be to treat Lafora cells with or without the alpha-amylase-containing chimeric polypeptides and then, after a period of incubation, examining levels of polyglucosan.
  • the present disclosure contemplates modifying the structure of an alpha-amylase polypeptide for such purposes as enhancing therapeutic or prophylactic efficacy, or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo).
  • Modified polypeptides can be produced, for instance, by amino acid substitution, deletion, or addition.
  • This disclosure further contemplates generating sets of combinatorial mutants of an alpha-amylase polypeptide, as well as truncation mutants, and is especially useful for identifying functional variant sequences.
  • Combinatorially-derived variants can be generated which have a selective potency relative to a naturally occurring alpha-amylase polypeptide.
  • mutagenesis can give rise to variants which have intracellular half- lives dramatically different than the corresponding wild-type alpha-amylase polypeptide.
  • the altered protein can be rendered either more stable or less stable to proteolytic degradation or other cellular process which result in destruction of, or otherwise inactivation of alpha-amylase.
  • Such variants can be utilized to alter the alpha-amylase polypeptide level by modulating their half-life.
  • the library of potential alpha-amylase variants sequences can be generated, for example, from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes then can be ligated into an appropriate gene for expression. The purpose of a degenerate set of genes is to provide, in one mixture, all of the sequences encoding the desired set of potential polypeptide sequences. The synthesis of degenerate oligonucleotides is well known in the art (see for example, Narang, SA (1983) Tetrahedron 39:3; Itakura et al., (1981)
  • alpha-amylase polypeptide variants can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis and the like (Ruf et al., (1994) Biochemistry 33 : 1565-1572; Wang et al., (1994) J. Biol. Chem. 269:3095-3099; Balint et al., (1993) Gene 137: 109-118; Grodberg et al., (1993) Eur. J. Biochem. 218:597-601; Nagashima et al., (1993) J. Biol. Chem. 268:2888-2892;
  • combinatorial mutagenesis of the alpha-amylase polypeptides typically comprises cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
  • Each of the illustrative assays described below are amenable to high through-put analysis as necessary to screen large numbers of degenerate sequences created by combinatorial mutagenesis techniques.
  • an alpha-amylase polypeptide may include a
  • peptidomimetic includes chemically modified peptides and peptide-like molecules that contain non-naturally occurring amino acids, peptoids, and the like. Peptidomimetics provide various advantages over a peptide, including enhanced stability when administered to a subject. Methods for identifying a peptidomimetic are well known in the art and include the screening of databases that contain libraries of potential peptidomimetics. For example, the Cambridge Structural Database contains a collection of greater than 300,000 compounds that have known crystal structures (Allen et al., Acta Crystallogr. Section B, 35:2331 (1979)). Where no crystal structure of a target molecule is available, a structure can be generated using, for example, the program CONCORD (Rusinko et al., J. Chem. Inf. Comput. Sci. 29:251 (1989)).
  • CONCORD CONCORD
  • an alpha-amylase polypeptide may further comprise post- translational modifications.
  • post-translational protein modifications include phosphorylation, acetylation, methylation, ADP-ribosylation, ubiquitination, glycosylation, carbonylation, sumoylation, biotinylation or addition of a polypeptide side chain or of a hydrophobic group.
  • the modified alpha-amylase polypeptides may contain non- amino acid elements, such as lipids, poly- or mono-saccharides, and phosphates.
  • an alpha-amylase polypeptide may be tested for its biological activity, for example, alpha- 1,4-glucosi die bonds hydrolytic activity and/or its ability to treat Lafora Disease.
  • the alpha-amylase polypeptide may further comprise one or more polypeptide portions that enhance one or more of in vivo stability, in vivo half life, uptake/administration, and/or purification.
  • the internalizing moiety comprises an antibody or an antigen-binding fragment thereof.
  • an alpha-amylase polypeptide is not N-glycosylated or lacks one or more of the N-glycosylation groups present in a wildtype alpha-amylase
  • the alpha-amylase polypeptide for use in the present disclosure may lack all N-glycosylation sites, relative to native alpha-amylase, or the alpha-amylase polypeptide for use in the present disclosure may be under-glycosylated, relative to native alpha-amylase.
  • the alpha-amylase polypeptide comprises a modified amino acid sequence that is unable to be N-glycosylated at one or more N- glycosylation sites.
  • asparagine (Asn) of at least one predicted N- glycosylation site i.e., a consensus sequence represented by the amino acid sequence Asn- Xaa-Ser or Asn-Xaa-Thr
  • alpha-amylase polypeptide is substituted by another amino acid.
  • the asparagine at the amino acid position corresponding to residue 412 and/or 461 of SEQ ID NO: 1 is substitute by another amino acid acid.
  • alpha-amylase polypeptide of the present disclosure lacks one or more N- glycosylation sites, and thus is either not glycosylated or is under glycosylated relative to native alpha-amylase.
  • an alpha-amylase polypeptide is not O-glycosylated or lacks one or more of the O-glycosylation groups present in a wildtype alpha-amylase
  • the alpha-amylase polypeptide comprises a modified amino acid sequence that is unable to be O-glycosylated at one or more O-glycosylation sites.
  • serine or threonine at any one or more predicted O- glycosylation site in the alpha-amylase polypeptide sequence is substituted or deleted.
  • the disclosure contemplates that any one or more of the foregoing examples can be combined so that an alpha-amylase polypeptide of the present disclosure lacks one or more N- glycosylation and/or O-glycosylation sites, and thus is either not glycosylated or is under glycosylated relative to native alpha-amylase.
  • an alpha-amylase polypeptide may be modified with nonproteinaceous polymers.
  • the polymer is polyethylene glycol ("PEG”), polypropylene glycol, or polyoxyalkylenes, in the manner as set forth in U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417;
  • PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161).
  • biological activity By the terms “biological activity”, “bioactivity” or “functional” is meant the ability of the alpha-amylase polypeptide to carry out the functions associated with wildtype mature alpha-amylase polypeptides, for example, alpha- 1,4-glucosi die bond hydrolytic activity or ability to hydrolyze polyglucosan.
  • biological activity By the terms “biological activity”, “bioactivity”, and “functional” are used interchangeably herein.
  • fragments are understood to include bioactive fragments (also referred to as functional fragments) or bioactive variants that exhibit “bioactivity” as described herein. That is, bioactive fragments or variants of alpha-amylase exhibit bioactivity that can be measured and tested.
  • bioactive fragments/functional fragments or variants exhibit the same or substantially the same bioactivity as native (i.e., wild-type, or normal) alpha-amylase polypeptide, and such bioactivity can be assessed by the ability of the fragment or variant to, e.g., hydrolyze alpha- 1,4-glucosi die bonds in a carbohydrate.
  • native i.e., wild-type, or normal alpha-amylase polypeptide
  • substantially the same refers to any parameter (e.g., activity) that is at least 70% of a control against which the parameter is measured. In certain embodiments, “substantially the same” also refers to any parameter (e.g., activity) that is at least 75%, 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99%, 100%, 102%, 105%, or 110% of a control against which the parameter is measured.
  • fragments or variants of the mature alpha- amylase polypeptide will preferably retain at least 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100%) of the alpha-amylase biological activity associated with the native mature alpha- amylase polypeptide, when assessed under the same or substantially the same conditions.
  • fragments or variants of the alpha-amylase polypeptide have a half-life (t ) which is enhanced relative to the half-life of the native protein.
  • the half-life of alpha-amylase fragments or variants is enhanced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the half-life of the native alpha- amylase polypeptide.
  • the protein half-life is determined in vitro, such as in a buffered saline solution or in serum.
  • the protein half- life is an in vivo half life, such as the half-life of the protein in the serum or other bodily fluid of an animal.
  • fragments or variants can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry.
  • the fragments or variants can be produced (recombinantly or by chemical synthesis) and tested to identify those fragments or variants that can function as well as or substantially similarly to a native alpha-amylase polypeptide.
  • the disclosure contemplates all combinations of any of the foregoing aspects and embodiments, as well as combinations with any of the embodiments set forth in the detailed description and examples.
  • the described methods based on administering chimeric polypeptides or contacting cells with chimeric polypeptides can be performed in vitro (e.g., in cells or culture) or in vivo (e.g., in a patient or animal model).
  • the method is an in vitro method.
  • the method is an in vivo method.
  • the present disclosure also provides a method of producing any of the foregoing chimeric polypeptides as described herein. Further, the present disclosure contemplates any number of combinations of the foregoing methods and compositions.
  • an alpha-amylase polypeptide may be a fusion protein which further comprises one or more fusion domains.
  • fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, and an immunoglobulin heavy chain constant region (Fc), maltose binding protein (MBP), which are particularly useful for isolation of the fusion proteins by affinity chromatography.
  • relevant matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used.
  • Fusion domains also include "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
  • epitope tags for which specific monoclonal antibodies are readily available include FLAG, influenza virus haemagglutinin (HA), His and c-myc tags.
  • An exemplary His tag has the sequence HHHHHH (SEQ ID NO: 15)
  • an exemplary c-myc tag has the sequence EQKLISEEDL (SEQ ID NO: 16).
  • the fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom.
  • the alpha-amylase polypeptides may contain one or more modifications that are capable of stabilizing the polypeptides. For example, such modifications enhance the in vitro half life of the polypeptides, enhance circulatory half life of the polypeptides or reduce proteolytic degradation of the
  • internalizing moiety refers to a polypeptide/protein capable of interacting with a target tissue or a cell type such that the moiety is internalized into the target tissue or the cell type.
  • antibodies or antigen binding fragments of the disclosure refer to any one or more of the antibodies and antigen binding fragments provided herein.
  • Antibodies and antigen binding fragments of the disclosure comprise a heavy chain comprising a heavy chain variable domain and a light chain comprising a light chain variable domain.
  • a VH domain comprises three CDRs, such as any of the CDRs provided herein and as defined or identified by the Kabat and/or FMGT systems. These CDRs are typically interspersed with framework regions (FR), and together comprise the VH domain.
  • FR framework regions
  • a VL comprises three CDRs, such as any of the CDRs provided herein and as defined by the Kabat and/or IMGT systems.
  • CDRs are typically interspersed with framework regions (FR), and together comprise the V L domain.
  • FR regions such as FR1, FR2, FR3, and/or FR4 can similarly be defined or identified by the Kabat or IMGT systems.
  • CDRs are indicated as being, as identified or defined by the Kabat or FMGT systems, what is meant is that the CDRs are in accordance with that system (e.g., the Kabat CDRs or the IMGT CDRs). Any of these terms can be used to indicate whether the Kabat or FMGT CDRs are being referred to.
  • an antibody or antigen binding fragment may comprise any combination of a VH domain, as provided herein, and a VL domain, as provided herein.
  • at least one of the VH and/or VL domains are humanized (collectively, antibodies or antigen binding fragments of the disclosure).
  • Chimeric antibodies are also included. Any antibody or antigen binding fragment of the disclosure may be provided alone. In other embodiments, any antibody or antigen binding fragment of the disclosure may be provided as a conjugate associated with a heterologous agent.
  • heterologous agents which may include polypeptides, peptides, small molecules (e.g., a chemotherapeutic agent small molecule), or
  • Conjugates may refer to an antibody or antigen binding fragment associated with a heterologous agent.
  • the antibody or antigen-binding fragment is isolated and/or purified. Any of the antibodies or antigen-binding fragments described herein, including those provided in an isolated or purified form, may be provided as a composition, such as a composition comprising an antibody or antigen-binding fragment formulated with one or more pharmaceutical and/or physiological acceptable carriers and/or excipients. Any of the antibodies or antigen-binding fragments described herein, including compositions (e.g., pharmaceutical compositions) may be used in any of the methods described herein and may be optionally provided conjugated (e.g., interconnected; associated) with a heterologous agent.
  • the internalizing moiety is capable of interacting with a target tissue or a cell type to effect delivery of the heterologous agent into a cell (i.e., penetrate desired cell; transport across a cellular membrane; deliver across cellular membranes to, at least, the cytoplasm).
  • a target tissue or a cell type to effect delivery of the heterologous agent into a cell (i.e., penetrate desired cell; transport across a cellular membrane; deliver across cellular membranes to, at least, the cytoplasm).
  • Such conjugates may similarly be provided as a composition and may be used in any of the methods described herein.
  • Internalizing moieties having limited cross-reactivity are generally preferred.
  • this disclosure relates to an internalizing moiety which selectively, although not necessarily exclusively, targets and penetrates muscle, liver and/or neuronal cells.
  • the internalizing moiety has limited cross-reactivity, and thus preferentially targets a particular cell or tissue type.
  • suitable internalizing moieties include, for example, antibodies, monoclonal antibodies, or derivatives or analogs thereof.
  • the internalizing moiety mediates transit across cellular membranes via an ENT2 transporter. In some embodiments, the internalizing moiety helps the chimeric polypeptide effectively and efficiently transit cellular membranes. In some embodiments, the internalizing moiety transits cellular membranes via an equilibrative nucleoside (ENT) transporter. In some embodiments, the internalizing moiety transits cellular membranes via an ENT1, ENT2, ENT3 or ENT4 transporter. In some embodiments, the internalizing moiety transits cellular membranes via an equilibrative nucleoside transporter 2 (ENT2) and/or ENT3 transporter.
  • ENT2 equilibrative nucleoside transporter 2
  • ENT3 transporter equilibrative nucleoside transporter 2
  • the internalizing moiety promotes delivery into muscle (e.g., cardiac or diaphragm muscle), liver, skin or neuronal (e.g., brain) cells.
  • muscle e.g., cardiac or diaphragm muscle
  • liver e.g., liver
  • neuronal e.g., brain
  • the internalizing moiety is internalized into the cytoplasm.
  • the internalizing moiety is internalized into the nucleus or lysosomes.
  • the internalizing moiety is an antibody or antibody fragment that binds DNA. In certain embodiments, the internalizing moiety is any of the antibody or antibody fragments described herein. In other words, in certain embodiments, the antibody or antibody fragment (e.g., antibody fragment comprising an antigen binding fragment) binds DNA. In certain embodiments, DNA binding ability is measured versus a double stranded DNA substrate. In certain embodiments, the internalizing moiety is an antibody or antibody fragment that binds DNA and can transit cellular membranes via ENT2. In certain embodiments, the internalizing moiety binds a DNA bubble.
  • the internalizing moiety is capable of binding
  • the internalizing moiety is capable of binding DNA. In certain embodiments, the internalizing moiety is an antibody capable of binding DNA. In certain embodiments, the internalizing moiety is capable of binding DNA with a K D of less than 1 ⁇ . In certain embodiments, the internalizing moiety is capable of binding DNA with a K D of less than 100 nM, less than 75nM, less than 50nM, or even less than 30nM. K D can be measured using Surface Plasm on Resonance (SPR) or Quartz Crystal Microbalance (QCM), in accordance with currently standard methods.
  • SPR Surface Plasm on Resonance
  • QCM Quartz Crystal Microbalance
  • an internalizing moiety for use in the chimeric polypeptides of the disclosure is an antibody or antibody fragment (e.g., an antigen binding fragment) that can transit cellular membranes into the cytoplasm and binds to DNA.
  • an internalizing moiety for use herein is an anti-DNA antibody or antigen binding fragment thereof.
  • an internalizing moiety of the disclosure binds a given DNA substrate with higher affinity as compared to an antibody or scFv or Fv having the VH and VL of the antibody produced by the hybridoma deposited with the ATCC under ATCC accession number PTA- 2439.
  • an internalizing moiety for use in the methods of the present disclosure is not an antibody or antibody fragment having the VH and VL of the antibody produced by the hybridoma deposited with the ATCC under ATCC accession number PTA- 2439.
  • an internalizing moiety for use in the methods of the present disclosure is not a murine antibody or antibody fragment.
  • a full length antibody comprising the foregoing VH and VL binds a double- stranded blunt DNA substrate with an even lower K D , as evaluated by ELISA.
  • the internalizing moiety binds double-stranded, blunt DNA, and DNA binding activity is or can be demonstrated in a binding assay using blunt DNA (see, for example, Xu et. Al. (2009) EMBO Journal 28: 568-577; Hansen et al., (2012) Sci
  • the foregoing K D of the antibody or antibody fragment (such as an antibody fragment comprising an antigen-binding fragment) is evaluated versus a double stranded, blunt end DNA substrate, such as the DNA substrate set forth in Xu et al.
  • the internalizing moiety is an anti-DNA antibody. It is recognized that 3E10 and other anti-DNA antibodies may be capable of binding a variety of DNA substrates with high affinity, as has been demonstrated.
  • any of the internalizing moieties described herein is capable of binding specific nucleotide motifs present in a polynucleotide sequence.
  • the internalizing moiety is capable of binding AT -rich sequences.
  • the internalizing moiety binds to AT -rich sequences with a stronger affinity than to a GC-rich sequence.
  • the internalizing moiety is capable of binding a TATA sequence.
  • the internalizing moiety binds to 4-mer TATA motifs within a 6 base pair sequence.
  • the internalizing moiety is capable of binding a DNA bubble.
  • the internalizing moiety is capable of binding a DNA sequence adjacent to a DNA bubble.
  • the internalizing moiety is capable of binding specific nucleotide motifs present in a polynucleotide sequence.
  • the internalizing moiety is capable of binding AT -rich sequences.
  • the internalizing moiety binds to AT -rich sequences with a stronger affinity than to a GC-rich sequence.
  • an internalizing moiety is capable of binding a DNA sequence adjacent to a DNA bubble that is at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or at least 25 base pairs in length.
  • the internalizing moiety is capable of binding a 5-mer variable region adjacent to a 7-base or 11 -base bubble.
  • an internalizing moiety of the disclosure such as an antibody or antibody fragment described herein, binds a given DNA substrate with higher affinity as compared to an antibody or scFv or Fv having the VH and VL of the antibody produced by the hybridoma deposited with the ATCC under ATCC accession number PTA-2439.
  • an internalizing moiety for use in the methods of the present disclosure is not an antibody or antibody fragment having the VH and VL of the antibody produced by the hybridoma deposited with the ATCC under ATCC accession number PTA-2439. In some embodiments, an internalizing moiety for use in the methods of the present disclosure is not a murine antibody or antibody fragment.
  • any of the internalizing moieties described herein bind DNA at DNA response elements. In some embodiments, the internalizing moieties bind DNA response elements to prevent transcription factors or proteins from binding to the elements. In some embodiments, the internalizing moieties block or inhibit transcription. In certain aspects, any of the internalizing moieties described herein bind DNA at DNA repair sites. In some embodiments, the internalizing moiety binds a DNA bubble formed at a DNA repair site. In some embodiments, the internalizing moiety binds DNA at a DNA repair site, wherein the DNA repair site is present as the result of DNA damage due to chemotherapeutic or radiotherapeutic treatment.
  • the internalizing moiety binds DNA at a DNA repair site wherein the DNA repair site is present as the result of DNA damage due to chemotherapeutic treatment.
  • the chemotherapeutic treatment is treatment with a DNA cross-linker (e.g., a platin such as cisplatin, carboplatin, oxaliplatin or an active analog thereof), an inhibitor of DNA synthesis (e.g., methotrexate or an active analog thereof), a topoisomerase poison (e.g., doxorubicin, daunorubicin, or an active analog thereof), a DNA alkylating agent (e.g., a nitrosurea, triazene compound or an active analog thereof), and/or an antimetabolite (e.g., a pyrimidine analog such as 5-fluorouracil or an active analog thereof).
  • a DNA cross-linker e.g., a platin such as cisplatin, carboplatin, oxaliplatin
  • any of the internalizing moieties of the disclosure are capable of binding DNA at DNA sites independent of DNA repair sites.
  • an internalizing moiety may comprise an antibody, including a monoclonal antibody, a polyclonal antibody, and a humanized antibody.
  • the internalizing moiety is a full-length antibody.
  • internalizing moieties may comprise antibody fragments, derivatives or analogs thereof, including without limitation: antibody fragments comprising antigen binding fragments (e.g., Fv fragments, single chain Fv (scFv) fragments, Fab fragments, Fab ' fragments, F(ab ' )2 fragments), single domain antibodies, camelized antibodies and antibody fragments, humanized antibodies and antibody fragments, human antibodies and antibody fragments, and multivalent versions of the foregoing; multivalent internalizing moieties including without limitation: Fv fragments, single chain Fv (scFv) fragments, Fab ' fragments, F(ab ' )2 fragments, single domain antibodies, camelized antibodies and antibody fragments, humanized antibodies and antibody fragments, human antibodies and antibody fragments, and multivalent versions of the foregoing
  • the antibodies or variants thereof may be chimeric, e.g., they may include variable heavy or light regions from the murine 3E10 antibody, but may include constant regions from an antibody of another species (e.g., a human).
  • the antibodies or variants thereof may comprise a constant region that is a hybrid of several different antibody subclass constant domains (e.g., any combination of IgGl, IgG2a, IgG2b, IgG3 and IgG4, from any species or combination of species).
  • the antibodies or variants thereof comprise the following constant domain scheme: IgG2a CHl-IgGl hinge-IgGl CH2-CH3, for example, any of the foregoing may be human IgG or murine IgG. Other suitable combinations are also contemplated.
  • the antibody comprises a full length antibody and the CHI, hinge, CH2, and CH3 is from the same constant domain subclass (e.g., IgGl).
  • the antibodies or variants thereof are antibody fragments (e.g., the internalizing moiety is an antibody fragment comprising an antigen binding fragment; e.g., the internalizing moiety is an antigen binding fragment) comprising a portion of the constant domain of an immunoglobulin, for example, the following constant domain scheme: IgG2a CHl-IgGl upper hinge.
  • the internalizing moiety is an antibody fragment comprising an antigen binding fragment; e.g., the internalizing moiety is an antigen binding fragment
  • the constant domain scheme IgG2a CHl-IgGl upper hinge.
  • the antibodies or variants thereof are antibody fragments that comprise a sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 1 1.
  • the antibodies or variants thereof comprise a kappa constant domain (e.g., of the Km3 allotype).
  • the antibodies or variants thereof are antibody fragments that comprise a sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% SEQ ID NO: 12.
  • Heavy chain constant domains (whether for a full length antibody or for an antibody fragment (e.g., an antigen binding fragment) comprising an amino acid substitution, relative to native IgG domains, to decrease effector function and/or facilitate production are included within the scope of antibodies and antigen binding fragments. For example, one, two, three, or four amino acid substitutions in a heavy chain, relative to a native murine or human
  • immunoglobulin constant region such as in the hinge or CH2 domain of a heavy chain constant region.
  • an internalizing moiety comprises an antibody, and the heavy chain comprises a VH region, and a constant domain comprising a CHI, hinge, CH2, and CH3 domain.
  • a heavy chain comprises a VH region, and a constant domain comprising a CHI domain and, optionally, the upper hinge.
  • the upper hinge may include, for example, 1, 2, 3, or 4 amino acid residues of the hinge region.
  • the upper hinge does not include a cysteine residue.
  • the upper hinge includes one or more consecutive residues N-terminal to a cysteine that exists in the native hinge sequence.
  • the heavy chain comprises a CH region, and a constant domain comprising a CHI domain and a hinge.
  • the hinge (whether present as part of a full length antibody or an antibody fragment) comprises a C to S substitution at a position corresponding to Kabat position 222 (e.g., a C222S in the hinge, where the variation is at a position corresponding to Kabat position 222).
  • the internalizing moiety comprises a serine residue, rather than a cysteine residue, in a hinge domain at a position corresponding to Kabat 222.
  • the heavy chain comprises a constant domain comprising a CHI, hinge, CH2 and, optionally CH3 domain.
  • a CH2 domain comprises an N to Q substitution at a position corresponding to Kabat position 297 (e.g., a N297Q in a CH2 domain, wherein the variation is at a position corresponding to Kabat position 297).
  • the internalizing moiety comprises a glutamine, rather than an asparagine, at a position corresponding to Kabat position 297.
  • the internalizing moiety comprises all or a portion of the Fc region of an immunoglobulin.
  • the internalizing moiety comprises all or a portion of a heavy chain constant region of an immunoglobulin (e.g., one or two polypeptide chains of a heavy chain constant region.
  • each immunoglobulin heavy chain constant region comprises four or five domains. The domains are named sequentially as follows: CHl-hinge-CH2- CH3(-CH4).
  • immunoglobulin Fc region is understood to mean the carboxyl-terminal portion of an immunoglobulin chain constant region, preferably an immunoglobulin heavy chain constant region, or a portion thereof.
  • an immunoglobulin Fc region may comprise 1) a CHI domain, a CH2 domain, and a CH3 domain, 2) a CHI domain and a CH2 domain, 3) a CHI domain and a CH3 domain, 4) a CH2 domain and a CH3 domain, or 5) a combination of two or more domains and an immunoglobulin hinge region, or a portion of a hinger (e.g., an upper hinge).
  • an internalizing moiety further comprises a light chain constant region (CL).
  • the Fc portion of any of the internalizing moieties described herein has been modified such that it does not induce antibody-dependent cell-mediated cytotoxicity (ADCC). In some embodiments, the Fc portion has been modified such that it does not bind complement.
  • a CH2 domain of the Fc portion comprises an N to Q substitution at a position corresponding to Kabat position 297 (e.g., a N297Q in a CH2 domain, wherein the variation is at a position corresponding to Kabat position 297).
  • the internalizing moiety comprises a glutamine, rather than an asparagine, at a position corresponding to Kabat position 297.
  • the class of immunoglobulin from which the heavy chain constant region is derived is IgG (Igy) ( ⁇ subclasses 1, 2, 3, or 4).
  • IgG immunoglobulin
  • IgA immunoglobulin
  • IgD immunoglobulin
  • IgE immunoglobulin
  • IgM 3 ⁇ 4 ⁇
  • the choice of particular immunoglobulin heavy chain constant region sequences from certain immunoglobulin classes and subclasses to achieve a particular result is considered to be within the level of skill in the art.
  • the portion of the DNA construct encoding the immunoglobulin Fc region preferably comprises at least a portion of a hinge domain, and preferably at least a portion of a CH 3 domain of Fey or the homologous domains in any of IgA, IgD, IgE, or IgM.
  • substitution or deletion of amino acids within the immunoglobulin heavy chain constant regions may be useful in the practice of the disclosure.
  • One example would be to introduce amino acid substitutions in the upper CH2 region to create a Fc variant with reduced affinity for Fc receptors (Cole et al. (1997) J. IMMUNOL. 159:3613).
  • One of ordinary skill in the art can prepare such constructs using well known molecular biology techniques.
  • any of the internalizing moieties disclosed herein comprise a signal sequence conjugated to the heavy chain and/or the light chain amino acid sequence.
  • the heavy chain comprises a signal sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 4.
  • the light chain comprises a signal sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 5.
  • the signal sequence lacks the N-terminal Methionine.
  • any of the polypeptides disclosed herein lacks the N-terminal Methionine.
  • the internalizing moiety is any peptide or antibody-like protein having the complementarity determining regions (CDRs) of the 3E10 antibody sequence, or of an antibody that binds the same epitope (e.g., the same target, such as DNA) as 3E10.
  • CDRs complementarity determining regions
  • transgenic mice, or other mammals may be used to express humanized or human antibodies. Such humanization may be partial or complete.
  • the internalizing moiety comprises the monoclonal antibody 3E10 or an antigen binding fragment thereof.
  • the internalizing moiety comprises an antibody or an antigen binding fragment thereof, such as any of the antigen binding fragments described herein.
  • the antibody or antigen binding fragment thereof may be monoclonal antibody 3E10, or a variant thereof that retains cell penetrating activity, or an antigen binding fragment of 3E10 or said 3E10 variant.
  • the antibody or antigen binding fragment thereof may be an antibody that binds to the same epitope (e.g., target, such as DNA) as 3E10, or an antibody that has substantially the same cell penetrating activity as 3E10, or an antigen binding fragment thereof.
  • the internalizing moiety is capable of binding polynucleotides. In certain embodiments, the internalizing moiety is capable of binding DNA, such as double-stranded blunt DNA. In certain embodiments, the internalizing moiety is capable of binding DNA with a K D of less than 100 nM. In certain embodiments, the internalizing moiety is capable of binding DNA with a K D of less than 100 nM, less than 75 nM, less than 50 nM, or even less than 30 nM. K D is determined using SPR or QCM or ELISA, according to
  • K D is determined using a fluorescence polarization assay.
  • the antigen binding fragment is an Fv or scFv fragment thereof.
  • Monoclonal antibody 3E10 can be produced by a hybridoma 3E10 placed permanently on deposit with the American Type Culture Collection (ATCC) under ATCC accession number PTA-2439 and is disclosed in US Patent No. 7, 189,396. This antibody has been shown to bind DNA. Additionally or alternatively, the 3E10 antibody can be produced by expressing in a host cell nucleotide sequences encoding the heavy and light chains of the 3E10 antibody. The term “3E10 antibody” or “monoclonal antibody 3E10" are used to refer to the antibody, regardless of the method used to produce the antibody.
  • 3E10 antibody when referring to variants or antigen-binding fragments of 3E10, such terms are used without reference to the manner in which the antibody was produced. At this point, 3E10 is generally not produced by the hybridoma but is produced recombinantly.
  • 3E10 antibody unless otherwise specified, will refer to an antibody having the sequence of the hybridoma or comprising a variable heavy chain domain comprising the amino acid sequence set forth in SEQ ID NO: 17 (which has a one amino acid substitution relative to that of the 3E10 antibody deposited with the ATCC, as described herein) and the variable light chain domain comprising the amino acid sequence set forth in SEQ ID NO: 18, and antibody fragments thereof.
  • the internalizing moiety may also comprise variants of mAb 3E10, such as variants of 3E10 which retain the same cell penetration characteristics as mAb 3E10, as well as variants modified by mutation to improve the utility thereof (e.g., improved ability to target specific cell types, improved ability to penetrate the cell membrane, improved ability to localize to the cellular DNA, convenient site for conjugation, and the like).
  • variants include variants wherein one or more conservative or non-conservative substitutions are introduced into the heavy chain, the light chain and/or the constant region(s) of the antibody.
  • variants include humanized versions of 3E10 or a 3E10 variant, particularly those with improved activity or utility, as provided herein.
  • the light chain or heavy chain may be modified at the N-terminus or C-terminus.
  • the foregoing description of variants applies to antigen binding fragments. Any of these antibodies, variants, or fragments may be made recombinantly by expression of the nucleotide sequence(s) in a host cell.
  • the internalizing moiety may also include mutants of mAb 3E10, such as variants of 3E10 which retain the same or substantially the same cell penetration characteristics as mAb 3E10, as well as variants modified by mutation to improve the utility thereof (e.g., improved ability to target specific cell types, improved ability to penetrate the cell membrane, improved ability to localize to the cellular DNA, improved binding affinity, and the like).
  • Such mutants include variants wherein one or more conservative substitutions are introduced into the heavy chain, the light chain and/or the constant region(s) of the antibody.
  • Numerous variants of mAb 3E10 have been characterized in, e.g., US Patent 7, 189,396 and WO 2008/091911, the teachings of which are incorporated by reference herein in their entirety.
  • the internalizing moiety comprises an antibody or antigen binding fragment comprising an VH domain comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 99%, or 100% identical to SEQ ID NO: 17 and/or a VL domain comprising an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 99%, or 100%) identical to SEQ ID NO: 18, or a humanized variant thereof.
  • a signal sequence is included for expression of an antibody or antibody fragment, that signal sequence is generally cleaved and not presented in the finished chimeric polypeptide (e.g., the signal sequence is generally cleaved and present only transiently during protein production).
  • an internalizing moiety for use in the methods of the present disclosure is not an antibody or antibody fragment having the VH and VL of the antibody produced by the hybridoma deposited with the ATCC under ATCC accession number PTA-2439.
  • an internalizing moiety for use in the methods of the present disclosure is not an antibody or antibody fragment having a VH comprising the amino acid sequence set forth in SEQ ID NO: 17 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 18.
  • the internalizing moiety is capable of binding
  • the internalizing moiety is capable of binding (specifically binding) DNA. In certain embodiments, the internalizing moiety is capable of binding DNA with a K D of less than 100 nM. In certain embodiments, the internalizing moiety is capable of binding DNA with a K D of less than 50 nM. In certain embodiments, the internalizing moiety is an anti-DNA antibody, such as an antibody or antigen binding fragment that binds double-stranded blunt DNA. In certain embodiments, the internalizing moiety is an anti-DNA antibody or antigen binding fragment (thereof), where K D is evaluated versus a double stranded DNA substrate, such as provided herein.
  • the internalizing moiety is an antigen binding fragment, such as a single chain Fv of 3E10 (scFv) comprising SEQ ID NOs: 17 and 18.
  • the internalizing moiety comprises a single chain Fv of 3E10 (or another antigen binding fragment), and the amino acid sequence of the V H domain is at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 17, and amino acid sequence of the V L domain is at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 18.
  • the variant 3E10 or fragment thereof retains the function of an internalizing moiety.
  • the VH and VL domains are typically connected via a linker, such as a gly/ser linker.
  • the VH domain may be N- terminal to the VL domain or vice versa.
  • the internalizing moiety is an antigen binding fragment, such as a Fab comprising a VH and a VL.
  • the internalizing moiety is a Fab (or another antigen binding fragment, such as a Fab ), and the amino acid sequence of the V H domain is at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 17.
  • the internalizing moiety is a Fab (or another antigen binding fragment, such as a Fab ' ), and the amino acid sequence of the V L domain is at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 18.
  • Our VH and VL domains, or combinations thereof, described herein are similarly contemplated.
  • the internalizing moiety when the internalizing moiety is a Fab the heavy chain comprises a CHI domain and an upper hinge of an immunoglobulin constant region.
  • the upper hinge comprises a substitution, relative to a native immunoglobulin constant region, such as to decrease effector function and/or to eliminate a cysteine (e.g., a C to S). In certain embodiments, the upper hinge does not include a cysteine.
  • an internalizing moiety for use in the methods of the present disclosure is not an antibody or antibody fragment having the VH and VL of the antibody produced by the hybridoma deposited with the ATCC under ATCC accession number PTA-2439.
  • an internalizing moiety for use in the methods of the present disclosure is not an antibody or antibody fragment having a VH comprising the amino acid sequence set forth in SEQ ID NO: 17 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 18.
  • the constant domain of the antibody or antibody fragment comprises all or a portion of a human Fc domain.
  • the internalizing moiety is a full length antibody
  • the constant domain of the antibody comprises a CHI , hinge, CH2 and CH3 domain.
  • the constant domain comprises one or more substitutions, relative to a native immunoglobulin, that reduce effector function.
  • such a constant domain may include one or more (e.g., 1 substitution, 2 substitutions, 3 substitutions) substitutions in the heavy chain constant domain, such as in the hinge and/or CH2 domains, such as to reduce effector function. Such substitutions are known in the art.
  • the internalizing moiety is an antigen binding fragment - a fragment of an antibody comprising an antigen binding fragment. Suitable such fragments of antibodies, such as scFv, Fab, Fab ' and the like are described herein. In certain embodiments, the internalizing moiety is an antigen binding fragment or a full length antibody. In certain embodiments, the internalizing moiety comprises a light chain comprising a constant region (CL). In certain embodiments, the internalizing moiety comprises a heavy chain comprising a constant region, wherein the constant region comprises a CHI domain. In certain embodiments, the internalizing moiety comprises a heavy chain comprising a constant region and a light chain comprising a constant region, wherein the heavy chain constant region comprises a CHI domain.
  • the internalizing moiety may further comprise a heavy chain constant region comprising all or a portion of a hinge (e.g., an upper hinge or more than the upper hinge).
  • the internalizing moiety may further comprise a heavy chain comprising a CH2 and/or CH3 domain.
  • the internalizing moiety comprises one or more of the CDRs of the 3E10 antibody. In certain embodiments, the internalizing moiety comprises one or more of the CDRs of a 3E10 antibody comprising the amino acid sequence of a V H domain that is identical to SEQ ID NO: 17 and the amino acid sequence of a V L domain that is identical to SEQ ID NO: 18.
  • the CDRs of the 3E10 antibody may be determined using any of the CDR identification schemes available in the art. For example, in some embodiments, the CDRs of the 3E10 antibody are defined according to the Kabat definition as set forth in Kabat et al. Sequences of Proteins of Immunological Interest, 5th Ed. Public Health
  • the CDRs of the 3E10 antibody are defined according to Chothia et al., 1987, J Mol Biol. 196: 901-917 and Chothia et al., 1989, Nature. 342:877-883.
  • the CDRs of the 3E10 antibody are defined according to the international ImMunoGeneTics database (IMGT) as set forth in LeFranc et al., 2003, Development and Comparative Immunology, 27: 55-77.
  • IMGT international ImMunoGeneTics database
  • the CDRs of the 3E10 antibody are defined according to Honegger A, Pluckthun A., 2001, J Mol Biol., 309:657-670.
  • the CDRs of the 3E10 antibody are defined according to any of the CDR identification schemes discussed in Kunik et al., 2012, PLoS Comput Biol. 8(2): el002388.
  • the internalizing moiety comprises at least 1, 2, 3, 4, or 5 of the CDRs of 3E10 as determined using the Kabat CDR identification scheme (e.g., the CDRs set forth in SEQ ID NOs: 19-24; the internalizing moiety is an antibody or antigen binding fragment thereof comprising a heavy chain comprising CDR1, CDR2, and CDR 3, as set forth in SEQ ID NOs: 19-21, respectively, and a light chain comprising CDR1, CDR2, and CDR3, as set forth in SEQ ID NOs: 22-24, respectively; e.g., and these CDRs in the internalizing moiety are as determined using the Kabat scheme).
  • the Kabat CDR identification scheme e.g., the CDRs set forth in SEQ ID NOs: 19-24; the internalizing moiety is an antibody or antigen binding fragment thereof comprising a heavy chain comprising CDR1, CDR2, and CDR 3, as set forth in SEQ ID NOs: 19-21, respectively, and a light chain comprising CDR1, CDR2, and CDR
  • the internalizing moiety comprises at least 1, 2, 3, 4 or 5 of the CDRs of 3E10 as determined using the EVIGT identification scheme (e.g., the CDRs set forth in SEQ ID NOs: 27-32; the internalizing moiety is an antibody or antigen binding fragment thereof comprising a heavy chain comprising CDR1, CDR2, and CDR 3, as set forth in SEQ ID NOs: 27-29, respectively, and a light chain comprising CDR1, CDR2, and CDR3, as set forth in SEQ ID NOs: 30-32, respectively; e.g., and these CDRs in the internalizing moiety are as determined using the EVIGT identification scheme).
  • the EVIGT identification scheme e.g., the CDRs set forth in SEQ ID NOs: 27-32; the internalizing moiety is an antibody or antigen binding fragment thereof comprising a heavy chain comprising CDR1, CDR2, and CDR 3, as set forth in SEQ ID NOs: 27-29, respectively, and a light chain comprising CDR1, CDR
  • the internalizing moiety comprises all six CDRs of 3E10 as determined using the Kabat CDR identification scheme (e.g., comprises SEQ ID NOs 19-24). In other embodiments, the internalizing moiety comprises all six CDRS of 3E10 as determined using the IMGT identification scheme (e.g., which are set forth as SEQ ID NOs: 27-32).
  • the internalizing moiety is an antibody that binds the same epitope (e.g., the same target, such as DNA) as 3E10 and/or the internalizing moiety competes with 3E10 for binding to antigen.
  • Exemplary internalizing moieties target and transit cells via ENT2.
  • Exemplary internalizing moieties comprise antibodies or antigen binding fragments that bind DNA, such as double stranded blunt DNA.
  • the internalizing moiety comprising an antibody fragment, and the antibody fragment comprises an antigen binding fragment, such as an Fab or Fab'.
  • the internalizing moiety comprises an Fab or Fab ' .
  • the internalizing moiety competes with binding for a DNA substrate, such as double-stranded blunt DNA, with an antibody (or antigen-binding fragment) of the antibody produced by hybridoma 3E10 placed permanently on deposit with the American Type Culture Collection (ATCC) under ATCC accession number PTA- 2439.
  • ATCC American Type Culture Collection
  • a linker may be used.
  • typical surface amino acids in flexible protein regions include Gly, Asn and Ser.
  • One exemplary linker is provided in SEQ ID NO: 6, 13 or 14.
  • Permutations of amino acid sequences containing Gly, Asn and Ser would be expected to satisfy the criteria (e.g., flexible with minimal hydrophobic or charged character) for a linker sequence.
  • Another exemplary linker is of the formula (G 4 S)n, wherein n is an integer from 1-10, such as 2, 3, or 4.
  • Other near neutral amino acids, such as Thr and Ala, can also be used in the linker sequence.
  • Preparation of antibodies may be accomplished by any number of well-known methods for generating monoclonal antibodies. These methods typically include the step of immunization of animals, typically mice, with a desired immunogen (e.g., a desired target molecule or fragment thereof). Once the mice have been immunized, and preferably boosted one or more times with the desired immunogen(s), monoclonal antibody -producing hybridomas may be prepared and screened according to well known methods (see, for example, Kuby, Janis, Immunology, Third Edition, pp. 131-139, W.H. Freeman & Co. (1997), for a general overview of monoclonal antibody production, that portion of which is incorporated herein by reference). Over the past several decades, antibody production has become extremely robust.
  • a desired immunogen e.g., a desired target molecule or fragment thereof.
  • phage display technology may be used to generate an internalizing moiety specific for a desired target molecule.
  • An immune response to a selected immunogen is elicited in an animal (such as a mouse, rabbit, goat or other animal) and the response is boosted to expand the immunogen-specific B-cell population.
  • Messenger RNA is isolated from those B-cells, or optionally a monoclonal or polyclonal hybridoma population.
  • the mRNA is reverse- transcribed by known methods using either a poly-A primer or murine immunoglobulin- specific primer(s), typically specific to sequences adjacent to the desired VH and VL chains, to yield cDNA.
  • the desired V H and V L chains are amplified by polymerase chain reaction (PCR) typically using VH and VL specific primer sets, and are ligated together, separated by a linker.
  • PCR polymerase chain reaction
  • VH and VL specific primer sets are commercially available, for instance from Stratagene, Inc. of La Jolla, California.
  • VH-linker-VL product (encoding an scFv fragment) is selected for and amplified by PCR. Restriction sites are introduced into the ends of the VH-linker-VL product by PCR with primers including restriction sites and the scFv fragment is inserted into a suitable expression vector (typically a plasmid) for phage display. Other fragments, such as an Fab ' fragment, may be cloned into phage display vectors for surface expression on phage particles.
  • the phage may be any phage, such as lambda, but typically is a filamentous phage, such as fd and M13, typically M13.
  • an antibody or antibody fragment is made recombinantly in a host cell.
  • the antibody can be made recombinantly using standard techniques.
  • the internalizing moieties may be modified to make them more resistant to cleavage by proteases.
  • the stability of an internalizing moiety comprising a polypeptide may be increased by substituting one or more of the naturally occurring amino acids in the (L) configuration with D-amino acids.
  • at least 1%, 5%, 10%, 20%, 50%, 80%, 90% or 100% of the amino acid residues of internalizing moiety may be of the D configuration.
  • the switch from L to D amino acids neutralizes the digestion capabilities of many of the ubiquitous peptidases found in the digestive tract.
  • enhanced stability of an internalizing moiety comprising a peptide bond may be achieved by the introduction of modifications of the traditional peptide linkages.
  • enhanced stability of an internalizing moiety may be achieved by intercalating one or more dextrorotatory amino acids (such as, dextrorotatory phenylalanine or dextrorotatory tryptophan) between the amino acids of internalizing moiety.
  • dextrorotatory amino acids such as, dextrorotatory phenylalanine or dextrorotatory tryptophan
  • the disclosure contemplates the use of internalizing moieties (including antibodies or antigen binding fragments of the disclosure) described based on any combination of any of the foregoing or following structural and/or functional characteristics. Any such internalizing moieties, such as antibodies or antigen-binding fragments, are considered antibodies and antigen binding fragments of the disclosure and can be used for any of the uses or methods described herein, such as to treat Lafora Disease.
  • Antibodies or Antigen-Binding Fragments such as Humanized Antibodies or Antigen Binding Fragments
  • the disclosure provides any of the antibodies or antigen- binding fragments disclosed herein, wherein the antibody or antigen-binding fragment is humanized.
  • one class of internalizing moiety such as antibody or antigen binding fragment, is a humanized antibody or antigen binding fragment.
  • Such internalizing moiety may be humanized in whole or in part. Numerous examples of such humanized internalizing moieties are provided herein and are also described in WO 2015/106290, which is incorporated herein in its entirety.
  • the disclosure provides an antibody or antigen-binding fragment comprising a humanized antibody or antigen-binding fragment, wherein the humanized antibody or antigen-binding fragment comprises a light chain variable (VL) domain and a heavy chain variable (VH) domain; wherein the V H domain is humanized and comprises:
  • VH CDR1 having the amino acid sequence of SEQ ID NO : 27;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 28;
  • VH CDR3 having the amino acid sequence of SEQ ID NO: 29;
  • VL is humanized and comprises:
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 30;
  • VL CDR2 having the amino acid sequence of SEQ ID NO: 31;
  • VL CDR3 having the amino acid sequence of SEQ ID NO: 32;
  • the humanized antibody or antigen-binding fragment has increased DNA binding and/or cell penetration, relative to that of a murine 3E10 antibody comprising a light chain variable (VL) domain having the amino acid sequence of SEQ ID NO: 18 and a heavy chain variable (VH) domain having the amino acid sequence of SEQ ID NO: 17.
  • VL light chain variable
  • VH heavy chain variable
  • the suitable comparison is between two proteins of the same structure (e.g., comparing a full length antibody to another full length antibody or comparing an Fab to another Fab).
  • the comparison is to an scFv or Fv of the murine antibody as a constant basis for comparison.
  • an asparagine is mutated to another amino acid residue in the VH or VL domains in order to reduce N-linked glycosylation of the humanized antibody or antibody fragment.
  • This humanized antibody or antibody fragment is based on a murine parent antibody - specifically a murine 3E10 antibody comprising a heavy chain and a light chain, wherein the light chain comprises a VL comprising the amino acid sequence of SEQ ID NO: 18 and the heavy chain comprises a VH comprising the amino acid sequence of SEQ ID NO: 17.
  • the internalizing moieties and fragments are associated with at least the cell-penetration properties associated with the murine 3E10 antibody (e.g., retain at least 75%, 80%, 85%, 90%, 95%, or greater than 95%) of the cell penetration properties.
  • the humanized antibody or antibody fragment has one or more preferable cell penetration characteristics, such as improved penetration efficiency.
  • the humanized antibody or antibody fragment has improved DNA binding activity and/or a different range of DNA substrate affinity or specificity.
  • fragment or "antigen-binding fragment” of a humanized antibody moiety or “antigen binding fragment” includes any fragment of a humanized internalizing moiety that retains at least the cell-penetration and/or DNA binding properties associated with the murine 3E10 antibody.
  • fragment and “antigen binding fragment” are used interchangeably.
  • Exemplary antibody fragments include scFv fragments, Fab fragments (e.g., Fab' or F(ab')2), and the like.
  • the humanized internalizing moiety (e.g., the humanized antibody and antigen binding fragments of the disclosure) is not directly fused to any heterologous agent or not fused or otherwise linked to a therapeutic or toxic heterologous agent.
  • the internalizing moiety may still be post-translationally modified (e.g., glycosylated or) and/or provided as part of a composition.
  • the humanized internalizing moiety e.g., the antibodies or antigen binding fragments of the disclosure, such as humanized antibodies or antibody binding fragments
  • the internalizing moiety effects delivery of a heterologous agent into a cell (i.e., penetrate desired cell; transport across a cellular membrane; deliver across cellular membranes to, at least, the cytoplasm).
  • this disclosure relates to an internalizing moiety which promotes delivery of a heterologous agent into muscle, liver and/or neuronal cells, as well as certain other cell types. This portion promotes entry of the conjugate into cells.
  • the humanized antibody and antigen binding fragments of the disclosure promote entry into cells via an ENT transporter, such as an ENT2 transporter and/or an ENT3 transporter.
  • ENT2 is expressed preferentially in certain cell types, including muscle (skeletal and cardiac), neuronal and/or liver cells.
  • conjugates e.g., conjugates in which a humanized antibody or antigen binding fragment of the disclosure is conjugated to a heterologous agent
  • the conjugates may be delivered with some level of enrichment for particular tissues, including skeletal muscle, cardiac muscle, diaphragm, liver and neurons.
  • the internalizing moiety is capable of binding
  • polynucleotides e.g., a target/antigen for an antibody of the disclosure is DNA. This is consistent with the properties of the 3E10 antibody which is known to bind DNA (e.g., to specifically bind DNA).
  • the internalizing moiety is capable of binding DNA. In certain embodiments, the internalizing moiety is capable of binding DNA with a K D of less than 100 nM.
  • the internalizing moiety is capable of binding DNA (e.g., single stranded DNA or blunt double stranded DNA) with a K D of less than 500 nM, less than 100 nM, less than 75nM, less than 50nM, or even less than 30nM, less than 20 nM, less than 10 nM, or even less than 1 nM.
  • K D can be measured using Surface Plasm on Resonance (SPR) or Quartz Crystal Microbalance (QCM), or by
  • an antibody or antibody fragment comprising a VH having the amino acid sequence set forth in SEQ ID NO: 2 and a VL having an amino acid sequence set forth in SEQ ID NO: 3 specifically binds DNA with a K D of less than lOOnM, and is an example of an anti-DNA antibody.
  • the internalizing moiety binds double-stranded, blunt DNA, and DNA binding activity is or can be demonstrated in a binding assay using blunt DNA (see, for example, Xu et. Al. (2009) EMBO Journal 28: 568-577; Hansen et al., (2012) Sci
  • the internalizing moiety is an anti-DNA antibody.
  • an internalizing moiety e.g., an antibody or antigen binding fragment
  • an internalizing moiety for use alone or associated with a heterologous agent comprises an antibody or antibody fragment that can transit cellular membranes into the cytoplasm and/or the nucleus and is capable of binding to DNA.
  • the antibody and antigen binding fragments of the disclosure such as humanized antibodies and antigen binding fragments, are based upon a murine, parental 3E10 antibody having VH and VL domains, as described above.
  • the humanized antibody has the same, substantially the same, or even improved cell penetration and/or DNA binding characteristics in comparison to the murine, parental antibody, including a murine parental antibody comprising, when present, a murine constant domain.
  • the antibodies and antigen binding fragments of the disclosure have the same CDRs, as defined using the IMGT system, as the murine, parent antibody (e.g., the antibody comprising a heavy chain comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 17 and a light chain comprising a VL comprising the amino acid sequence set forth in SEQ ID NO: 18).
  • the antibodies and antigen binding fragments of the disclosure have at least one CDR of the heavy chain and/or the light chain that differs from that of the murine, parent antibody (e.g., differ at VH CDR2 and/or VL CDR2 and/or VL CDR1, according to Kabat).
  • a humanized antibody or antigen binding fragment of the disclosure comprises a V H domain and a V L domain comprising:
  • VH CDR1 having the amino acid sequence of SEQ ID NO: 27;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 28;
  • VH CDR3 having the amino acid sequence of SEQ ID NO: 29;
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 30;
  • VL CDR2 having the amino acid sequence of SEQ ID NO: 31
  • VL CDR3 having the amino acid sequence of SEQ ID NO: 32, which CDRs are in accordance with the EVIGT system.
  • a humanized antibody or antigen binding fragment of the disclosure comprises a V H domain and a V L domain comprising:
  • VH CDR1 having the amino acid sequence of SEQ ID NO : 19;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 20;
  • VH CDR3 having the amino acid sequence of SEQ ID NO: 21, which CDRs are according to Kabat;
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 30;
  • VL CDR2 having the amino acid sequence of SEQ ID NO: 31;
  • VL CDR3 having the amino acid sequence of SEQ ID NO: 32, which CDRs are according to the IMGT system.
  • a humanized antibody or antigen binding fragment of the disclosure comprises a V H domain and a V L domain comprising:
  • VH CDR1 having the amino acid sequence of SEQ ID NO : 27;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 28;
  • VH CDR3 having the amino acid sequence of SEQ ID NO: 29, which CDRs are according to the EVIGT system, and
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 22;
  • VL CDR2 having the amino acid sequence of SEQ ID NO: 23;
  • VL CDR3 having the amino acid sequence of SEQ ID NO: 24, which CDRs are according to Kabat.
  • an antibody or antigen binding fragment of the disclosure comprises a V H domain comprising:
  • VH CDR1 having the amino acid sequence of SEQ ID NO : 19;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 37;
  • VH CDR3 having the amino acid sequence of SEQ ID NO: 21, which CDRs are according to the Kabat system, and
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 22 or 38;
  • VL CDR2 having the amino acid sequence of SEQ ID NO: 39;
  • the antibody or antigen-binding fragments of the disclosure can be compared to the murine, parent antibody or to the original 3E10 antibody or antigen binding fragment thereof. Additionally or alternatively, antibodies of the disclosure (or antigen binding fragments thereof) can be compared to alternate antibodies and fragments (e.g., other humanized antibodies based on the same murine parent).
  • the comparison could be to an alternate antibody or antigen binding fragment have the foregoing 6 IMGT or Kabat CDRs, but have one or more changes in the framework regions relative to the humanized antibody or antigen-binding fragment of the disclosure.
  • antibodies or antigen binding fragments having the CDRs disclosed herein, but with one, two, three, or four amino acid substitutions in one or more CDRs (e.g., with one
  • Activity is considered improved, relative to the murine, parental antibody, if a characteristic is at least about 5%, preferably at least about 10% better (e.g., approximately 105%, 110%, 115%, 120%, 125%, 130%, 150%, or greater than 150%) the activity of the murine, parental antibody or an alternate humanized antibody).
  • a characteristic is at least about 5%, preferably at least about 10% better (e.g., approximately 105%, 110%, 115%, 120%, 125%, 130%, 150%, or greater than 150%) the activity of the murine, parental antibody or an alternate humanized antibody).
  • an activity is considered improved, relative to another antibody, if a characteristic is at least 2-fold better.
  • an activity is considered improved if a characteristic is at least 3-, 4-, 5-, 6-, 8, or 10-fold better.
  • antibodies or humanized antibodies may comprise antibody fragments, derivatives or analogs thereof, including without limitation: antibody fragments comprising an antigen binding fragments (e.g., Fv fragments, single chain Fv (scFv) fragments, Fab fragments, Fab ' fragments, F(ab ' )2 fragments, single domain antibodies, and multivalent versions of the foregoing; multivalent internalizing moieties including without limitation: Fv fragments, single chain Fv (scFv) fragments, Fab fragments, Fab ' fragments, F(ab ' )2 fragments, single domain antibodies, camelized antibodies and antibody fragments, humanized antibodies and antibody fragments, human antibodies and antibody fragments, and multivalent versions of the foregoing; multivalent internalizing moieties including without limitation: monospecific or bispecific antibodies, such as disulfide stabilized Fv fragments, scFv tandems ((scFv) 2 fragments), diabodies, tribodies or tetrabodies,
  • the antibodies or variants thereof may comprise a constant region that is a hybrid of several different antibody subclass constant domains (e.g., any combination of IgGl, IgG2a, IgG2b, IgG3 and IgG4).
  • the internalizing moiety is an antibody fragment comprising an antigen binding fragment. In other words, in certain embodiments, the internalizing moiety is not a full length antibody but is a fragment thereof comprising an antigen binding fragment. In certain embodiments, the internalizing moiety is an scFv, Fab, Fab ' , or Fab2 ' . In certain embodiments, the internalizing moiety is a full length antibody comprising a heavy chain comprising a CHI, hinge, CH2, and CH3 domains, optionally substituted to reduce effector function, such as in the hinge and/or CH2 domains, as described herein. In certain embodiments, the heavy chain comprises a VH domain, and a constant domain comprising a CHI, hinge, CH2, and CH3 domain. In certain embodiments,
  • a heavy chain comprises a VH domain, and a constant domain comprising a CHI domain and, optionally the upper hinge.
  • the upper hinge may include, for example, 1, 2, 3, or 4 amino acid residues of the hinge region.
  • the upper hinge does not include a cysteine residue.
  • the upper hinge includes one or more consecutive residues N-terminal to a cysteine that exists in the native hinge sequence.
  • the heavy chain comprises a CH region, and a constant domain comprising a CHI domain and a hinge.
  • the hinge (whether present as part of a full length antibody or an antibody fragment) comprises a C to S substitution at a position corresponding to Kabat position 222 (e.g., a C222S in the hinge, where the variation is at a position corresponding to Kabat position 222).
  • the internalizing moiety comprises a serine residue, rather than a cysteine residue, in a hinge domain at a position corresponding to Kabat 222.
  • the heavy chain comprises a constant domain comprising a CHI, hinge, CH2 and, optionally CH3 domain.
  • a CH2 domain comprises an N to Q substitution at a position corresponding to Kabat position 297 (e.g., a N297Q in a CH2 domain, wherein the variation is at a position corresponding to Kabat position 297).
  • the internalizing moiety comprises a glutamine, rather than an asparagine, at a position corresponding to Kabat position 297.
  • an antibody or antigen binding fragment as disclosed herein is a full length antibody comprising CHI, hinge, CH2, and CH3 of a heavy chain constant domain and a light chain constant domain.
  • the heavy chain constant region comprises one or more of a CHI, CH2, and CH3 domains, optionally with a hinge.
  • Monoclonal antibody 3E10 can be produced by hybridoma 3E10 placed
  • 3E10 antibody can be produced by expressing in a host cell nucleotide sequences encoding the heavy and light chains of the 3E10 antibody.
  • the term "3E10 antibody” or “monoclonal antibody 3E10” are used also herein to refer to a murine antibody (or antigen binding fragment) comprising the a VL domain comprising the amino acid sequence of SEQ ID NO: 18 and a VH domain comprising the amino acid sequence of SEQ ID NO: 17, regardless of the method used to produce the antibody.
  • 3E10 antibody will refer, unless otherwise specified, to an antibody having the sequence of the hybridoma or comprising a variable heavy chain domain comprising the amino acid sequence set forth in SEQ ID NO: 17 (which has a one amino acid substitution relative to that of the 3E10 antibody deposited with the ATCC, as described herein and previously demonstrated as retaining cell penetration and DNA binding activity) and the variable light chain domain comprising the amino acid sequence set forth in SEQ ID NO: 18.
  • the parent murine antibody used as the basis for humanization was an antibody comprising the VL domain comprising the amino acid sequence of SEQ ID NO: 18 and a VH domain comprising the amino acid sequence of SEQ ID NO: 17.
  • the disclosure provides, in certain embodiments, humanized antibodies based on murine 3E10.
  • the humanized internalizing moiety may also be derived from variants of mAb 3E10, such as variants of 3E10 which retain the same cell penetration characteristics as mAb 3E10, as well as variants modified by mutation to improve the utility thereof (e.g., improved ability to target specific cell types, improved ability to penetrate the cell membrane, improved ability to localize to the cellular DNA, convenient site for
  • variants include variants wherein one or more conservative substitutions are introduced into the heavy chain, the light chain and/or the constant region(s) of the antibody.
  • the light chain or heavy chain may be modified at the N-terminus or C-terminus.
  • the antibody or antibody fragment may be modified to facilitate conjugation to a heterologous agent.
  • the foregoing description of variants applies to antigen binding fragments. Any of these antibodies, variants, or fragments may be made recombinantly by expression of the nucleotide sequence(s) in a host cell.
  • Such internalizing moieties can transit cells via an ENT transporter, such as ENT2 and/or ENT3 and/or bind the same epitope (e.g., target, such as DNA) as 3E10.
  • the humanized internalizing moiety may also be derived from mutants of mAb 3E10, such as variants of 3E10 which retain the same or substantially the same cell penetration characteristics as mAb 3E10, as well as variants modified by mutation to improve the utility thereof (e.g., improved ability to target specific cell types, improved ability to penetrate the cell membrane, improved ability to localize to the cellular DNA, improved binding affinity, and the like).
  • Such mutants include variants wherein one or more conservative substitutions are introduced into the heavy chain or the light chain.
  • Numerous variants of mAb 3E10 have been characterized in, e.g., US Patent 7,189,396 and WO 2008/091911, the teachings of which are incorporated by reference herein in their entirety.
  • the parent, murine 3E10 comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 17 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 18.
  • the internalizing moiety is an antigen binding fragment, such as a humanized single chain Fv (scFv).
  • scFv single chain Fv
  • the humanized antibody is a Fab' fragment.
  • the internalizing moiety is an antibody or antibody fragment comprising an immunoglobulin heavy chain constant region or fragment thereof.
  • each immunoglobulin heavy chain constant region comprises four or five domains.
  • the domains are named sequentially as follows: C H l-hinge-C H 2-C H 3(-C H 4).
  • the DNA sequences of the heavy chain domains have cross-homology among the immunoglobulin classes, e.g., the C H 2 domain of IgG is homologous to the C H 2 domain of IgA and IgD, and to the C H 3 domain of IgM and IgE.
  • immunoglobulin Fc region is understood to mean the carboxyl-terminal portion of an immunoglobulin heavy chain constant region, preferably an immunoglobulin heavy chain constant region, or a portion thereof.
  • an immunoglobulin Fc region may comprise 1) a CHI domain, a CH2 domain, and a CH3 domain, 2) a CHI domain and a CH2 domain, 3) a CHI domain and a CH3 domain, 4) a CH2 domain and a CH3 domain, or 5) a combination of two or more domains and an immunoglobulin hinge region.
  • the immunoglobulin Fc region may comprise 1) a CHI domain, a CH2 domain, and a CH3 domain, 2) a CHI domain and a CH2 domain, 3) a CHI domain and a CH3 domain, 4) a CH2 domain and a CH3 domain, or 5) a combination of two or more domains and an immunoglobulin hinge region.
  • the immunoglobulin Fc region may comprise 1) a CHI domain
  • immunoglobulin Fc region comprises at least an immunoglobulin hinge region a CH2 domain and a CH3 domain, and lacks the CHI domain.
  • the class of immunoglobulin from which the heavy chain constant region is derived is IgG (Igy) ( ⁇ subclasses 1, 2, 3, or 4).
  • Other classes of immunoglobulin, IgA (Iga), IgD (Ig5), IgE (Igs) and IgM (3 ⁇ 4 ⁇ ) may be used.
  • IgA Iga
  • IgD Ig5
  • IgE IgE
  • IgM 3 ⁇ 4 ⁇
  • the choice of particular immunoglobulin heavy chain constant region sequences from certain immunoglobulin classes and subclasses to achieve a particular result is considered to be within the level of skill in the art.
  • the portion of the DNA construct encoding the immunoglobulin Fc region may comprise at least a portion of a hinge domain, and preferably at least a portion of a CH3 domain of Fc ⁇ or the homologous domains in any of IgA, IgD, IgE, or IgM.
  • substitution or deletion of amino acids within the immunoglobulin heavy chain constant regions may be useful in the practice of the disclosure.
  • the constant region domains are human.
  • the Fc portion of any of the internalizing moieties described herein has been modified such that it does not induce antibody-dependent cell-mediated cytotoxicity (ADCC). In some embodiments, the Fc portion has been modified such that it does not bind complement.
  • a CH2 domain comprises an N to Q substitution at a position corresponding to Kabat position 297 (e.g., a N297Q in a CH2 domain, wherein the variation is at a position corresponding to Kabat position 297).
  • the internalizing moiety comprises a glutamine, rather than an asparagine, at a position corresponding to Kabat position 297.
  • the antibody or antigen binding fragment comprises hybrid heavy chain constant regions, i.e., the antibody or antigen binding fragment comprise multiple heavy chain constant region domains selected from: a CHI domain, a CH2 domain, a CH3 domain, and a CH4 domain; wherein at least one of the constant region domains in the antibody or antigen binding fragment is of a class or subclass of
  • At least one of the constant region domains in the antibody or antigen binding fragment is an IgG constant region domain
  • at least one of the constant region domains in the antibody or antigen binding fragment is of a different immunoglobulin class, i.e., an IgA, IgD, IgE, or IgM constant region domain.
  • At least one of the constant region domains in the antibody or antigen binding fragment is an IgGl constant region domain
  • at least one of the constant region domains in the antibody or antigen binding fragment is of a different IgG subclass, i.e., an IgG2A, IgG2B, IgG3 or IgG4.
  • Suitable constant regions may be human or from another species (e.g., murine). Humanized antibodies and antigen binding fragments of the disclosure are consider humanized regardless of whether and constant region sequence (heavy or light chain), if present, corresponds to that of a human immunoglobulin or corresponds to that of another species.
  • humanized internalizing moieties or fragments or variants may be utilized to promote delivery of a heterologous agent.
  • Humanized moieties derived from 3E10 are particularly well suited for this because of their demonstrated ability to effectively promote delivery to muscle, liver and neuronal cells.
  • humanized internalizing moieties are especially useful for promoting effective delivery into cells in subjects, such as human patients or model organisms.
  • antibodies and antigen binding fragments of the disclosure are useful as intermediates for further conjugation to a heterologous agent, such as a heterologous protein, peptide,
  • the humanized internalizing moieties or fragments or variants are not utilized to deliver any heterologous agent.
  • a linker may be used.
  • typical surface amino acids in flexible protein regions include Gly, Asn and Ser.
  • One exemplary linker is provided in SEQ ID NO: 6, 13 or 14.
  • Permutations of amino acid sequences containing Gly, Asn and Ser would be expected to satisfy the criteria (e.g., flexible with minimal hydrophobic or charged character) for a linker sequence.
  • Another exemplary linker is of the formula (G 4 S)n, wherein n is an integer from 1-10, such as 2, 3, or 4.
  • Other near neutral amino acids, such as Thr and Ala, can also be used in the linker sequence.
  • linkers interconnecting portions of, for example, an scFv the disclosure contemplates the use of additional linkers to, for example, interconnect the heterologous agent to the antibody portion of a conjugate or to interconnect the
  • heterologous agent portion to the antibody portion of conjugate.
  • Preparation of antibodies may be accomplished by any number of well-known methods for generating monoclonal antibodies. These methods typically include the step of immunization of animals, typically mice, with a desired immunogen (e.g., a desired target molecule or fragment thereof). Once the mice have been immunized, and preferably boosted one or more times with the desired immunogen(s), monoclonal antibody -producing hybridomas may be prepared and screened according to well known methods (see, for example, Kuby, Janis, Immunology, Third Edition, pp. 131-139, W.H. Freeman & Co.
  • a desired immunogen e.g., a desired target molecule or fragment thereof
  • phage display technology may be used to generate an internalizing moiety specific for a desired target molecule.
  • An immune response to a selected immunogen is elicited in an animal (such as a mouse, rabbit, goat or other animal) and the response is boosted to expand the immunogen-specific B-cell population.
  • Messenger RNA is isolated from those B-cells, or optionally a monoclonal or polyclonal hybridoma population.
  • the mRNA is reverse- transcribed by known methods using either a poly-A primer or murine immunoglobulin- specific primer(s), typically specific to sequences adjacent to the desired V H and V L chains, to yield cDNA.
  • the desired V H and V L chains are amplified by polymerase chain reaction (PCR) typically using V H and V L specific primer sets, and are ligated together, separated by a linker.
  • V H and V L specific primer sets are commercially available, for instance from Stratagene, Inc. of La Jolla, California. Assembled V H -linker-V L product (encoding an scFv fragment) is selected for and amplified by PCR. Restriction sites are introduced into the ends of the V H -linker-V L product by PCR with primers including restriction sites and the scFv fragment is inserted into a suitable expression vector (typically a plasmid) for phage display. Other fragments, such as an Fab' fragment, may be cloned into phage display vectors for surface expression on phage particles.
  • the phage may be any phage, such as lambda, but typically is a filamentous phage, such as fd and M13, typically M13.
  • an antibody or antibody fragment is made recombinantly in a host cell.
  • the antibody can be made recombinantly using standard techniques.
  • the humanized internalizing moieties may be modified to make them more resistant to cleavage by proteases.
  • the stability of an internalizing moiety comprising a polypeptide may be increased by substituting one or more of the naturally occurring amino acids in the (L) configuration with D-amino acids.
  • at least 1%, 5%, 10%, 20%, 50%, 80%, 90% or 100% of the amino acid residues of internalizing moiety may be of the D configuration.
  • the switch from L to D amino acids neutralizes the digestion capabilities of many of the ubiquitous peptidases found in the digestive tract.
  • enhanced stability of an internalizing moiety comprising an peptide bond may be achieved by the introduction of modifications of the traditional peptide linkages.
  • enhanced stability of an internalizing moiety may be achieved by intercalating one or more dextrorotatory amino acids (such as, dextrorotatory phenylalanine or dextrorotatory tryptophan) between the amino acids of internalizing moiety.
  • dextrorotatory amino acids such as, dextrorotatory phenylalanine or dextrorotatory tryptophan
  • a “Fab fragment” is comprised of one light chain and the C H I and variable regions of one heavy chain. Generally, the heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule.
  • a Fab may optionally include a portion of the hinge, such as the upper hinge.
  • a "Fab' fragment” contains one light chain and one heavy chain that contains more of the constant region, between the C H I and C H domains, such that an interchain disulfide bond can be formed between two heavy chains to form a F(ab') 2 molecule.
  • a “F(ab') 2 fragment” contains two light chains and two heavy chains containing a portion of the constant region between the CHI and CH2 domains, such that an interchain disulfide bond is formed between two heavy chains.
  • Native antibodies are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains (CH).
  • VH variable domain
  • CH constant domains
  • Each light chain has a variable domain at one end (VL) and a constant domain (CL) at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain.
  • Light chains are classified as either lambda chains or kappa chains based on the amino acid sequence of the light chain constant region.
  • the variable domain of a kappa light chain may also be denoted herein as VK.
  • the antibodies of the disclosure include full length or intact antibody, antibody fragments, native sequence antibody or amino acid variants, human, humanized (a form of chimeric antibodies), post-translationally modified, chimeric antibodies,
  • immunoconjugates and functional fragments thereof.
  • the antibodies can be modified in the Fc region to provide desired effector functions or serum half-life.
  • Naturally occurring antibody structural units typically comprise a tetramer.
  • Each such tetramer typically is composed of two identical pairs of polypeptide chains, each pair having one full-length "light” chain (typically having a molecular weight of about 25 kDa) and one full-length "heavy” chain (typically having a molecular weight of about 50-70 kDa).
  • the amino-terminal portion of each chain typically includes a variable region of about 100 to 110 or more amino acids that typically is responsible for antigen recognition.
  • the carboxy-terminal portion of each chain typically defines a constant region responsible for effector function.
  • Human light chains are typically classified as kappa and lambda light chains.
  • Heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • IgG has several subclasses, including, but not limited to, IgGl, IgG2, IgG3, and IgG4.
  • IgM has subclasses including, but not limited to, IgMl and IgM2.
  • IgA is similarly subdivided into subclasses including, but not limited to, IgAl and IgA2. See, e.g., Fundamental Immunology, Ch.
  • antibodies or antigen binding fragments of the disclosure comprise the following constant domain scheme: IgG2a CHl-IgGl hinge-IgGl CH2-CH3. Other suitable combinations are also contemplated.
  • the antibody comprises a full length antibody and the CHI , hinge, CH2, and CH3 is from the same constant domain subclass (e.g., IgGl).
  • the antibodies or antigen binding fragment comprises an antigen binding fragment comprising a portion of the constant domain of an immunoglobulin, for example, the following constant domain scheme: IgG2a CHl-IgGl upper hinge.
  • the antibodies or antigen binding fragments of the disclosure comprise a kappa constant domain (e.g., SEQ ID NO: 12).
  • variable regions of each of the heavy chains and light chains typically exhibit the same general structure comprising four relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions or CDRs.
  • the CDRs from the two chains of each pair typically are aligned by the framework regions, which alignment may enable binding to a specific target (e.g., antigen, DNA in the context of the present disclosure).
  • FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4 From N-terminal to C-terminal, both light and heavy chain variable regions typically comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
  • the assignment of amino acids to each domain is typically in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (1987 and 1991, National Institutes of Health, Bethesda, Md.).
  • the CDRs of a particular antibody such as an antibody provided herein, are CDRs, as defined by this Kabat system (e.g., the CDRs being referred to for an antibody or antigen binding fragment are identified using the Kabat system).
  • the FR regions are also defined and/or identified using the Kabat system.
  • the CDRs of a particular antibody are CDRs as defined by the IMGT system (e.g., CDRs for an antibody or antigen binding fragment are identified using the IMGT system).
  • Monoclonal antibodies are produced using any method that produces antibody molecules by continuous cell lines in culture. Examples of suitable methods for preparing monoclonal antibodies include the hybridoma methods of Kohler et al. (1975, Nature 256:495-497) and the human B-cell hybridoma method
  • hybridomas are used to generate an initial antibody of murine or rodent origin. That initial antibody may then be modified, such as using recombinant techniques to produce rodent variants, chimeric antibodies, humanized antibodies and the like. Other methods exist to produce an initial antibody, and such methods are known in the art.
  • any given antibody of non-human origin can then be modified to increase its humanness.
  • Antibodies may be modified for use as therapeutics.
  • Examples of such antibodies include chimeric, humanized, and fully human antibodies. Numerous methods exist in the art for the generation of chimeric, humanized and human antibodies. In the context of the present disclosure, an antibody is considered humanized if at least one of the VH domain or VL domain is humanized.
  • an VH or VL domain is humanized if the amino acid sequence of at least a portion of at least one FR regions has been modified, relative to a parent murine antibody, such that the amino acid sequence of that portion corresponds to that of a human antibody or a human consensus sequence.
  • at least one, two, three, or four FR regions of the VH domain and/or at least one, two, three, or four FR regions of the VL domain have been modified (in whole or in part) so that their sequence is more closely related to a human sequence.
  • a humanized antibody fragment may be provided in the context of a human or non-human light chain and/or heavy chain constant region (e.g., comprising a CL and one or more of a CHI, hinge, CH2, and/or CH3 domains).
  • a humanized antibody or antigen binding fragment of the disclosure is provided in the context of human light and/or heavy chain constant domains, when present. Numerous examples of humanized light and heavy chain variable domains based on a 3E10 parent antibody are provided herein. Antibodies and antibody binding fragments combining any of the humanized light chain variable domains and/or heavy chain variable domains described herein are exemplary of antibodies and antigen binding fragments of the disclosure.
  • chimeric or humanized antibodies may be produced by recombinant methods. Nucleic acids encoding the antibodies are introduced into host cells and expressed using materials and procedures generally known in the art.
  • the antibodies or antigen binding fragments of the disclosure are of the IgGl, IgG2, or IgG4 isotype.
  • the antibodies comprise a human kappa light chain and a human IgGl, IgG2, or IgG4 heavy chain.
  • the antibodies of the disclosure have been cloned for expression in mammalian cells.
  • an antibody of the disclosure is a full length antibody or an antigen binding fragment
  • antibodies and antigen binding fragments of the disclosure can be recombinantly expressed in cell lines.
  • sequences encoding particular antibodies can be used for transformation of a suitable host cell, such as a mammalian host cell or yeast host cell.
  • transformation can be achieved using any known method for introducing polynucleotides into a host cell, including, for example packaging the polynucleotide in a virus (or into a viral vector) and transducing a host cell with the virus (or vector) or by transfection procedures known in the art.
  • the transformation procedure used may depend upon the host to be transformed.
  • Methods for introducing heterologous polynucleotides into mammalian cells include, but are not limited to, dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei.
  • a nucleic acid molecule encoding the amino acid sequence of a heavy chain constant region (all or a portion), a heavy chain variable region of the disclosure, a light chain constant region, or a light chain variable region of the disclosure is inserted into an appropriate expression vector using standard ligation techniques.
  • the heavy or light chain constant region is appended to the C-terminus of the appropriate variable region and is ligated into an expression vector.
  • the vector is typically selected to be functional in the particular host cell employed (i.e., the vector is compatible with the host cell machinery such that amplification of the gene and/or expression of the gene can occur).
  • the vector is typically selected to be functional in the particular host cell employed (i.e., the vector is compatible with the host cell machinery such that amplification of the gene and/or expression of the gene can occur).
  • both the heavy and light chain may be expressed from the same vector (e.g., from the same or different promoters present on the same vector) or the heavy and light chains may be expressed from different vectors.
  • the heavy and light chains are expressed from different vectors which are transfected into the same host cell and co-expressed. Regardless of when the heavy and light chains are expressed in the same host cell from the same or a different vector, the chains can then associate to form an antibody (or antibody fragment, depending on the portions of the heavy and light chain being expressed).
  • an antibody or antigen binding fragment of the disclosure is not conjugated to a heterologous agent.
  • an antibody or antigen binding fragment of the disclosure is conjugated to a heterologous agent.
  • the heterologous agent is a protein or peptide. That protein or peptide may be expressed as an inframe, co-translation fusion protein with, for example, the heavy chain, and expressed as described herein. Chemical conjugation is also possible.
  • the interconnection/association may comprise a chemical conjugation, covalent bond, di-sulfide bond, etc. or combinations thereof.
  • at least a portion of the interconnection is via a covalent bond, such as the forming of a fusion protein between a heavy chain of the antibody of the disclosure and the heterologous agent (which may further associate with a light chain of the antibody of the disclosure). Accordingly, the disclosure provides such conjugates and pharmaceutical compositions comprising such conjugates.
  • a conjugate is a molecule comprising an antibody or antigen binding portion of the disclosure associate with a heterologous agent.
  • antibodies or antigen binding fragments of the disclosure may further comprise a heterologous agent.
  • Conjugates along molecules where the two portions are associated or interconnected e.g., the interconnection may comprise a chemical conjugation, covalent bond, di-sulfide bond, etc. or combinations thereof).
  • at least a portion of the interconnection is via a covalent bond, such as the forming of a fusion protein between a heavy chain of an antibody of the disclosure and the heterologous agent (which may further associate with a light chain of the antibody or antibody fragment of the disclosure).
  • expression vectors used in any of the host cells will contain sequences for plasmid maintenance and for cloning and expression of exogenous nucleotide sequences.
  • sequences collectively referred to as "flanking sequences" in certain embodiments will typically include one or more of the following nucleotide sequences: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a sequence encoding a leader sequence for polypeptide secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
  • a promoter one or more enhancer sequences
  • an origin of replication a transcriptional termination sequence
  • a complete intron sequence containing a donor and acceptor splice site a sequence encoding a leader sequence for polypeptide secreti
  • An origin of replication is typically a part of those prokaryotic expression vectors purchased commercially, and the origin aids in the amplification of the vector in a host cell. If the vector of choice does not contain an origin of replication site, one may be chemically synthesized based on a known sequence, and ligated into the vector.
  • the origin of replication from the plasmid pBR322 is suitable for most gram-negative bacteria and various viral origins (e.g., SV40, polyoma, adenovirus, vesicular stomatitus virus (VSV), or papillomaviruses such as HPV or BPV) are useful for cloning vectors in mammalian cells.
  • viral origins e.g., SV40, polyoma, adenovirus, vesicular stomatitus virus (VSV), or papillomaviruses such as HPV or BPV
  • the origin of replication component is not needed for mammalian expression vectors (for example, the SV40 origin is often used only because it also contains the virus early promoter).
  • the expression and cloning vectors of the disclosure will typically contain a promoter that is recognized by the host organism and operably linked to the molecule encoding heavy and/or light chain. Promoters are untranscribed sequences located upstream (i.e., 5') to the start codon of a structural gene (generally within about 100 to 1000 bp) that control the transcription of the structural gene. Promoters are conventionally grouped into one of two classes: inducible promoters and constitutive promoters. Inducible promoters initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, such as the presence or absence of a nutrient or a change in temperature.
  • Constitutive promoters initiate continual gene product production; that is, there is little or no control over gene expression.
  • a large number of promoters, recognized by a variety of potential host cells, are well known.
  • a suitable promoter is operably linked to the DNA encoding the heavy chain or light chain comprising an antibody or antigen binding fragment of the disclosure.
  • the same promoter is used for both the heavy and light chain.
  • different promoters are used for each.
  • Suitable promoters for use with yeast hosts are also well known in the art.
  • Yeast enhancers are advantageously used with yeast promoters.
  • Suitable promoters for use with mammalian host cells are well known and include, but are not limited to, those obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis-B virus and most preferably Simian Virus 40 (SV40).
  • viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis-B virus and most preferably Simian Virus 40 (SV40).
  • Other suitable mammalian promoters
  • Additional promoters which may be of interest include, but are not limited to: the SV40 early promoter region (Bernoist and Chambon, 1981, Nature 290:304-10); the CMV promoter; the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto et al., 1980, Cell 22:787-97); the herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci.
  • elastase I gene control region that is active in pancreatic acinar cells (Swift et al., 1984, Cell 38:639- 46; Ornitz et al., 1986, Cold Spring Harbor Symp. Quant. Biol. 50:399-409 (1986);
  • mice mammary tumor virus control region that is active in testicular, breast, lymphoid and mast cells (Leder et al., 1986, Cell 45:485-95); the albumin gene control region that is active in liver (Pinkert et al., 1987, Genes and Devel. 1 :268-76); the alpha- feto-protein gene control region that is active in liver (Krumlauf et al., 1985, Mol. Cell. Biol. 5: 1639-48; Hammer et al., 1987, Science 235:53-58); the alpha 1-antitiypsin gene control region that is active in liver (Kelsey et al., 1987, Genes and Devel.
  • the vector may also include an enhancer sequence to increase transcription of DNA encoding light chain or heavy chain.
  • Expression vectors of the disclosure may be constructed from a starting vector such as a commercially available vector. Such vectors may or may not contain all of the desired flanking sequences. Where one or more of the flanking sequences described herein are not already present in the vector, they may be individually obtained and ligated into the vector. Methods used for obtaining each of the flanking sequences are well known to one skilled in the art.
  • the completed vector may be inserted into a suitable host cell for amplification and/or polypeptide expression.
  • the transformation of an expression vector into a selected host cell may be accomplished by well known methods including transfection, infection, calcium phosphate co-precipitation, electroporation, microinjection, lipofection, DEAE-dextran mediated transfection, or other known techniques. The method selected will in part be a function of the type of host cell to be used. These methods and other suitable methods are well known to the skilled artisan, and are set forth, for example, in Sambrook et al., supra.
  • the host cell when cultured under appropriate conditions, synthesizes the antibody or antigen binding fragment of the disclosure that can subsequently be collected from the culture medium (if the host cell secretes it into the medium) or directly from the host cell producing it (if it is not secreted).
  • the selection of an appropriate host cell will depend upon various factors, such as desired expression levels, polypeptide modifications that are desirable or necessary for activity (such as glycosylation or phosphorylation) and ease of folding into a biologically active molecule.
  • Mammalian cell lines available as hosts for expression are well known in the art and include, but are not limited to, many immortalized cell lines available from the American Type Culture Collection (A.T.C.C.), including but not limited to Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), and a number of other cell lines.
  • A.T.C.C. American Type Culture Collection
  • CHO Chinese hamster ovary
  • HeLa cells HeLa cells
  • BHK baby hamster kidney
  • COS monkey kidney cells
  • human hepatocellular carcinoma cells e.g., Hep G2
  • the cell line stably expresses an antibody or antigen binding fragment of the disclosure. In other embodiments, the cells transiently express an antibody or antigen binding fragment of the disclosure.
  • antibodies of the disclosure including antigen binding fragments
  • Numerous methods, filters, and devices for substantially purifying antibodies grown in recombinant cell culture are available.
  • Antibody fragments can also be made by enzymatic digestion of a full length antibody.
  • the antibodies or antigen binding fragments of the disclosure are detectably labeled.
  • the detectable label is itself an example of a heterologous agent.
  • Methods for conjugation to a substance, such as a detectable label are well known in the art.
  • the attached substance is a detectable label (also referred to herein as a reporter molecule). Suitable substances for attachment to include, but are not limited to, a fluorophore, a chromophore, a dye, a radioisotope, and
  • label refers to incorporation of a detectable marker, e.g., by incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotin moieties that can be detected by marked avidin (e.g., streptavidin preferably comprising a detectable marker such as a fluorescent marker, a chemiluminescent marker or an enzymatic activity that can be detected by optical or colorimetric methods).
  • marked avidin e.g., streptavidin preferably comprising a detectable marker such as a fluorescent marker, a chemiluminescent marker or an enzymatic activity that can be detected by optical or colorimetric methods.
  • Various methods of labeling polypeptides and glycoproteins are known in the art and may be used advantageously in the methods disclosed herein.
  • labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, "mTc, U1 ln, 125 I, 131 I).
  • the label is a radioactive isotope. Examples of suitable radioisotopes or radionuclides (e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, "mTc, U1 ln, 125 I, 131 I).
  • the label is a radioactive isotope. Examples of suitable
  • radioactive materials include, but are not limited to, iodine ( I, I, I, I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( m In,' U2 In, U3 mln, 115 mln,), technetium ( 99 Tc, 99 201 Ti), gallium ( 68 Ga, 67 Ga), palladium ( 103 Pd), molybdenum ( 99 Mo),
  • labels include fluorescent labels (e.g., fluoroscein
  • FITC isothiocyanate
  • rhodamine or lanthanide phosphors
  • enzymatic labels e.g., horseradish peroxidase, ⁇ -galactosidase, luciferase, alkaline phosphatase
  • chemiluminescent labels such as biotinyl groups
  • hapten labels such as biotinyl groups
  • predetermined polypeptide epitopes recognized by a secondary reporter e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags.
  • labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
  • the heterologous agent is a therapeutic molecule and either does not include a detectable label and/or epitope tag, or includes a therapeutic molecule in addition to the detectable label and/or epitope tag.
  • “Humanized” refers to an immunoglobulin such as an antibody, wherein the amino acids directly involved in antigen binding, the so-called complementary determining regions (CDR), of the heavy and light chains are not necessarily of human origin, while at least a portion of the rest of the variable domain (e.g., one or more of FR1, FR2, FR3, FR4) of one or both chains of the immunoglobulin molecule, the so-called framework regions of the variable heavy and/or light chains, and, if present, optionally the constant regions of the heavy and light chains are modified so that their amino acid sequence more closely correspond to human sequences.
  • CDR complementary determining regions
  • a "humanized antibody” as used herein in the case of a two or greater chain antibody is one where at least one chain is humanized.
  • a humanized antibody chain has a variable region where one or more of the framework regions are human or contain alterations, relative to a murine parent, so that one or more framework regions are more human than a murine parent.
  • a humanized antibody which is a single chain is one where the chain has a variable region where one or more of the framework regions are human or contain alterations, relative to a murine parent, so that one or more framework regions are more human.
  • the non-human portions of the variable region of the humanized antibody chain or antigen-binding fragment is derived from a non-human source, particularly a non- human antibody, typically of rodent origin.
  • the non-human contribution to the humanized antibody is typically provided in the form of at least one CDR region which is interspersed among framework regions derived from one (or more) human immunoglobulin(s).
  • framework support residues may be altered to preserve binding affinity.
  • an entire framework region or all of the framework regions on a particular chain need not contain residues corresponding to a human antibody in order for the antibody to be considered humanized.
  • a “humanized antibody” may further comprise constant regions (e.g., at least one constant region or portion thereof, in the case of a light chain, and in some embodiments three constant regions in the case of a heavy chain).
  • a humanized antibody is generated by first subjecting a murine 3E10 light or heavy chain antibody sequence (e.g., the murine 3E10 antibody light and heavy chain amino acid sequences of SEQ ID NO: 18 and 17, respectively) to a sequence database search (e.g., BLAST) in order to identify the top closest human immunoglobulin kappa or heavy chain homologues in sequence similarity (e.g., the top 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 closest immunoglobulin kappa or heavy chain homologues).
  • sequence database search e.g., BLAST
  • the top closest human immunoglobulin kappa or heavy chain homologues are considered candidates for kappa or heavy chain CDR grafting.
  • sequence alignment tools such as Vector NTi sequence alignment tools, are then used to analyze the chimeric amino acid sequences consisting of the CDRs from the 3E10 kappa or heavy chain and the framework regions of any one of the top human immunoglobulin kappa or heavy chain homologues.
  • humanized antibodies comprise one or two variable domains in which all or part of the CDR regions correspond to parts derived from the non- human parent sequence and in which all or part of the FR regions are derived from a human immunoglobulin sequence.
  • the humanized antibody can then, optionally, comprise at least one portion of a constant region of immunoglobulin (Fc), in particular that of a selected reference human immunoglobulin.
  • Fc immunoglobulin
  • the antibodies and antigen binding fragments of the disclosure comprises one or more of the CDRs of the 3E10 antibody.
  • the antibodies and antigen binding fragments comprise one or more of the CDRs of a 3E10 antibody comprising a V H domain comprising the amino acid sequence set forth in SEQ ID NO: 17 and a V L domain comprising the amino acid sequence set forth in SEQ ID NO : 18.
  • Either or both of the Kabat or IMGT CDRs may be used to refer to or describe an antibody.
  • CDRs of the 3E10 antibody or an antibody of the disclosure may be determined using any of the CDR identification schemes available in the art, and such scheme may be used to describe the antibody.
  • the CDRs are defined according to the Kabat definition as set forth in Kabat et al. Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service,
  • the CDRs are defined according to Chothia et al., 1987, J Mol Biol. 196: 901-917 and Chothia et al., 1989, Nature. 342:877-883.
  • the CDRs are defined according to the international ImMunoGeneTics database (EVIGT) as set forth in LeFranc et al., 2003, Development and Comparative Immunology, 27: 55-77.
  • the CDRs of the 3E10 antibody are defined according to Honegger A, Pluckthun A., 2001, J Mol Biol., 309:657-670.
  • the CDRs are defined according to any of the CDR identification schemes discussed in Kunik et al., 2012, PLoS Comput Biol. 8(2): el002388.
  • antibodies and antigen binding fragments of the disclosure comprise one or more differences in the Kabat CDRs as compared to the murine, parent antibody.
  • the antibodies and antigen binding fragments of the disclosure differ at VH CDR2 and/or VL CDR2 and, optionally, at VL CDR1 in comparison to the murine, parent antibody.
  • such antibodies share the EVIGT CDRs of the murine, parent antibody.
  • amino acid positions of residues in the VH and VL domains are referred to by linear sequence relative to, for example, SEQ ID NO: 17 or 18.
  • sequence of the VH and/or VL of an antibody or antigen binding fragment of the disclosure can be described relative to the corresponding amino acid position(s) of SEQ ID NO: 17 or 18.
  • an VH or VL domain may include an alteration at a particular amino acid position, and that position may correspond to a particular position in SEQ ID NO: 17 or 18.
  • the CDR identification scheme also provide numbering systems that may be used to facilitate comparisons between antibodies.
  • numbering schemes that may be used to facilitate comparisons between antibodies.
  • one of skill in the art can readily use the available numbering scheme to refer to the CDRs described herein using a uniform numbering system, rather than by referring to the linear sequence.
  • to number residues of an antibody for the purpose of identifying CDRs according to any of the CDR identification schemes known in the art one may align the antibody at regions of homology of the sequence of the antibody with a "standard" numbered sequence known in the art for the elected CDR identification scheme. Maximal alignment of framework residues frequently requires the insertion of "spacer" residues in the numbering system, to be used for the Fv region.
  • the antibodies and antigen binding fragments of the disclosure comprises Kabat CDRs.
  • the antibodies and antigen binding fragments comprise a V H CDRl that corresponds to amino acid residues 31-35 of SEQ ID NO: 17, a V H CDR2 that corresponds to amino acid residues 50-66 of SEQ ID NO: 17, and/or a V H CDR3 that corresponds to amino acid residues 99-105 of SEQ ID NO: 17.
  • this numbering of amino acid residues is with reference to the linear amino acid sequence of SEQ ID NO: 17.
  • One of skill in the art can readily use the Kabat system to identify these residues using Kabat numbering.
  • the antibodies and antigen binding fragments comprise a V L CDRl that corresponds to amino acid residues 24-38 of SEQ ID NO: 18, a V L CDR2 that corresponds to amino acid residues 54-60 of SEQ ID NO: 18, and/or a V L CDR3 that corresponds to amino acid residues 93-101 of SEQ ID NO: 18.
  • this numbering of amino acid residues is with reference to the linear amino acid sequence of SEQ ID NO: 18.
  • One of skill in the art can readily use the Kabat system to identify these residues using Kabat numbering.
  • the antibodies and antigen binding fragments of the disclosure comprise CDRs that are defined using the IMGT system.
  • the antibodies and antigen binding fragments comprise V H CDRl that corresponds to amino acid residues 26-33 of SEQ ID NO: 17, a V H CDR2 that corresponds to amino acid residues 51-58 of SEQ ID NO: 17, and/or a V H CDR3 that corresponds to amino acid residues 97-105 of SEQ ID NO: 17.
  • this numbering of amino acid residues is with reference to the linear amino acid sequence of SEQ ID NO: 17.
  • the antibodies and antigen binding fragments comprise a V L CDRl that corresponds to amino acid residues 27-36 of SEQ ID NO: 18, a V L CDR2 that corresponds to amino acid residues 54-56 of SEQ ID NO: 18, and/or a V L CDR3 that corresponds to amino acid residues 93-101 of SEQ ID NO: 18.
  • this numbering of amino acid residues is with reference to the linear amino acid sequence of SEQ ID NO: 18.
  • an antibody or antigen binding fragment of the disclosure comprises all 6 of the foregoing CDRs.
  • the antibody or antigen binding fragment comprises 4 of the foregoing CDRs, and a VH CDR2 as set forth in SEQ ID NO: 37 and a VL CDR 2 as set forth in SEQ ID NO: 39.
  • the antibodies and antigen binding fragments of the disclosure comprise at least 1, 2, 3, 4, or 5 of the CDRs of 3E10 as determined using the Kabat CDR identification scheme (e.g., the CDRs set forth in SEQ ID NOs: 19-24).
  • the antibody or antigen binding fragment further comprises a VH CDR2 as set forth in SEQ ID NO: 37 and/or a VL CDR2 as set forth in SEQ ID NO: 38 and/or a VL CDRl as set forth in SEQ ID NO: 39.
  • the antibodies and antigen binding fragments comprise at least 1, 2, 3, 4 or 5 of the CDRS of 3E10 as determined using the IMGT identification scheme (e.g., the CDRs set forth in SEQ ID NOs: 27-32). In certain embodiments, the antibodies and antigen binding fragments comprise all six CDRs of 3E10 as determined using the Kabat CDR identification scheme (e.g., comprises SEQ ID NOs 19-24). In other embodiments, the antibodies and antigen binding fragments comprise all six CDRS of 3E10 as determined using the IMGT identification scheme (e.g., which are set forth as SEQ ID NOs: 27-32). For any of the foregoing, in certain embodiments, the antibodies and antigen binding fragments is an antibody that binds the same epitope (e.g., the same target, such as DNA) as 3E10 and/or the
  • antibodies and antigen binding fragments can transit cells via ENT2 and/or ENT3.
  • antibodies or antigen binding fragments of the disclosure comprise 6 of the foregoing CDRs, but include 1, 2 3, or 4 amino acid substitutions in one or more CDRs.
  • the antibodies or antigen binding fragments comprise 3 CDR substitutions: one substitution in each of three CDRs.
  • antibodies or antigen binding fragments of the disclosure comprise an amino acid sequence having at least one, two, three, four, or five amino acid alterations in one or more CDRs using IMGT numbering (e.g., in one or more CDRs having the amino acid sequence of any one of SEQ ID NOs: 27-32, such as having 1-2, 1-3, 1-4, or 1-5 alternations) or Kabat numbering (e.g., in one or more CDRs having the amino acid sequence of any one of SEQ ID NOs: 19-24, such as having 1-2, 1-3, 1-4, or 1-5 alterations).
  • IMGT numbering e.g., in one or more CDRs having the amino acid sequence of any one of SEQ ID NOs: 27-32, such as having 1-2, 1-3, 1-4, or 1-5 alternations
  • Kabat numbering e.g., in one or more CDRs having the amino acid sequence of any one of SEQ ID NOs: 19-24, such as having 1-2, 1-3, 1-4,
  • antibodies or antigen binding fragments of the disclosure comprise an amino acid sequence having at least one, two, three, four, or five amino acid alterations in one or more CDRs using Kabat numbering (e.g., in one or more CDRs having the amino acid sequence of any one of SEQ ID NOs: 19-24, such as have 2, 3, 4, or 5 alterations)
  • antibodies or antigen binding fragments of the disclosure comprise a VL domain comprising one or more of the following amino acid alterations: M37L, H38A or E59Q, as compared with and numbered with respect to the linear amino acid sequence of SEQ ID NO: 18.
  • any of the antibodies or antigen binding fragments disclosed herein comprise a V H domain comprising a T63 S alteration, as compared with and numbered with respect to the linear amino acid sequence of SEQ ID NO: 17.
  • antibodies or antigen binding fragments of the disclosure comprise a VL domain comprising an E59Q alteration as compared with and numbered with respect to the linear amino acid sequence of SEQ ID NO: 18, and a VH domain comprising a T63 S alteration as compared with and numbered with respect to the linear amino acid sequence of SEQ ID NO: 17.
  • one of the surprising findings of the present disclosure is the ability to generate antibodies and antigen-binding fragments that - have improved DNA binding activity versus murine 3E10, and further include an amino acid alteration (here, a substitution) in certain Kabat CDRs. Moreover, in certain embodiments, these improved antibodies having CDR substitutions are, in certain embodiments, also humanized.
  • an internalizing moiety of the disclosure binds a given DNA substrate with higher affinity as compared to an antibody or scFv or Fv having the VH and VL of the antibody produced by the hybndoma deposited with the ATCC under ATCC accession number PTA- 2439.
  • an internalizing moiety for use in the methods of the present disclosure is not an antibody or antibody fragment having the VH and VL of the antibody produced by the hybridoma deposited with the ATCC under ATCC accession number PTA- 2439.
  • an internalizing moiety for use in the methods of the present disclosure is not a murine antibody or antibody fragment.
  • the antibodies and antigen binding fragments of the disclosure comprise a variable heavy chain domain comprising at least one CDR different from the corresponding CDR set forth in SEQ ID NO: 17, as determined using the Kabat CDR identification scheme.
  • the at least one different CDR is V H CDR2 as set forth in SEQ ID NO: 37.
  • the antibodies and antigen binding fragments of the disclosure comprise a variable light chain domain comprising at least one CDR different from the corresponding CDR set forth in SEQ ID NO: 18, as determined using the Kabat CDR identification scheme.
  • the at least one different CDR is a V L CDR1 as set forth in SEQ ID NO: 38.
  • the at least one different CDR is a V L CDR2 as set forth in SEQ ID NO: 39.
  • acceptor is derived from a human immunoglobulin
  • the acceptor human framework may be from or derived from human antibody germline sequences available in public databases.
  • the antibody must be evaluated to make sure that it (i) retains the desired function of the parent, murine antibody (or optionally has enhanced function); (ii) does not have deleterious properties that make it difficult to make or use; and preferably (iii) possesses one or more advantageous properties in comparison to the murine, parent antibody. Whether and to what extent any or all of these occur for any specific humanized antibody is unpredictable and uncertain. This is particularly true where substitutions are also introduced into the CDRs. Moreover, amongst a panel of humanized antibodies or antibody fragments, some may not have the required activity and one or more antibodies that do have the required activity may have advantageous properties in comparison to other humanized antibodies. This too is unpredictable and uncertain.
  • the antibodies or antigen-binding fragments of the disclosure comprise a light chain variable (VL) domain and a heavy chain variable (VH) domain; wherein the VL domain is humanized and comprises:
  • VH CDR1 having the amino acid sequence of SEQ ID NO: 27;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 28;
  • VH CDR3 having the amino acid sequence of SEQ ID NO: 29; which CDRs are in accordance with the IMGT system
  • VH domain is humanized and comprises:
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 30;
  • VL CDR2 having the amino acid sequence of SEQ ID NO: 31;
  • VL CDR3 having the amino acid sequence of SEQ ID NO: 32; which CDRs are in accordance with the IMGT system, and wherein the antibody or antigen-binding fragment has increased DNA binding and/or cell penetration, relative to that of a murine 3E10 antibody comprising a light chain variable (VL) domain having the amino acid sequence of SEQ ID NO: 18 and a heavy chain variable (VH) domain having the amino acid sequence of SEQ ID NO: 17.
  • VL light chain variable
  • VH heavy chain variable
  • the antibodies or antigen-binding fragments of the disclosure comprise a light chain variable (VL) domain and a heavy chain variable (VH) domain; wherein the VH domain comprises:
  • VH CDR1 having the amino acid sequence of SEQ ID NO: 19;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 37;
  • VH CDR3 having the amino acid sequence of SEQ ID NO: 21,
  • VL comprises:
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 38
  • VL CDR2 having the amino acid sequence of SEQ ID NO: 39
  • VL CDR3 having the amino acid sequence of SEQ ID NO: 24,
  • the antibodies or antigen-binding fragments of the disclosure comprise a light chain variable (VL) domain and a heavy chain variable (VH) domain; wherein the VH domain comprises:
  • VH CDR1 having the amino acid sequence of SEQ ID NO: 19;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 37;
  • VH CDR3 having the amino acid sequence of SEQ ID NO: 21,
  • VL comprises:
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 22;
  • VL CDR2 having the amino acid sequence of SEQ ID NO: 39;
  • VL CDR3 having the amino acid sequence of SEQ ID NO: 24,
  • antibodies or antigen binding fragments of the disclosure penetrate cells (e.g., can transit the plasma membrane and enter into cells, such as cells expressing ENT2).
  • the VH domain is humanized. In some embodiments, the VL domain is humanized.
  • the antibodies or antigen-binding fragments of the disclosure comprise a V L domain that comprises the amino acid sequence set forth in SEQ ID NO: 35, or an amino acid sequence that differs from SEQ ID NO: 35 by the presence of a total of 1, 2, 3, 4, 5, or 6 amino acid substitutions, insertions and/or deletions in the framework regions, as defined by the EVIGT system, relative to SEQ ID NO: 35.
  • the V L domain comprises the amino acid sequence set forth in SEQ ID NO: 3, or an amino acid sequence that differs from SEQ ID NO: 3 by the presence of a total of 1, 2, 3, 4, 5, or 6 amino acid substitutions, insertions and/or deletions in the framework regions, as defined by the IMGT system, relative to SEQ ID NO: 3.
  • the VL domain comprises the amino acid sequence set forth in SEQ ID NO: 35.
  • the VL domain comprises the amino acid sequence set forth in SEQ ID NO: 3.
  • the antibodies or antigen-binding fragments of the disclosure comprise a V H domain that comprises the amino acid sequence set forth in SEQ ID NO: 33, or an amino acid sequence that differs from SEQ ID NO: 33 by the presence of a total of 1 , 2, 3, 4, 5, or 6 amino acid substitutions, insertions and/or deletions in the framework regions, as defined by the IMGT system, relative to SEQ ID NO: 33.
  • the V H domain comprises the amino acid sequence set forth in SEQ ID NO: 34, or an amino acid sequence that differs from SEQ ID NO: 34 by the presence of a total of 1 , 2, 3, 4, 5, or 6 amino acid substitutions, insertions and/or deletions in the framework regions, as defined by the IMGT system, relative to SEQ ID NO: 34.
  • the V H domain comprises the amino acid sequence set forth in SEQ ID NO: 2, or an amino acid sequence that differs from SEQ ID NO: 2 by the presence of a total of 1 , 2, 3, 4, 5, or 6 amino acid substitutions, insertions and/or deletions in the framework regions, as defined by the IMGT system, relative to SEQ ID NO: 2.
  • the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 33.
  • the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 34.
  • the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 2.
  • the antibodies or antigen-binding fragments of the disclosure comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V L domain is humanized and comprises the amino acid sequence set forth in SEQ ID NO: 3 ; wherein the V H domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 17, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • V L light chain variable
  • V H heavy chain variable
  • the antibodies or antigen-binding fragments of the disclosure comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V L domain is humanized and comprises the amino acid sequence set forth in SEQ ID NO: 35; wherein the V H domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 17, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • V L light chain variable
  • V H heavy chain variable
  • the antibodies or antigen-binding fragments of the disclosure comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V H domain is humanized and comprises the amino acid sequence set forth in SEQ ID NO: 2; wherein the V L domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 18, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • V L light chain variable
  • V H heavy chain variable
  • the antibodies or antigen-binding fragments of the disclosure comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V H domain is humanized and comprises the amino acid sequence set forth in SEQ ID NO: 33; wherein the V L domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 18, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • the antibodies or antigen-binding fragments of the disclosure comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V H domain comprises the amino acid sequence set forth in SEQ ID NO: 34; wherein the V L domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 18, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • the antibodies or antigen-binding fragments of the disclosure comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V H domain is humanized and comprises the amino acid sequence set forth in SEQ ID NO: 2; wherein the V L domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 3, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • V H domain of the antibodies or antigen-binding fragments described herein comprise:
  • VH CDR1 having the amino acid sequence of SEQ ID NO : 27;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 28;
  • VH CDR3 having the amino acid sequence of SEQ ID NO: 29.
  • V L domain of the antibodies or antigen-binding fragments described herein comprise:
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 30;
  • VL CDR2 having the amino acid sequence of SEQ ID NO: 31;
  • the antibodies or antigen-binding fragments disclosed herein comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V L domain comprises the amino acid sequence set forth in SEQ ID NO: 3; wherein the V H domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 17, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • V L light chain variable
  • V H heavy chain variable
  • the antibodies or antigen-binding fragments disclosed herein comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V L domain comprises the amino acid sequence set forth in SEQ ID NO: 35; wherein the V H domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 17, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • V L light chain variable
  • V H heavy chain variable
  • the antibodies or antigen-binding fragments disclosed herein comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V H domain comprises the amino acid sequence set forth in SEQ ID NO: 2; wherein the V L domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 18, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • the antibodies or antigen-binding fragments disclosed herein comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V H domain comprises the amino acid sequence set forth in SEQ ID NO: 33; wherein the V L domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 18, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • the antibodies or antigen-binding fragments disclosed herein comprise a light chain variable (V L ) domain and a heavy chain variable (V H ) domain; wherein the V H domain comprises the amino acid sequence set forth in SEQ ID NO: 34; wherein the V L domain comprises three CDRs of the amino acid sequence set forth in SEQ ID NO: 18, wherein the antibody or antigen-binding fragment binds DNA and penetrates cells.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a humanized V H domain that comprises the amino acid sequence of SEQ ID NO: 2, and b) a V L domain that comprises the amino acid sequence of SEQ ID NO: 18.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a humanized V H domain that comprises the amino acid sequence of SEQ ID NO: 2, and b) a humanized V L domain that comprises the amino acid sequence of SEQ ID NO: 3.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a humanized VH domain that comprises the amino acid sequence of SEQ ID NO: 2, and b) a humanized VL domain that comprises the amino acid sequence of SEQ ID NO: 35.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a humanized V H domain that comprises the amino acid sequence of SEQ ID NO: 33, and b) a VL domain that comprises the amino acid sequence of SEQ ID NO: 18.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a humanized VH domain that comprises the amino acid sequence of SEQ ID NO: 33, and b) a humanized V L domain that comprises the amino acid sequence of SEQ ID NO: 3.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a humanized VH domain that comprises the amino acid sequence of SEQ ID NO: 33, and b) a humanized VL domain that comprises the amino acid sequence of SEQ ID NO: 35.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a humanized V H domain that comprises the amino acid sequence of SEQ ID NO: 34, and b) a VL domain that comprises the amino acid sequence of SEQ ID NO: 18.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a humanized VH domain that comprises the amino acid sequence of SEQ ID NO: 34, and b) a humanized V L domain that comprises the amino acid sequence of SEQ ID NO: 3.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a humanized VH domain that comprises the amino acid sequence of SEQ ID NO: 34, and b) a humanized VL domain that comprises the amino acid sequence of SEQ ID NO: 35.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a VH domain that comprises the amino acid sequence of SEQ ID NO: 17, and b) a humanized VL domain that comprises the amino acid sequence of SEQ ID NO: 3.
  • an antibody or antigen-binding fragment of the disclosure comprises: a) a V H domain that comprises the amino acid sequence of SEQ ID NO: 17, and b) a humanized VL domain that comprises the amino acid sequence of SEQ ID NO: 35.
  • an antibody or antigen-binding fragment of the disclosure includes a signal sequence.
  • the signal sequence is conjugated to the N-terminal portion of any of the V L sequences disclosed herein (e.g., SEQ ID NO: 3).
  • the signal sequence conjugated to the light chain is SEQ ID NO: 5.
  • the signal sequence is conjugated to the N-terminal portion of any of the VH sequences disclosed herein (e.g., SEQ ID NO: 2).
  • the signal sequence conjugated to the heavy chain is SEQ ID NO: 4.
  • signal sequence when a signal sequence is included for expression of an antibody or antibody fragment, that signal sequence is generally cleaved and not present in the finished polypeptide (e.g., the signal sequence is generally cleaved and present only transiently during protein production).
  • the V H domain of any of the antibodies or antigen-binding fragments of the disclosure described herein comprise one or more of the following amino acid alterations: V5Q, E6Q, LI IV, VI 21, K13Q, R18L, K19R, V37I, E42G, A49S, T63S, A75S, F80Y, T84N, S88A, M93V, Tl 11L or LI 12V, as compared with an numbered with reference to the amino acid sequence of SEQ ID NO: 17.
  • an antibody or antigen-binding fragment comprises one or more amino acid alteration at a position corresponding to the foregoing, where the corresponding position is compared with SEQ ID NO: 17.
  • the V H domain comprises one or more of the following amino acid alterations: V5Q, LI IV, K13Q, R18L, K19R, V37I, E42G, A49S, T63S, A75S, F80Y, T84N, M93V, Ti l 1L or LI 12V, as compared with and numbered with reference to the amino acid sequence of SEQ ID NO: 17.
  • the V H domain comprises at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, or at least 17 of said alterations, as compared with and numbered with reference to the amino acid sequence of SEQ ID NO: 17.
  • At least one of the alterations in the V H domain is a V5Q alteration, as compared with and numbered with reference to the amino acid sequence of SEQ ID NO: 17. In certain embodiments, at least one of the alterations in the V H domain is a E6Q alteration, as compared with and numbered with reference to the amino acid sequence of SEQ ID NO: 17. In certain embodiments, at least one of the alterations in the V H domain is a LI IV alteration, as compared with and numbered with reference to the amino acid sequence of SEQ ID NO: 17. In certain embodiments, at least one of the alterations in the V H domain is a V37I alteration, as compared with and numbered with reference to the amino acid sequence of SEQ ID NO: 17.
  • the V H domain retains a serine at the amino acid position corresponding to amino acid position 88 of SEQ ID NO: 17. In certain embodiments, the V H domain retains a valine at the amino acid position corresponding to amino acid position 12 of SEQ ID NO: 17. In certain embodiments, the V H domain retains a tryptophan at the amino acid position corresponding to amino acid position 47 of SEQ ID NO: 17. All operable combinations of the foregoing are contemplated, as are combinations with any of the aspect and embodiments provided herein for the VL.
  • the V L domain of any of the humanized antibodies or antigen-binding fragments described herein comprise one or more of the following amino acid alterations: V3Q, L4M, A9S, A12S, V13A, L15V, Q17D, A19V, S22T, M37L, H38A, G45E, Q46K, P47A, E59Q, A64S, H76T, N78T, H80S, P81 S, V82L, E83Q, E84P, A87V, A87F, or G104A, as compared with and numbered with reference to the amino acid sequence of SEQ ID NO: 18.
  • the V L domain comprises one or more of the following amino acid alterations: V3Q, L4M, A9S, A12S, V13A, L15V, Q17D, A19V, G45E, Q46K, P47A, E59Q, A64S, H76T, N78T, H80S, P81 S, V82L, E83Q, E84P, A87V, or G104A, as compared with and numbered with reference to the amino acid sequence of SEQ ID NO: 18.
  • the V L domain comprises at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, or at least 22 of said amino acid alterations, as compared with and numbered with reference to the amino acid sequence of SEQ ID NO: 18.
  • the VH domain comprises an L to V alteration at a position corresponding to position 11 of SEQ ID NO: 17 (e.g., an LI IV alteration). This is exemplary of how all of the foregoing alterations can also be described, and such description is expressly contemplated.
  • the VL domain comprises a V to Q alteration at a position corresponding to position 3 of SEQ ID NO: 18 (e.g., a V3Q alteration).
  • the V L domain comprises a serine at each of the amino acid positions corresponding to amino acid positions 80 and 81 of SEQ ID NO: 18. In certain embodiments, the V L domain retains a lysine at the amino acid position corresponding to amino acid position 53 of SEQ ID NO: 18. In certain embodiments, the VL domain does not have any one or more of the following amino acid combinations:
  • the humanized internalizing moiety e.g., a humanized antibody or antigen-binding fragment comprising a light chain variable (VL) domain comprising the amino acid sequence set forth in SEQ ID NO: 3 and a heavy chain variable (VH) domain comprising the amino acid sequence set forth in SEQ ID NO: 2
  • VL light chain variable
  • VH heavy chain variable
  • the humanized internalizing moiety is associated with at least two superior physiological or biological properties as compared to a reference non-humanized internalizing moiety.
  • the humanized internalizing moiety is associated with at least three superior physiological or biological properties as compared to a reference non-humanized internalizing moiety (e.g., the murine, parent 3E10 antibody).
  • a reference non-humanized internalizing moiety e.g., the murine, parent 3E10 antibody.
  • the reference non-humanized internalizing moiety comprises the murine parent antibody comprising a VH comprising the amino acid sequence of SEQ ID NO: 17 and a VL comprising the amino acid sequence of SEQ ID NO : 18.
  • the reference humanized internalizing moiety is an antibody comprising the amino acid sequence of SEQ ID NO: 42.
  • the reference internalizing moiety is a humanized antibody or antigen binding fragment comprising the VH amino acid sequence of SEQ ID NO: 41 and the V L amino acid sequence of SEQ ID NO: 40.
  • the antibodies or antigen-binding fragments described herein are humanized and are associated with at least one superior biological or
  • murine antibody comprises a V L domain comprising the amino acid sequence set forth in SEQ ID NO: 18 and a VH domain comprising the amino acid sequence set forth in SEQ ID NO: 17, and/or as compared to an alternative antibody or antigen-binding fragment thereof, wherein said alternative antibody or antigen-binding fragment comprises a VL domain comprising the CDRs of the amino acid sequence set forth in SEQ ID NO: 18 and a V H domain comprising the CDRs of the amino acid sequence set forth in SEQ ID NO: 17; and wherein said alternative antibody or fragment does not comprise a VL domain comprising the amino acid sequence of SEQ ID NO: 3 or 35, and/or wherein said alternative antibody or fragment does not comprise a VH domain comprising the amino acid sequence of any of SEQ ID NOs: 2, 33 or 34; or, in some embodiments, wherein said alternative antibody or fragment does not comprise a VL domain comprising the amino acid sequence of SEQ ID NO: 3, and/or wherein said alternative antibody
  • a humanized internalizing moiety of the disclosure e.g., a humanized antibody or antigen-binding fragment thereof comprises a light chain variable (VL) domain comprising the amino acid sequence set forth in SEQ ID NO: 3 and a heavy chain variable (VH) domain comprising the amino acid sequence set forth in SEQ ID NO: 2) is associated with at least one superior physiological or biological property as compared to an alternative internalizing moiety or fragment thereof (e.g., a different humanized antibody based on the same parent, murine antibody and, optionally, having the same CDRs).
  • VL light chain variable
  • VH heavy chain variable
  • a humanized internalizing moiety of the disclosure is associated with at least two superior physiological or biological properties as compared to the alternative internalizing moiety (e.g., a different humanized antibody based on the same parent, murine antibody and, optionally, having the same CDRs).
  • the humanized internalizing moiety of the disclosure is associated with at least three superior physiological or biological properties as compared to the alternative internalizing moiety (e.g., a different humanized antibody based on the same parent, murine antibody and, optionally, having the same CDRs).
  • the alternative antibody is the parent antibody from which the humanized antibody was derived (e.g., the parent, murine antibody).
  • the alternative antibody is another humanized antibody that is derived from the 3E10 antibody but that has a different amino acid sequence than the humanized internalizing moieties or antigen-binding fragments thereof of the present disclosure.
  • an antibody or antigen binding fragment of the disclosure has one or more improved characteristics in comparison to the murine parent antibody and/or an alternative humanized antibody.
  • the alternative humanized antibody has one, two, or three amino acid substitutions in the Kabat CDRs, as compared to an antibody of the disclosure.
  • the alternative internalizing moiety or fragment thereof comprises:
  • VH CDR1 having the amino acid sequence of SEQ ID NO: 19;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 20;
  • VH CDR3 having the amino acid sequence of SEQ ID NO: 21 ;
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 22;
  • VL CDR2 having the amino acid sequence of SEQ ID NO: 23;
  • VL CDR3 having the amino acid sequence of SEQ ID NO: 24, which CDRs are defined in accordance with Kabat, but does not comprise the same scaffold amino acid sequence present in the humanized internalizing moieties or fragments thereof of the present disclosure (e.g. a humanized internalizing moiety or fragment thereof comprising the amino acid sequence of any of SEQ ID NOs: 2, 3 or 38-40).
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with reduced immunogenicity in a human patient as compared to the immunogenicity of the non- humanized or to the alternative antibody or antigen-binding fragment in a human patient.
  • the skilled worker is familiar with numerous assays for determining the immunogenicity of the antibodies.
  • the humanized antibodies of the disclosure are associated with reduced immunogenicity in a human patient, but retain the cell penetration properties associated with the murine 3E10 antibody.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with increased solubility in a physiologically acceptable carrier as compared to the solubility of the non-humanized or to the alternative antibody or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • a physiologically acceptable carrier includes include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • the humanized internalizing moiety or fragment is associated with at least 5%, 10%, 25%, 50%, 75%), 100%), 150%), 200%) or 300% greater solubility in a physiologically acceptable carrier as compared to a non-humanized or alternative internalizing moiety or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the skilled worker is aware of routine experiments that may be utilized for testing the solubility of the humanized internalizing moieties or fragments thereof.
  • solubility assays include standard turbidity or light-scattering assays, commercial solubility assays, such as the OptiSolTM solubility assay kit (DiLyx, Seattle, WA), or the protein solubility assay screen described in Bondos et al., 2003, Analytical Biochemistry, 316:223-231 may be utilized.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with a higher expression level in a type of cell as compared to the expression level of the non- humanized or alternative antibody or antigen-binding fragment in the same type of cell.
  • the humanized internalizing moiety or fragment is associated with at least 5%, 10%, 25%, 50%, 75%, 100%, 150%, 200% or 300% higher expression level in a cell as compared to the expression level of a non-humanized or alternative internalizing moiety or antigen-binding fragment in the same type of cell.
  • the skilled worker is aware of routine experiments that may be utilized for testing the expression level of the humanized internalizing moieties or fragments thereof.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with lower toxicity (e.g., cytotoxicity and/or genotoxicity) in a cell type as compared to the toxicity in the same type of cell that is associated with the non-humanized or alternative antibody or antigen-binding fragment.
  • the humanized internalizing moiety or fragment is associated with at least 5%, 10%, 25%, 50%, 75%, 100%, 150%,
  • the cell is a mammalian cell. In some embodiments the cell is a human cell. In some embodiments, the cell is in an organism, such as a mammal. In some embodiments, the cell is a human cell in a human organism. The skilled worker is aware of routine experiments that may be utilized for testing the toxicity of the humanized internalizing moieties or fragments thereof.
  • the toxicity of the humanized internalizing moieties or fragments of the disclosure and of the non-humanized or alternative internalizing moieties or fragments thereof may be tested in an in vitro cell or cell culture, such as in a cell or cell culture derived from human cells, or may be tested in an in vitro animal model such as a mouse or rat.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with reduced aggregation in a physiologically acceptable carrier as compared to aggregation of the non-humanized or alternative antibody or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the humanized internalizing moiety or fragment is associated with at least 5%, 10%, 25%, 50%, 75%, 100%, 150%, 200%) or 300%) less aggregation in a physiologically acceptable carrier as compared to a non-humanized or alternative internalizing moiety or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the humanized antibody or antigen-binding antigen-binding fragment in a pharmaceutically acceptable carrier is associated with reduced aggregation after a period of at least 1 hour, 6 hours, 12 hours, 18 hours, 24 hours, 36 hours, 2 days, 5 days, one week, two weeks, four weeks, one month, two months, three months, six months or one year.
  • the skilled worker is aware of routine experiments that may be utilized for testing the aggregation of the humanized internalizing moieties or fragments thereof.
  • aggregation assays include standard turbidity or light-scattering assays ⁇ e.g., A600nm assay), visual inspection, SDS-PAGE, commercial aggregation assays, such as the OptiSolTM aggregation assay kit (DiLyx, Seattle, WA), HP- SEC analysis, or the protein aggregation assay screen described in Bondos et al., 2003, Analytical Biochemistry, 316:223-231 may be utilized.
  • standard turbidity or light-scattering assays e.g., A600nm assay
  • visual inspection e.g., A600nm assay
  • SDS-PAGE e.g., SDS-PAGE
  • commercial aggregation assays such as the OptiSolTM aggregation assay kit (DiLyx, Seattle, WA), HP- SEC analysis, or the protein aggregation assay screen described in Bondos et al., 2003,
  • the superior biological or physiological property associated with the humanized internalizing moieties or antigen-binding fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with increased stability in a physiologically acceptable carrier as compared to the stability of the non-humanized or alternative antibody or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the humanized internalizing moiety or fragment is associated with at least 5%, 10%, 25%, 50%, 75%, 100%), 150%), 200%) or 300% greater stability in a physiologically acceptable carrier as compared to a non-humanized or alternative internalizing moiety or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the humanized antibody or antigen-binding antigen-binding fragment in a pharmaceutically acceptable carrier is associated with increased stability after a period of at least 1 hour, 6 hours, 12 hours, 18 hours, 24 hours, 36 hours, 2 days, 5 days, one week, two weeks, four weeks, one month, two months, three months, six months or one year as compared to a non- humanized or alternative internalizing moiety or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the skilled worker is aware of routine experiments that may be utilized for testing the stability of the humanized internalizing moieties or fragments thereof.
  • the skilled worker could test the stability of the humanized and non-humanized or alternative internalizing moieties or fragments thereof after various intervals of being stored in a physiologically acceptable carrier.
  • Commercial assays such as the ProteoStatTM Thermal shift stability assay (Enzo, Farmingdale, NY) may be utilized in assessing the stability of the moieties or fragments thereof.
  • the stability of the moieties or fragments thereof may be determined by HP-SEC or by SDS-PAGE analysis.
  • the superior biological or physiological property associated with the humanized internalizing moieties or antigen-binding fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with improved cell penetration as compared to the cell penetration of the non- humanized or alternative antibody or antigen-binding fragment.
  • the improved penetration is due to the increased efficiency of the humanized internalizing moiety or antigen-binding fragment to be internalized by an ENT transporter (e.g., an ENT2 and/or ENT3 transporter).
  • the humanized internalizing moiety or fragment is associated with at least 5%, 10%, 25%, 50%, 75%, 100%, 150%, 200% or 300%) greater cell penetration as compared to a non-humanized or alternative internalizing moiety or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the skilled worker is aware of routine experiments that may be utilized for testing the cell penetration of the humanized internalizing moieties or fragments thereof.
  • the humanized internalizing moieties or fragments thereof may be labeled (e.g. fluorescently or radiolabeled) and administered to a cell or cell culture in order to determine the cell penetration of the humanized internalizing moieties or fragments thereof.
  • the humanized internalizing moieties or fragments may be administered to a cell or cell culture and then detected with a secondary agent, e.g., a fluorescently labeled or radiolabeled secondary antibody, in order to determine the cell penetration of the humanized
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with reduced glycosylation in a cell type as compared to the glycosylation of the non-humanized or alternative antibody or antigen-binding fragment in the same cell type.
  • an asparagine is mutated to another amino acid residue in the VH or VL domains in order to reduce N-linked glycosylation of the humanized antibody or antibody fragment.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with increased glycosylation in a cell type as compared to the glycosylation of the non- humanized or alternative antibody or antigen-binding fragment in the same cell type.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with a specific pattern of glycosylation in a cell type that differs from the glycosylation pattern of the non-humanized or alternative internalizing moiety or antigen-binding fragment in the same type of cell.
  • the humanized internalizing moiety or antigen-binding fragment may be hemi- glycosylated in a cell type while the non-humanized or alternative internalizing moiety or antigen-binding fragment is not hemi-glycosylated in the same type of cell.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments described herein is that the humanized internalizing moiety or antigen-binding fragment is post-translationally modified with a specific glycosylation group in a cell type that differs from the post-translational modification of the non-humanized or alternative internalizing moiety or antigen-binding fragment in the same type of cell.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with reduced deamidation in a physiologically acceptable carrier as compared to deamidation of the non-humanized or alternative antibody or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the humanized internalizing moiety or fragment is associated with at least 5%, 10%, 25%, 50%, 75%, 100%, 150%, 200% or 300%) less deamidation in a physiologically acceptable carrier as compared to a non-humanized or alternative internalizing moiety or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the humanized antibody or antigen-binding fragment in a pharmaceutically acceptable carrier is associated with reduced deamidation after a period of at least 1 hour, 6 hours, 12 hours, 18 hours, 24 hours, 36 hours, 2 days, 5 days, one week, two weeks, four weeks, one month, two months, three months, six months or one year as compared to a non-humanized or alternative internalizing moiety or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the skilled worker is aware of routine experiments that may be utilized for testing the deamidation of the humanized internalizing moieties or fragments thereof.
  • assays for testing protein deamidation include commercially available deamidation assays such as the ISOQUANT ® Isoaspartate Detection Kit (Promega, Madison WI) or Dionex UltiMate 3000 Titanium System (Dionex, Sunnyvale, CA).
  • Other assays may include peptide mapping. See generally, Kalgahtgi, K., & Horvath, C. "Rapid Peptide Mapping by High Performance Liquid Chromatography", J. Chromatography 443, 343-354 (1988).
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with reduced oxidation in a physiologically acceptable carrier as compared to oxidation of the non-humanized or alternative antibody or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the humanized internalizing moiety or fragment is associated with at least 5%, 10%, 25%, 50%, 75%, 100%, 150%, 200% or 300%) less oxidation in a physiologically acceptable carrier as compared to a non- humanized or alternative internalizing moiety or antigen-binding fragment in the same type of physiologically acceptable carrier.
  • the humanized antibody or antigen-binding antigen-binding fragment in a pharmaceutically acceptable carrier is associated with reduced oxidation after a period of at least 1 hour, 6 hours, 12 hours, 18 hours, 24 hours, 36 hours, 2 days, 5 days, one week, two weeks, four weeks, one month, two months, three months, six months or one year as compared to a non-humanized or alternative internalizing moiety or antigen-binding fragment in the same type of
  • oxidation levels may be assessed by using any one of several commercially available oxidation assays, such as the Methionine Sulfoxide
  • Immunoblotting Kit (Cayman Chemical, Ann Arbor, MI).
  • Other assays may include peptide mapping. See generally, Kalgahtgi, K., & Horvath, C. "Rapid Peptide Mapping by High Performance Liquid Chromatography", J. Chromatography 443, 343-354 (1988).
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with reduced lipidation when produced in a cell type as compared to the lipidation of the non- humanized or alternative antibody or fragment when produced in the same type of cell.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with increased lipidation when produced in a cell type as compared to the lipidation of the non-humanized or alternative antibody or antigen-binding fragment when produced in the same type of cell.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments described herein is that the humanized internalizing moiety or antigen-binding fragment is associated with a specific pattern of lipidation when produced in a cell type that differs from the lipidation pattern of the non- humanized or alternative internalizing moiety or antigen-binding fragment when produced in the same type of cell.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments described herein is that the humanized internalizing moiety or antigen-binding fragment is post- translationally modified with a specific lipidation group when produced in a cell type that differs from the post-translational modification of the non-humanized or alternative internalizing moiety or antigen-binding fragment when produced in the same type of cell.
  • the skilled worker is aware of routine experiments that may be utilized for testing the lipidation patterns of the humanized internalizing moieties or fragments thereof.
  • the internalizing moieties or fragments thereof may be assessed by the protocols described in Gelb et al., 1999, Protein Lipidation Protocols, Humana Press, pages 1-256.
  • the superior biological or physiological property associated with the humanized internalizing moieties or fragments of the disclosure described herein is that the humanized internalizing moiety or antigen-binding fragment is capable of binding a polynucleotide (e.g., DNA) with higher affinity (lower K D ) as compared to the binding affinity of the non-humanized, parent antibody or an alternative antibody or fragment, such as a different humanized antibody.
  • a polynucleotide e.g., DNA
  • lower K D lower affinity
  • the humanized internalizing moiety or fragment is associated with at least 5%, 10%, 25%, 50%, 75%, 100%, 150%, 200% or 300%) stronger binding affinity for a polynucleotide (e.g., DNA; double stranded blunt DNA) as compared to a non-humanized or alternative internalizing moiety or antigen- binding fragment in the same type of physiologically acceptable carrier.
  • a polynucleotide e.g., DNA; double stranded blunt DNA
  • binding affinity K D
  • Binding affinity can be measured using Surface Plasmon Resonance (SPR) or Quartz Crystal Microbalance (QCM), in accordance with currently standard methods and the manufacturer's protocols.
  • the disclosure provides chimeric polypeptides comprising an internalizing moiety portion and a non-internalizing moiety portion.
  • the non-internalizing moiety polypeptide portion comprises or consists of a alpha-amylase polypeptide (e.g., a mature alpha-amylase).
  • alpha-amylase polypeptide e.g., a mature alpha-amylase.
  • Numerous examples of internalizing moieties, and each of the potential non-internalizing moiety polypeptide portions are described above, and all suitable combinations of internalizing moiety portions and non-internalizing moiety polypeptide portions to generate chimeric polypeptides are contemplated.
  • the association of the alpha-amylase polypeptide (e.g., a mature alpha-amylase polypeptide) with the internalizing moiety portion facilitates delivery of the chimeric polypeptide, and thus, the non-internalizing moiety portion to the cytoplasm and, optionally, to the lysosome and/or autophagic vesicles.
  • the internalizing moiety delivers alpha-amylase activity into cells.
  • the chimeric polypeptide of the disclosure comprises an alpha-amylase- containing chimeric polypeptide (e.g., the non-internalizing moiety portion comprises or consists of an alpha-amylase polypeptide). Any of the internalizing moieties described herein may be combined with any of the non-internalizing moiety polypeptide portions, as described herein, to generate a chimeric polypeptide of the disclosure.
  • the disclosure provides chimeric polypeptides (e.g., chimeric polypeptides of the disclosure). Chimeric polypeptides for use in the methods disclosed herein can be made in various manners.
  • the chimeric polypeptides may comprise any of the internalizing moiety portions and the alpha-amylase polypeptide portions disclosed herein.
  • chimeric polypeptides of the disclosure comprise (i) an alpha-amylase polypeptide portion and (ii) an internalizing moiety portion.
  • any of the chimeric polypeptides disclosed herein may be utilized in any of the methods or compositions disclosed herein.
  • an internalizing moiety e.g. an antibody or antigen-binding fragment
  • the alpha-amylase polypeptide is a mature alpha-amylase and comprises the amino acid sequence of SEQ ID NO: 1, or variants or fragments thereof, fused to the C-terminus of an internalizing moiety.
  • the alpha- amylase polypeptide comprises the amino acid sequence of SEQ ID NO: 1, or variants or fragments thereof, fused to the C-terminus of the heavy chain segment of a Fab
  • the alpha-amylase polypeptide comprises the amino acid sequence of SEQ ID NO: 1, or variants or fragments thereof, fused to the C- terminus of the heavy chain segment of a full-length antibody internalizing moiety.
  • the chimeric polypeptide comprises: (i) an alpha-amylase polypeptide, and (ii) an internalizing moiety; wherein the alpha-amylase polypeptide comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 1 ; and wherein the internalizing moiety is an antibody or antigen binding fragment, wherein the antibody or antigen binding fragment comprises a heavy chain variable domain and a light chain variable domain; wherein the heavy chain variable domain comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 2; and wherein the light chain variable domain comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • the chimeric polypeptide comprises: (i) an alpha- amylase polypeptide, and (ii) an internalizing moiety; wherein the alpha-amylase polypeptide comprises the amino acid sequence of SEQ ID NO: 1 ; and wherein the internalizing moiety is an antibody or antigen binding fragment, wherein the antibody or antigen binding fragment comprises a heavy chain variable domain and a light chain variable domain; wherein the heavy chain variable domain comprises the amino acid sequence of SEQ ID NO: 2; and wherein the light chain variable domain comprises the amino acid sequence of SEQ ID NO: 3.
  • the heavy chain comprises the leader sequence of SEQ ID NO: 4.
  • the light chain comprises the leader sequence of SEQ ID NO: 5.
  • the disclosure provides a chimeric polypeptide that does not include a leader sequence, for example, the leader sequence has been proceesed.
  • the chimeric polypeptide comprises a linker interconnecting the alpha-amylase polypeptide to the internalizing moiety.
  • the linker comprises the amino acid sequence of SEQ ID NO: 6.
  • the chimeric polypeptide comprises a heavy chain amino acid sequence lacking a leader sequence (e.g., lacking the leader sequence of SEQ ID NO: 4).
  • the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO: 7.
  • the chimeric polypeptide comprises a light chain amino acid sequence lacking a leader sequence (e.g., lacking the leader sequence of SEQ ID NO: 5). In some embodiments, the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO: 8. In some embodiments, the chimeric polypeptide comprises the amino acid sequence of both SEQ ID NOs: 7 and 8.
  • the chimeric polypeptide comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 9. In some embodiments, the chimeric polypeptide comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 10. In some embodiments, the chimeric polypeptide comprises the amino acid sequences of both SEQ ID NOs: 9 and 10.
  • the chimeric polypeptide comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 43. In some embodiments, the chimeric polypeptide comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 8. In some embodiments, the chimeric polypeptide comprises the amino acid sequences of both SEQ ID NOs: 8 and 43.
  • a chimeric polypeptide comprising any of the mature alpha- amylase polypeptide or fragments or variants thereof disclosed herein and any of the antibodies or antigen binding fragments disclosed herein (e.g., a protein comprising the amino acid sequences of SEQ ID NOs: 8 and 43), has a higher biological activity (e.g., at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%, or 200% higher biological activity) at a slightly acidic pH (e.g., pH 5.5) as compared to a reference wildtype mature alpha amylase (e.g., an alpha-amylase consisting of the amino acid sequence of SEQ ID NO: 1).
  • a slightly acidic pH e.g., pH 5.5
  • the chimeric polypeptide has a higher biological activity (e.g., at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%), or 200% higher biological activity) at a slightly acidic pH (e.g., pH 5.5) as compared to the biological activity of the same chimeric polypeptide at a neutral pH (e.g., pH 7.0).
  • a slightly acidic pH e.g., pH 5.5
  • a neutral pH e.g., pH 7.0
  • the chimeric polypeptide has a higher biological activity (e.g., at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%, or 200% higher biological activity) at a slightly acidic pH (e.g., pH 5.5) as compared to the biological activity of the same chimeric polypeptide at a more acidic pH (e.g., pH 4.3).
  • the "slightly acidic pH” is selected from the group consisting of ranges 4.5 to 6.5; 4.8 to 6.3; 5.2 to 6.2; 5.3 to 6.3; 5.0 to 6.0; 5.2 to 5.8; 5.3 to 5.7; 5.4 to 5.6; or at 5.5.
  • the chimeric polypeptide has highest biological activity at a pH range of 4.5 to 6.5; 4.8 to 6.3; 5.2 to 6.2; 5.3 to 6.3; 5.0 to 6.0; 5.2 to 5.8; 5.3 to 5.7; 5.4 to 5.6; or at 5.5.
  • the biological activity is the ability of the alpha-amylase portion of the chimeric polypeptide to hydrolyze glycogen.
  • the biological activity may be measured using a glycogen digestion assay, similar to the assay described in the Exemplification section provided herein.
  • potential configurations include the use of truncated portions of an antibody's heavy and light chain sequences (e.g., mAB 3E10) as needed to maintain the functional integrity of the attached alpha-amylase.
  • the internalizing moiety can be linked to an exposed internal (non-terminus) residue of alpha- amylase or a fragment and/or variant thereof.
  • any combination of the alpha-amylase-internalizing moiety configurations can be employed, thereby resulting in a alpha-amylase:internalizing moiety ratio that is greater than 1 : 1 (e.g., two alpha- amylase molecules to one internalizing moiety).
  • the alpha-amylase polypeptide and the internalizing moiety may be linked directly to each other. Alternatively, they may be linked to each other via a linker sequence, which separates alpha-amylase polypeptide and the internalizing moiety by a distance sufficient to ensure that each domain properly folds into its secondary and tertiary structures.
  • Preferred linker sequences (1) should adopt a flexible extended conformation, (2) should not exhibit a propensity for developing an ordered secondary structure which could interact with the functional domains of the alpha-amylase polypeptide or the internalizing moiety, and (3) should have minimal hydrophobic or charged character, which could promote interaction with the functional protein domains.
  • Typical surface amino acids in flexible protein regions include Gly, Asn and Ser.
  • Permutations of amino acid sequences containing Gly, Asn and Ser would be expected to satisfy the above criteria for a linker sequence.
  • Other near neutral amino acids such as Thr and Ala, can also be used in the linker sequence.
  • a linker sequence length of about 20 amino acids can be used to provide a suitable separation of functional protein domains, although longer or shorter linker sequences may also be used.
  • the length of the linker sequence separating the alpha- amylase polypeptide from the internalizing moiety can be from 5 to 500 amino acids in length, or more preferably from 5 to 100 amino acids in length.
  • the linker sequence is from about 5-30 amino acids in length.
  • the linker sequence is from about 5 to about 20 amino acids, and is advantageously from about 10 to about 20 amino acids.
  • the linker joining the alpha-amylase polypeptide to an internalizing moiety can be a constant domain of an antibody (e.g., constant domain of mAb 3E10 or all or a portion of an Fc region of another antibody).
  • the linker is a cleavable linker.
  • the linker sequence comprises the linker sequence of SEQ ID NO: 6.
  • the internalizing moiety is an antibody or antibody fragment and the conjugation includes chemical or recombinant conjugation to a constant domain, such as the constant domain of a heavy chain of the antibody or antibody fragment.
  • the alpha-amylase polypeptide and internalizing moiety may be further associated via the association between the heavy chain and light chain of the antibody or antibody fragment. This is also included within the scope of the conjugation.
  • the alpha-amylase polypeptide or functional fragment thereof may be conjugated or joined directly to the internalizing moiety.
  • a recombinantly conjugated chimeric polypeptide can be produced as an in-frame fusion of the alpha-amylase portion and the internalizing moiety portion.
  • the linker may be a cleavable linker.
  • internalizing moiety may be conjugated (directly or via a linker) to the N-terminal or C- terminal amino acid of the alpha-amylase polypeptide.
  • the internalizing moiety may be conjugated (directly or indirectly) to an internal amino acid of the alpha-amylase polypeptide. Note that the two portions of the construct are
  • conjugation/joined to each other.
  • describing the chimeric polypeptide as a conjugation of the alpha-amylase portion to the internalizing moiety is used equivalently as a conjugation of the internalizing moiety to the alpha-amylase portion.
  • conjugation and/or joining refers to either chemical or genetic conjugation.
  • the chimeric polypeptides of the present disclosure can be generated using well-known cross-linking reagents and protocols.
  • cross-linking agents there are a large number of chemical cross-linking agents that are known to those skilled in the art and useful for cross-linking the alpha-amylase polypeptide with an internalizing moiety (e.g., an antibody).
  • the cross-linking agents are heterobifunctional cross-linkers, which can be used to link molecules in a stepwise manner.
  • Heterobifunctional cross-linkers provide the ability to design more specific coupling methods for conjugating proteins, thereby reducing the occurrences of unwanted side reactions such as homo-protein polymers.
  • heterobifunctional cross-linkers include succinimidyl 4-(N-maleimidomethyl) cyclohexane- 1-carboxylate (SMCC), m- Maleimidobenzoyl-N-hydroxysuccinimide ester (MBS); N-succinimidyl (4-iodoacetyl) aminobenzoate (SIAB), succinimidyl 4-(p-maleimidophenyl) butyrate (SMPB), l-ethyl-3- (3-dimethylaminopropyl) carbodiimide hydrochloride (EDC); 4-succinimidyloxycarbonyl- a-methyl-a-(2-pyridyldithio)-tolune (SMPT), N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP), succinimidyl 6-[3-(2-pyridyldithio) propionate (SMTC), m-male
  • cross-linking agents having N-hydroxysuccinimide moieties can be obtained as the N- hydroxysulfosuccinimide analogs, which generally have greater water solubility.
  • those cross-linking agents having disulfide bridges within the linking chain can be synthesized instead as the alkyl derivatives so as to reduce the amount of linker cleavage in vivo.
  • heterobifunctional cross-linkers there exists a number of other cross-linking agents including homobifunctional and photoreactive cross-linkers.
  • DSS Disuccinimidyl subcrate
  • BMH bismaleimidohexane
  • DMP dimethylpimelimidate.2 HC1
  • BASED bis-[B-(4 - azidosalicylamido)ethyl]disulfide
  • BASED bis-[B-(4 - azidosalicylamido)ethyl]disulfide
  • SANPAH N-succinimidyl-6(4'-azido-2'- nitrophenylamino)hexanoate
  • heterobifunctional cross-linkers contain the primary amine reactive group, N-hydroxysuccinimide (NHS), or its water soluble analog N-hydroxysulfosuccinimide (sulfo-NHS).
  • NHS N-hydroxysuccinimide
  • sulfo-NHS water soluble analog N-hydroxysulfosuccinimide
  • Primary amines lysine epsilon groups
  • Sulfo-NHS water soluble analog N-hydroxysulfosuccinimide
  • Another reactive group useful as part of a heterobifunctional cross-linker is a thiol reactive group.
  • Common thiol reactive groups include maleimides, halogens, and pyridyl disulfides.
  • Maleimides react specifically with free sulfhydryls (cysteine residues) in minutes, under slightly acidic to neutral (pH 6.5-7.5) conditions.
  • Halogens iodoacetyl functions
  • --SH groups react with --SH groups at physiological pH's. Both of these reactive groups result in the formation of stable thioether bonds.
  • the third component of the heterobifunctional cross-linker is the spacer arm or bridge.
  • the bridge is the structure that connects the two reactive ends. The most apparent attribute of the bridge is its effect on steric hindrance. In some instances, a longer bridge can more easily span the distance necessary to link two complex biomolecules.
  • the chimeric polypeptide comprises multiple linkers.
  • the chimeric polypeptide may comprise a first linker conjugating the alpha-amylase to the internalizing moiety, and a second linker in the scFv conjugating the VH domain (e.g., SEQ ID NO: 2) to the V L domain (e.g., SEQ ID NO: 3).
  • VH domain e.g., SEQ ID NO: 2
  • V L domain e.g., SEQ ID NO: 3
  • Preparing protein-conjugates using heterobifunctional reagents is a two-step process involving the amine reaction and the sulfhydryl reaction. For the first step, the amine reaction, the protein chosen should contain a primary amine.
  • the protein should not contain free sulfhydryl groups. In cases where both proteins to be conjugated contain free sulfhydryl groups, one protein can be modified so that all sulfhydryls are blocked using for instance, N-ethylmaleimide (see Partis et al. (1983) J. Pro. Chem. 2:263, incorporated by reference herein).
  • Ellman's Reagent can be used to calculate the quantity of sulfhydryls in a particular protein (see for example Ellman et al. (1958) Arch. Biochem. Biophys. 74:443 and Riddles et al. (1979) Anal. Biochem. 94:75, incorporated by reference herein).
  • chimeric polypeptides of the disclosure can be produced by using a universal carrier system.
  • a alpha-amylase polypeptide can be conjugated to a common carrier such as protein A, poly-L-lysine, hex-histidine, and the like.
  • the conjugated carrier will then form a complex with an antibody which acts as an internalizing moiety.
  • a small portion of the carrier molecule that is responsible for binding immunoglobulin could be used as the carrier.
  • chimeric polypeptides of the disclosure can be produced by using standard protein chemistry techniques such as those described in Bodansky, M.
  • Synthetic Peptides A User's Guide, W. H. Freeman and Company, New York (1992).
  • automated peptide synthesizers are commercially available (e.g., Advanced ChemTech Model 396; Milligen/Biosearch 9600).
  • a cleavable domain or cleavable linker can be used. Cleavage will allow separation of the internalizing moiety and the alpha-amylase polypeptide. For example, following penetration of a cell by a chimeric polypeptide, cleavage of the cleavable linker would allow separation of alpha-amylase from the internalizing moiety.
  • the chimeric polypeptides comprising a alpha-amylase polypeptide and an internalizing moiety portion can be generated as a fusion protein containing the alpha-amylase polypeptide and the internalizing moiety.
  • the chimeric polypeptides of the present disclosure can be generated as a fusion protein containing a alpha-amylase polypeptide and an internalizing moiety (e.g., an antibody or a homing peptide), expressed as one contiguous polypeptide chain.
  • the chimeric polypeptide is generated as a fusion protein that comprises an alpha-amylase polypeptide portion and internalizing moiety portion.
  • a fusion gene is constructed comprising nucleic acids which encode a alpha- amylase polypeptide and an internalizing moiety, and optionally, a peptide linker sequence to span the alpha-amylase polypeptide and the internalizing moiety.
  • the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
  • the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
  • PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can
  • chimeric gene sequence see, for example, Current Protocols in Molecular Biology, Eds. Ausubel et al. John Wiley & Sons: 1992.
  • the chimeric polypeptides encoded by the fusion gene may be recombinantly produced using various expression systems as is well known in the art (also see below).
  • chimeric polypeptides in which alpha-amylase are conjugated to variant light and heavy chains of Fv3E10 are indicated in SEQ ID NOs: 3 and 2, respectively.
  • Recombinantly conjugated chimeric polypeptides include embodiments in which the internalizing moiety is N-terminal to the alpha-amylase polypeptide and embodiments in which the internalizing moiety is C-terminal to the alpha-amylase polypeptide portion.
  • methods of making fusion proteins recombinantly are well known in the art. Any of the chimeric proteins described herein can readily be made recombinantly. This includes proteins having one or more tags and/or one or more linkers.
  • the chimeric polypeptide may comprise a first linker interconnection the internalizing moiety to the alpha-amylase polypeptide portion, and a second linker in the scFv conjugating the V H domain.
  • the chimeric polypeptides comprise a "AGIH" portion (SEQ ID NO: 1
  • the chimeric polypeptide comprises a serine at the N-terminal most position of the polypeptide.
  • the chimeric polypeptides comprise an "SAGIH” (SEQ ID NO: 26) portion at the N-terminus of the polypeptide (or within 10 amino acid residues of the N-terminus), and such chimeric polypeptides may be provided in the presence or absence of one or more epitope tags.
  • SAGIH SEQ ID NO: 26
  • the chimeric polypeptides comprise a signal sequence (e.g., SEQ ID NO: 4 or 5).
  • the signal sequence e.g., SEQ ID NO: 5
  • the signal sequence is at the N-terminus of the light chain sequence of any of the antibodies or antigen binding fragments disclosed herein.
  • the signal sequence e.g., SEQ ID NO: 5
  • the signal sequence is at the N-terminus of the amino acid sequence SEQ ID NO: 3, or fragments or variants thereof.
  • the signal sequence (e.g., SEQ ID NO: 4) is at the N- terminus of the heavy chain sequence of any of the antibodies or antigen binding fragments disclosed herein.
  • the signal sequence e.g., SEQ ID NO: 4
  • the chimeric polypeptides are produced recombinantly in cells.
  • the cells are bacteria (e.g., E. coli), yeast (e.g., Picchia), insect cells (e.g., Sf9 cells) or mammalian cells (e.g., CHO or HEK-293 cells).
  • Chimeric polypeptides of the disclosure are, in certain embodiments, made in any of the foregoing cells in culture using art recognized techniques for making and purifying protein from cells or cell supernatant.
  • the presence in the chimeric polypeptide of all or a portion of an immunoglobulin or an epitope tag, such as an HA or myc tag provides a region for purification of chimeric polypeptide.
  • the immunogenicity of the chimeric polypeptide may be reduced by identifying a candidate T-cell epitope within a junction region spanning the chimeric polypeptide and changing an amino acid within the junction region as described in U. S. Patent Publication No. 2003/0166877.
  • Chimeric polypeptides according to the disclosure can be used for numerous purposes. We note that any of the chimeric polypeptides described herein can be used in any of the methods described herein, and such suitable combinations are specifically contemplated.
  • Chimeric polypeptides described herein can be used to deliver alpha-amylase polypeptide to cells, particular to a muscle cell.
  • chimeric polypeptides deliver alpha-amylase to liver cells.
  • the chimeric polypeptides can be used to facilitate transport of alpha-amylase to cells in vitro or in vivo.
  • the chimeric polypeptides improve delivery efficiency, thus facilitating working with alpha-amylase polypeptide in vitro or in vivo.
  • the chimeric polypeptides may help decrease the amount of alpha- amylase needed for in vitro or in vivo experimentation.
  • the chimeric polypeptides and methods of the disclosure can address the problems associated with cytoplasmic accumulation of glycogen in, for example, Lafora Disease.
  • the chimeric polypeptides can be used to study the function of alpha-amylase in cells in culture, as well as to study transport of alpha-amylase.
  • the chimeric polypeptides can be used to identify binding partners for alpha-amylase in cells, such as transport between cytoplasm and lysosome.
  • the chimeric polypeptides can be used in screens to identify modifiers (e.g., small organic molecules or polypeptide modifiers) of alpha- amylase activity in a cell.
  • the chimeric polypeptides can be used to help treat or alleviate the symptoms of Lafora Disease in humans or in an animal model. The foregoing are merely exemplary of the uses for the subject chimeric polypeptides.
  • any of the chimeric polypeptides described herein, including chimeric polypeptides combining any of the features of the alpha-amylase polypeptides, internalizing moieties, and linkers, may be used in any of the methods of the disclosure.
  • the present disclosure makes use of nucleic acids for producing an alpha-amylase polypeptide (including a mature alpha-amylase polypeptide and functional fragments, variants, and fusions thereof).
  • the nucleic acids may further comprise DNA which encodes an internalizing moiety for making a recombinant chimeric protein of the disclosure.
  • the disclosure relates to isolated or recombinant nucleic acid sequences that are at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to a region of an alpha-amylase nucleotide sequence ⁇ e.g., GenBank Accession No.
  • the nucleotide sequence encodes a mature alpha-amylase polypeptide sequence.
  • the alpha-amylase nucleotide sequence encodes an alpha-amylase polypeptide that lacks the amino acids correspondings to amino acids 1-15 of SEQ ID NO: 1.
  • the alpha- amylase nucleic acid sequences can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
  • alpha-amylase nucleic acids also include nucleotide sequences that hybridize under highly stringent conditions to any of the above-mentioned nucleotide sequences, or complement sequences thereof.
  • appropriate stringency conditions which promote DNA hybridization can be varied. For example, one could perform the hybridization at 6.0 x sodium chloride/sodium citrate (SSC) at about 45 °C, followed by a wash of 2.0 x SSC at 50 °C.
  • the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 °C to a high stringency of about 0.2 x SSC at 50 °C.
  • the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 °C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
  • the disclosure provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
  • Isolated nucleic acids which differ from the native alpha-amylase nucleic acids due to degeneracy in the genetic code are also within the scope of the disclosure. For example, a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein. However, it is expected that DNA sequence polymorphisms that do lead to changes in the amino acid sequences of the subject proteins will exist among mammalian cells.
  • nucleotides up to about 3-5% of the nucleotides
  • nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this disclosure.
  • any of the nucleic acids disclosed herein are codon optimized for expression in a particular cell expression system, e.g., a mammalian cell, a yeast cell, a bacterial cell, a plant cell or an insect cell.
  • the nucleic acids are codon optimized for expression in a mammalian cell, such as a CHO or HEK-293 cell.
  • the recombinant alpha-amylase nucleic acids may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
  • Regulatory nucleotide sequences will generally be appropriate for a host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art for a variety of host cells.
  • said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the disclosure.
  • the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
  • An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
  • the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
  • this disclosure relates to an expression vector comprising a nucleotide sequence encoding a alpha-amylase polypeptide, such as any of the alpha-amylase polypeptides described herein, and operably linked to at least one regulatory sequence.
  • regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, CA (1990). It should be understood that the design of the expression vector may depend on such factors as the choice of the host cell (e.g., Chinese Hamster Ovary cells) to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
  • a nucleic acid construct comprising a nucleotide sequence that encodes a alpha-amylase polypeptide or a bioactive fragment thereof, is operably linked to a nucleotide sequence that encodes an internalizing moiety, wherein the nucleic acid construct encodes a chimeric polypeptide having alpha-amylase biological activity.
  • the nucleic acid constructs may further comprise a nucleotide sequence that encodes a linker.
  • This disclosure also pertains to a host cell transfected with a recombinant gene which encodes a alpha-amylase polypeptide or a chimeric polypeptide of the disclosure.
  • the host cell may be any prokaryotic or eukaryotic cell.
  • a alpha-amylase polypeptide or a chimeric polypeptide may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells.
  • Other suitable host cells are known to those skilled in the art.
  • the present disclosure further pertains to methods of producing a alpha-amylase polypeptide or a chimeric polypeptide of the disclosure.
  • a host cell transfected with an expression vector encoding a alpha-amylase polypeptide or a chimeric polypeptide can be cultured under appropriate conditions to allow expression of the polypeptide to occur.
  • the polypeptide may be secreted and isolated from a mixture of cells and medium containing the polypeptides.
  • the polypeptides may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
  • a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
  • polypeptides can be isolated from cell culture medium, host cells, or both using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, and immunoaffinity purification with antibodies specific for particular epitopes of the polypeptides (e.g., an alpha-amylase polypeptide).
  • the polypeptide is a fusion protein containing a domain which facilitates its purification.
  • a recombinant alpha-amylase nucleic acid can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
  • Expression vehicles for production of a recombinant polypeptide include plasmids and other vectors.
  • suitable vectors include plasmids of the types: pBR322-derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E.
  • the preferred mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
  • the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
  • vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
  • derivatives of viruses such as the bovine papilloma virus (BPV-1), or Epstein-Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
  • BBV-1 bovine papilloma virus
  • pHEBo Epstein-Barr virus
  • the various methods employed in the preparation of the plasmids and transformation of host organisms are well known in the art.
  • suitable expression systems for both prokaryotic and eukaryotic cells, as well as general recombinant procedures see Molecular Cloning A Laboratory Manual, 2nd Ed., ed.
  • baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the B-gal containing pBlueBac III).
  • fusion genes are well known. Essentially, the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
  • the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
  • PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can
  • the disclosure contemplates methods of producing chimeric proteins
  • Suitable vectors and host cells may be readily selected for expression of proteins in, for example, yeast or mammalian cells.
  • Host cells may express a vector encoding a chimeric polypeptide stably or transiently.
  • Such host cells may be cultured under suitable conditions to express chimeric polypeptide which can be readily isolated from the cell culture medium.
  • Chimeric polypeptides of the disclosure may be expressed as a single polypeptide chain or as more than one polypeptide chains.
  • An example of a single polypeptide chain is when a alpha-amylaseportion is fused inframe to an internalizing moiety, which internalizing moiety is an scFv.
  • this single polypeptide chain is expressed from a single vectors as a fusion protein.
  • the internalizing moiety is an antibody or Fab.
  • the heavy and light chains of the antibody or Fab may be expressed in a host cell expressing a single vector or two vectors (one expressing the heavy chain and one expressing the light chain).
  • the alpha- amylase polypeptide may be expressed as an inframe fusion to, for example, the C-terminus of the heavy chain such that the alpha-amylase polypeptide is appended to the internalizing moiety but at a distance to the antigen binding region of the internalizing moiety.
  • nucleotide sequences expressing a mature alpha-amylase polypeptide such as a human mature alpha-amylase polypeptide, having a particular amino acid sequence are available and can be used.
  • nucleotide sequences expressing an internalizing moiety portion such as expressing a 3E10 antibody, scFv, or Fab comprising the VH and VL set forth in SEQ ID NO: 2 and 3) are publicly available and can be combined with nucleotide sequence encoding suitable heavy and light chain constant regions.
  • the disclosure contemplates nucleotide sequences encoding any of the chimeric polypeptides of the disclosure, vectors (single vector or set of vectors) comprising such nucleotide sequences, host cells comprising such vectors, and methods of culturing such host cells to express chimeric polypeptides of the disclosure. V. Methods of Treatment and other Methods of Use
  • the disclosure contemplates the use of any of the chimeric polypeptides and/or compositions described throughout the application.
  • the disclosure contemplates the combination of any step or steps of one method with any step or steps from another method.
  • a chimeric polypeptide of the disclosure comprising a mature alpha- amylase polypeptide ⁇ e.g., a mature alpha-amylase polypeptide) portion and an
  • internalizing moiety portion can be used in any of the methods of the disclosure.
  • a chimeric polypeptide of the disclosure e.g., a
  • polypeptide comprising a mature alpha-amylase polypeptide portion and an internalizing moiety portion is delivered to the cytoplasm of cells, such as muscle (e.g., diaphragm muscle and/or cardiac muscle), neuronal cells ⁇ e.g., neuronal cells of the brain) and/or liver cells to decrease cytoplasmic glycogen accumulation (e.g., deleterious accumulation of normal of abnormal glycogen, such as polyglucosan).
  • muscle e.g., diaphragm muscle and/or cardiac muscle
  • neuronal cells e.g., neuronal cells of the brain
  • liver cells e.g., deleterious accumulation of normal of abnormal glycogen, such as polyglucosan.
  • Such cells may be present in vitro or in a subject (e.g., a patient, such as a human).
  • the subject is a subject having, or suspected or having, a glycogen storage disorder, particularly Pompe Disease, GSD III, or GSD IV, and/or a glycogen metabolism disorder, such as Lafora Disease.
  • a chimeric polypeptide of the disclosure is suitable for use in delivering alpha-amylase to cytoplasm in a subject in need thereof, such as a subject having Pompe Disease, GSD III, or GSD IV, and/or a glycogen metabolism disorder, such as Lafora Disease.
  • the subject in need thereof has or is suspected of having GSD III.
  • the subject in need thereof has or is suspected of having GSD IV.
  • the disclosure provides a method of treating (e.g., improving one or more symptoms of; decreasing glycogen accumulation, such as cytoplasmic glycogen accumulation) GSD III. In certain embodiments, the disclosure provides a method of treating (e.g., improving one or more symptoms of; decreasing glycogen accumulation, such as cytoplasmic glycogen accumulation) GSD IV. In certain embodiments, the disclosure provides a method of treating ⁇ e.g., improving one or more symptoms of; decreasing glycogen accumulation) Lafora Disease. In certain embodiments, the disclosure provides a method of treating a disease or disorder associated with hypoxia- induced glycogen accumulation. In some embodiments, the disease or disorder associated with hypoxia-induced glycogen accumulation is cancer. Further methods are described herein.
  • any of the chimeric polypeptides disclosed herein may be used to decrease glycogen accumulation in an acidic cellular compartment (e.g., a lysosome or an autophagosome).
  • the chimeric polypeptides may be used to decrease glycogen accumulation in one or more cells of a patient having a disease associated with glycogen accumulation in acidic cellular compartments (e.g., lysosomes or autophagosomes).
  • the chimeric polypeptides may be used to decrease glycogen accumulation in a Pompe Disease (GSD II) cell.
  • the chimeric polypeptides may be used to treat a patient having Pompe Disease (GSD II).
  • the chimeric polypeptides of the disclosure may be used to increase glycogen clearance in a cell.
  • the cell is a muscle (e.g., cardiac or diaphragm muscle), liver or neuronal (e.g., of the brain) cell.
  • the cell is in a subject having Lafora Disease.
  • chimeric polypeptides comprising any of the alpha-amylase polypeptides disclosed herein can be used to treat Lafora Disease. In certain embodiments, chimeric polypeptides comprising any of the alpha-amylase polypeptides disclosed herein can be used to treat Forbes-Cori Disease. In certain embodiments, the present disclosure provides methods of delivering chimeric polypeptides to cells, including cells in culture (in vitro or ex vivo) and cells in a subject. Delivery to cells in culture, such as healthy cells or cells from a model of disease, have numerous uses.
  • alpha- amylase substrates or binding partners include to identify alpha- amylase substrates or binding partners, to evaluate localization and/or trafficking (e.g., to cytoplasm, lysosome, and/or autophagic vesicles), to evaluate enzymatic activity under a variety of conditions (e.g., pH), to assess glycogen accumulation, and the like.
  • chimeric polypeptides of the disclosure can be used as reagents to understand alpha-amylase activity, localization, and trafficking in healthy or disease contexts.
  • chimeric polypeptides may be used for diagnostic or research purposes.
  • a chimeric polypeptide of the disclosure may be detectably labeled and administered to a subj ect, such as an animal model of disease or a patient, and used to image the chimeric polypeptide in the subject' s tissues (e.g., localization to muscle, brain and/or liver).
  • exemplary uses include delivery to cells in a subject, such as to an animal model of disease (e.g., Lafora Disease).
  • chimeric polypeptides of the disclosure may be used as reagents and delivered to animals to understand alpha-amylase bioactivity, localization and trafficking, protein- protein interactions, enzymatic activity, and impacts on animal physiology in healthy or diseased animals.
  • the present disclosure provides methods of treating conditions associated with, dysfunction of laforin, alpha-amylase, and/or malin , with aberrant glycogen accumulation and/or with Lafora Disease.
  • the glycogen accumulation is in the cytoplasm, and delivery of alpha-amylase reduces cytoplasmic glycogen accumulation, such as in skeletal muscle or liver.
  • the subject does not have dysfunction in endogenous laforin, alpha-amylase, and/or malin (e.g., the methods do not comprise replacement of the protein that is mutated or for which there is dysfunction).
  • these methods involve administering to the individual a therapeutically effective amount of a chimeric polypeptide as described above (e.g., a chimeric polypeptide comprising (i) an alpha-amylase polypeptide and (ii) an internalizing moiety portion).
  • a chimeric polypeptide as described above (e.g., a chimeric polypeptide comprising (i) an alpha-amylase polypeptide and (ii) an internalizing moiety portion).
  • these methods are particularly aimed at therapeutic and prophylactic treatments of animals, and more particularly, humans.
  • methods for treating Lafora Disease the disclosure contemplates all combinations of any of the foregoing aspects and embodiments, as well as combinations with any of the embodiments set forth in the detailed description and examples.
  • chimeric polypeptides of the disclosure are, in certain embodiments, suitable for treating diseases such as Lafora Disease.
  • the chimeric polypeptide decreases glycogen
  • muscle cells e.g., diaphragm muscle or cardiac muscle cells
  • liver cells e.g., neuronal cells
  • the present disclosure provides a method of delivering a chimeric polypeptide or nucleic acid construct into a cell via an equilibrative nucleoside transporter (ENT2) pathway, comprising contacting a cell with a chimeric polypeptide or nucleic acid construct.
  • the method comprises contacting a cell with a chimeric polypeptide, which chimeric polypeptide comprises an alpha-amylase polypeptide or bioactive fragment thereof and an internalizing moiety which can mediate transport across a cellular membrane via an ENT2 pathway (and optionally via another ENT transporter, such as ENT3), thereby delivering the chimeric polypeptide into the cell.
  • the cell is a muscle cell.
  • the muscle cells targeted using any of the methods disclosed herein may include skeletal (e.g., diaphragm), cardiac or smooth muscle cells.
  • the chimeric polypeptides are delivered to liver or neuronal (e.g., brain) cells.
  • the present disclosure also provides a method of delivering a chimeric polypeptide or nucleic acid construct into a cell via a pathway that allows access to cells other than muscle cells.
  • Other cell types that could be targeted using any of the methods disclosed herein include, for example, liver cells, neurons (e.g., of the brain), epithelial cells, uterine cells, and kidney cells.
  • the internalizing moiety is an antibody or antigen binding fragment, such as an antibody or antigen binding fragment that binds DNA.
  • the internalizing moiety is an antibody, such as a full length antibody or a Fab.
  • the full length antibody or Fab comprises one or more substitutions, relative to a native immunoglobulin constant region, such as to decrease effector function.
  • Lafora Disease also called Lafora progressive myoclonic epilepsy or MELF
  • MELF Lafora progressive myoclonic epilepsy
  • Lafora bodies cytoplasmic polyglucosan inclusion bodies
  • Symptoms include temporary blindness, depression, seizures, drop attacks, myoclonus, visual hallucinations, absences, ataxia and quickly developing and severe dementia. Death usually occurs 2-10 years (5 years mean) after onset.
  • Lafora Disease The prevalence of Lafora Disease is unknown. While this disease occurs worldwide, it is most common in Mediterranean countries, parts of Central Asia, India, Pakistan, North Africa and the Middle East. In Western countries, the prevalence is estimated to be below 1/1,000,000.
  • Treatment refers to curing as well as ameliorating at least one symptom of the condition or disease, and includes administration of a composition which reduces the frequency of, or delays the onset of, symptoms of a medical condition in a subject in need relative to a subject which does not receive the composition.
  • Treatment covers any treatment of a disease or condition of a mammal, particularly a human, and includes: (a) preventing symptoms of the disease or condition from occurring in a subject which may be predisposed to the disease or condition but has not yet begun experiencing symptoms; (b) inhibiting the disease or condition (e.g., arresting its development); or (c) relieving the disease or condition (e.g., causing regression of the disease or condition, providing improvement in one or more symptoms).
  • Treatment of Lafora Disease is contemplated and encompasses a complete reversal or cure of the disease, or any range of improvement in symptoms and/or adverse effects attributable to the disease.
  • Treatment of Lafora Disease includes an improvement in any of the following effects associated with Lafora Disease or combination thereof: blindness, depression, seizures, drop attacks, hepatic disease, muscle atrophy, myoclonus, visual hallucinations, absences, ataxia, dementia, and/or shortened lifespan. Treatment may also include a reduction of Lafora bodies and or aberrant accumulation of polyglucosan in, for example, muscle (e.g., cardiac or diaphragm), liver and/or brain. Other symptoms not listed above may also be monitored in order to determine the effectiveness of treating Lafora Disease.
  • the population of subjects treated by the method of the disclosure includes subjects suffering from the undesirable condition or disease, as well as subjects at risk for development of the condition or disease. In certain embodiments, the subject being treated is treated before onset of dementia or before onset of measureable, appreciable dementia.
  • the disclosure provides methods of delivering alpha- amylase activity to cells, such as muscle and/or liver and/or kidney cells of a subject having Lafora Disease comprising administering a chimeric polypeptide of the disclosure or a composition comprising a chimeric polypeptide of the disclosure formulated with one or more pharmaceutically acceptable carriers and/or excipients.
  • terapéuticaally effective dose is meant a dose that produces the desired effect for which it is administered.
  • the exact dose will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lloyd (1999) The Art, Science and Technology of Pharmaceutical
  • administration of a chimeric polypeptide of the disclosure is via any one of the routes of administration described herein, such as subcutaneous, intravenous, or via the hepatic portal vein.
  • the disclosure contemplates methods of delivery by administering via any such route of administration.
  • the method results in delivery of greater alpha-amylase activity to the cytoplasm, in comparison, to that following deliver of a alpha-amylase polypeptide that is not conjugated to an internalizing moiety and/or in comparison to that of a alpha-amylase polypeptide conjugated to a different internalizing moiety.
  • one or more chimeric polypeptides of the present disclosure can be administered, together (simultaneously) or at different times (sequentially).
  • chimeric polypeptides of the present disclosure can be administered alone or in combination with one or more additional compounds or therapies for treating Lafora Disease.
  • one or more chimeric polypeptides can be co-administered in conjunction with one or more other therapeutic compounds.
  • the combination therapy may encompass simultaneous or alternating
  • the combination may encompass acute or chronic
  • the chimeric polypeptide of the present disclosure and additional compounds act in an additive or synergistic manner for treating Lafora Disease.
  • Additional compounds to be used in combination therapies include, but are not limited to, small molecules, polypeptides, antibodies, antisense oligonucleotides, and siRNA molecules.
  • administration of the chimeric polypeptides of the disclosure may be continued while the other therapy is being administered and/or thereafter.
  • Administration of the chimeric polypeptides may be made in a single dose, or in multiple doses. In some instances, administration of the chimeric polypeptides is commenced at least several days prior to the other therapy, while in other instances, administration is begun either immediately before or at the time of the administration of the other therapy.
  • any of the chimeric polypeptides described herein are administered to a subject (e.g., a subject having Lafora Disease) in combination with an anti-epileptic drug.
  • any of the chimeric polypeptides described herein are administered to a subject (e.g., a subject having Lafora Disease) in combination with any of the chimeric polypeptides disclosed in WO 2015/192092, which is incorporated by reference in its entirety.
  • any of the chimeric polypeptides described herein are administered to a subject (e.g., a subject having Lafora Disease) in combination with any of the malin and/or laforin chimeric polypeptides disclosed in WO 2015/192092.
  • one or more chimeric polypeptides of the disclosure can be used as part of a therapeutic regimen combined with one or more additional treatment modalities.
  • additional treatment modalities include, but are not limited to, dietary therapy, occupational therapy, physical therapy, ventilator supportive therapy, massage, acupuncture, acupressure, mobility aids, assistance animals, and the like.
  • one or more chimeric polypeptides of the present disclosure can be administered prior to or following a liver transplant.
  • a chimeric polypeptide is provided as the sole form of therapy. Regardless of whether administrated alone or in combination with other medications or therapeutic regiments, the dosage, frequency, route of administration, and timing of administration of the chimeric polypeptides is determined by a physician based on the condition and needs of the patient.
  • a method may comprise administration at a dose and on a dosing schedule, such as administration at specified intervals over a period of time.
  • each dose contributes to efficacy, and is thus effective, although improvement in symptoms may only be observed after administration of multiple doses.
  • Chimeric polypeptides of the disclosure have numerous uses, including in vitro and in vivo uses. In vivo uses include not only therapeutic uses but also diagnostic and research uses in, for example, any of the foregoing animal models. By way of example, chimeric polypeptides of the disclosure may be used as research reagents and delivered to animals to understand alpha-amylase bioactivity, localization and trafficking, protein-protein interactions, enzymatic activity, and impacts on animal physiology in healthy or diseases animals.
  • Chimeric polypeptides may also be used in vitro to evaluate, for example, alpha- amylase bioactivity, localization and trafficking, protein-protein interactions, and enzymatic activity in cells in culture, including healthy and alpha-amylase deficient cells in culture.
  • the disclosure contemplates that chimeric polypeptides of the disclosure may be used to deliver alpha-amylase to cytoplasm, lysosome, and/or autophagic vesicles of cells, including cells in culture.
  • any of the methods described herein may be carried out by administering or contacting cells with a chimeric polypeptide of the disclosure and/or a composition of the disclosure (e.g., a composition comprising a chimeric polypeptide of the disclosure formulated with one or more pharmaceutically acceptable carriers and/or excipients).
  • a composition of the disclosure e.g., a composition comprising a chimeric polypeptide of the disclosure formulated with one or more pharmaceutically acceptable carriers and/or excipients.
  • nucleic acids encoding polypeptides of alpha-amylase e.g., a mature alpha- amylase
  • chimeric polypeptides comprising alpha-amylase in mammalian cells or target tissues.
  • Such methods can be used to administer nucleic acids encoding
  • polypeptides of the disclosure e.g., alpha-amylase including variants thereof, and include chimeric polypeptides
  • the disclosure contemplates that gene transfer methods may be used to deliver nucleic acid encoding any of the chimeric polypeptides of the disclosure or alpha-amylase polypeptides.
  • the nucleic acids encoding alpha-amylase are administered for in vivo or ex vivo gene therapy uses.
  • gene delivery techniques are used to study the activity of chimeric polypeptides or alpha-amylase polypeptide or to study Lafora Disease in cell based or animal models, such as to evaluate cell trafficking, enzyme activity, and protein-protein interactions following delivery to healthy or diseased cells and tissues.
  • Non-viral vector delivery systems include DNA plasmids, naked nucleic acid, and nucleic acid complexed with a delivery vehicle such as a liposome.
  • Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the cell. Such methods are well known in the art.
  • Methods of non-viral delivery of nucleic acids encoding engineered polypeptides of the disclosure include lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA.
  • Lipofection methods and lipofection reagents are well known in the art (e.g., TransfectamTM and LipofectinTM).
  • Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424, WO 91/16024. Delivery can be to cells (ex vivo administration) or target tissues (in vivo administration).
  • the preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes, is well known to one of skill in the art.
  • RNA or DNA viral based systems for the delivery of nucleic acids encoding alpha-amylase or its variants take advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus.
  • Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro and the modified cells are administered to patients (ex vivo).
  • Conventional viral based systems for the delivery of polypeptides of the disclosure could include retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer.
  • Viral vectors are currently the most efficient and versatile method of gene transfer in target cells and tissues. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues.
  • Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis- acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression.
  • Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SW), human immuno deficiency virus (HIV), and combinations thereof, all of which are well known in the art.
  • MiLV murine leukemia virus
  • GaLV gibbon ape leukemia virus
  • SW Simian Immuno deficiency virus
  • HAV human immuno deficiency virus
  • Adenoviral based systems are typically used.
  • Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system.
  • Adeno-associated virus (“AAV”) vectors are also used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures. Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No.
  • rAAV Recombinant adeno-associated virus vectors
  • All vectors are derived from a plasmid that retains only the AAV 145 bp inverted terminal repeats flanking the transgene expression cassette. Efficient gene transfer and stable transgene delivery due to integration into the genomes of the transduced cell are key features for this vector system.
  • Replication-deficient recombinant adenoviral vectors can be engineered such that a transgene replaces the Ad Ela, Elb, and E3 genes; subsequently the replication defector vector is propagated in human 293 cells that supply deleted gene function in trans.
  • Ad vectors can transduce multiple types of tissues in vivo, including nondividing, differentiated cells such as those found in the liver, kidney and muscle system tissues.
  • Packaging cells are used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and 42 cells or PA317 cells, which package retrovirus.
  • Viral vectors used in gene therapy are usually generated by producer cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host, other viral sequences being replaced by an expression cassette for the protein to be expressed. The missing viral functions are supplied in trans by the packaging cell line.
  • AAV vectors used in gene therapy typically only possess ITR sequences from the AAV genome which are required for packaging and integration into the host genome.
  • Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences.
  • the cell line is also infected with adenovirus as a helper.
  • the helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid.
  • the helper plasmid is not packaged in significant amounts due to a lack of ITR sequences.
  • Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV.
  • the gene therapy vector be delivered with a high degree of specificity to a particular tissue type.
  • a viral vector is typically modified to have specificity for a given cell type by expressing a ligand as a fusion protein with a viral coat protein on the viruses outer surface.
  • the ligand is chosen to have affinity for a receptor known to be present on the cell type of interest. This principle can be extended to other pairs of virus expressing a ligand fusion protein and target cell expressing a receptor.
  • filamentous phage can be engineered to display antibody fragments (e.g., FAB or Fv) having specific binding affinity for virtually any chosen cellular receptor.
  • antibody fragments e.g., FAB or Fv
  • nonviral vectors e.g., viral vectors, the same principles can be applied to nonviral vectors.
  • Such vectors can be engineered to contain specific uptake sequences thought to favor uptake by specific target cells, such as muscle cells.
  • Gene therapy vectors can be delivered in vivo by administration to an individual patient, by systemic administration (e.g., intravenous, intraperitoneal, intramuscular, subdermal, or intracranial infusion) or topical application.
  • vectors can be delivered to cells ex vivo, such as cells explanted from an individual patient (e.g., lymphocytes, bone marrow aspirates, tissue biopsy) or universal donor hematopoietic stem cells, followed by reimplantation of the cells into a patient, usually after selection for cells which have incorporated the vector.
  • Ex vivo cell transfection for diagnostics, research, or for gene therapy (e.g., via re- infusion of the transfected cells into the host organism) is well known to those of skill in the art.
  • cells are isolated from the subject organism, transfected with a nucleic acid (gene or cDNA) encoding, e.g., alpha-amylaseor its variants, and re-infused back into the subject organism (e.g., patient).
  • a nucleic acid gene or cDNA
  • encoding e.g., alpha-amylaseor its variants
  • Various cell types suitable for ex vivo transfection are well known to those of skill in the art.
  • stem cells are used in ex vivo procedures for cell transfection and gene therapy.
  • the advantage to using stem cells is that they can be differentiated into other cell types in vitro, or can be introduced into a mammal (such as the donor of the cells) where they will engraft in the bone marrow.
  • Stem cells are isolated for transduction and differentiation using known methods.
  • Vectors e.g., retroviruses, adenoviruses, liposomes, etc.
  • therapeutic nucleic acids can be also administered directly to the organism for transduction of cells in vivo.
  • naked DNA can be administered.
  • Administration is by any of the routes normally used for introducing a molecule into ultimate contact with blood or tissue cells. Suitable methods of administering such nucleic acids are available and well known to those of skill in the art, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective reaction than another route.
  • compositions are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of
  • compositions of the present disclosure as described herein.
  • Various delivery systems are known and can be used to administer the chimeric polypeptides of the disclosure. Any such methods may be used to administer any of the chimeric polypeptides described herein.
  • Methods of introduction can be enteral or parenteral, including but not limited to, intradermal, intramuscular, intraperitoneal, intramyocardial, intravenous, subcutaneous, pulmonary, intranasal, intraocular, epidural, intrathecal, intracranial, intraventricular and oral routes.
  • the chimeric polypeptides may be administered by any convenient route, for example, by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local.
  • the chimeric polypeptide is administered intravenously.
  • chimeric polypeptides of the disclosure may be desirable to administer locally to the area in need of treatment (e.g., muscle); this may be achieved, for example, and not by way of limitation, by local infusion during surgery, by means of a catheter, or by means of an implant, the implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, fibers, or commercial skin substitutes.
  • such local administration can be to all or a portion of the heart.
  • administration can be by intrapericardial or intramyocardial administration.
  • administration to cardiac tissue can be achieved using a catheter, wire, and the like intended for delivery of agents to various regions of the heart.
  • local administration is directed to the liver.
  • Glycogen storage and glycogenolysis in the liver affect the availability of glycogen for many other tissues in the body.
  • a venous catheter may be placed in the hepatic portal vein to deliver chimeric polypeptides directly to the liver.
  • delivery through the hepatic portal vein ensures that adequate concentrations of alpha-amylase reach the liver cells.
  • the disclosure contemplates methods in which chimeric polypeptides are administered, at the same or different times, via one than one route of administration.
  • the disclosure contemplates a regimen in which chimeric polypeptides are administered systemically, such as by intravenous infusion, in combination with local administration via the hepatic portal vein.
  • the chimeric polypeptides of the disclosure can be delivered in a vesicle, in particular, a liposome (see Langer, 1990, Science 249: 1527-1533).
  • the chimeric polypeptides of the disclosure can be delivered in a controlled release system.
  • a pump may be used (see Langer, 1990, supra).
  • polymeric materials can be used (see Howard et al., 1989, J. Neurosurg. 71 : 105).
  • the chimeric polypeptides of the disclosure can be delivered intravenously.
  • the chimeric polypeptides are administered by intravenous infusion. In certain embodiments, the chimeric polypeptides are infused over a period of at least 10, at least 15, at least 20, or at least 30 minutes. In other embodiments, the chimeric polypeptides are infused over a period of at least 60, 90, or 120 minutes. Regardless of the infusion period, the disclosure contemplates that each infusion is part of an overall treatment plan where chimeric polypeptide is administered according to a regular schedule (e.g., weekly, monthly, etc.).
  • a regular schedule e.g., weekly, monthly, etc.
  • the subject chimeric polypeptides for use in any of the methods disclosed herein are formulated with a pharmaceutically acceptable carrier (e.g., formulated with one or more pharmaceutically acceptable carriers and/or excipients).
  • a pharmaceutically acceptable carrier e.g., formulated with one or more pharmaceutically acceptable carriers and/or excipients.
  • One or more chimeric polypeptides can be administered alone or as a component of a pharmaceutical formulation (composition).
  • composition Any of the chimeric polypeptides described herein may be formulated, as described herein, and any such compositions (e.g., pharmaceutical compositions, or preparations, or formulations) may be used in any of the methods described herein.
  • the composition comprises a chimeric polypeptide comprising an alpha-amylase polypeptide.
  • the chimeric polypeptides may be formulated for administration in any convenient way for use in human or veterinary medicine.
  • Wetting agents, emulsifiers and lubricants, such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the compositions.
  • Formulations of the subject chimeric polypeptides include, for example, those suitable for oral, nasal, topical, parenteral, rectal, and/or intravaginal administration.
  • the formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy.
  • the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the host being treated and the particular mode of administration.
  • the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the compound which produces a therapeutic effect.
  • methods of preparing these formulations or compositions include combining another type of therapeutic agents and a carrier and, optionally, one or more accessory ingredients.
  • the formulations can be prepared with a liquid carrier, or a finely divided solid carrier, or both, and then, if necessary, shaping the product.
  • any of the pharmaceutical compositions described herein comprise concentrated amounts of any of the chimeric polypeptides described herein.
  • the compositions have 50%, 100%, 150%, 200%, 250%, 300%, 350% or 400%) more concentrated levels of the chimeric polypeptide as compared to the levels of chimeric polypeptide originally purified from the cells producing the chimeric polypeptide.
  • the concentration of the chimeric polypeptide is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 mg/ml. In some embodiments, the concentration of the chimeric polypeptide is at least 10 mg/ml or greater.
  • the concentration of the chimeric polypeptide is at least 15 mg/ml or greater. In some embodiments, the concentration of the chimeric polypeptide is at least 20 mg/ml or greater. In some embodiments, the concentration of the chimeric polypeptide is at least 30 mg/ml or greater. In some embodiments, the concentration of the chimeric polypeptide is at least 50 mg/ml or greater. In some embodiments, the concentration of the chimeric polypeptide is at least 70 mg/ml or greater. In some embodiments, the concentration of the chimeric polypeptide is at least 90 mg/ml or greater. In some embodiments, the
  • concentration of the chimeric polypeptide is at least 110 mg/ml or greater. In some embodiments, the concentration of the chimeric polypeptide is 10-50 mg/ml, 10-40 mg/ml, 10-30 mg/ml, 10-25 mg/ml, 10-20 mg/ml. 20-50 mg/ml, 50-70 mg/ml, 70-90 mg/ml or 90- 110 mg/ml. In some embodiments, any of the compositions described herein preserve at least 80%, 90%, 95% or 100% biological activity (as defined herein) for at least 24 hours, 2 days, 4 days, 1 week, 2 weeks or 1 month when stored in a pharmaceutically acceptable formulation at 4°C. In some embodiments of any of the foregoing, the chimeric
  • polypeptide portion of the composition is substantially pure, as described herein (e.g., greater than 85% of the alpha-amylase present is in association or interconnected with an internalizing moiety).
  • Formulations for oral administration may be in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of a subject chimeric polypeptide therapeutic agent as an active ingredient.
  • lozenges using a flavored basis, usually sucrose and acacia or tragacanth
  • Suspensions in addition to the active compounds, may contain suspending agents such as ethoxylated isostearyl alcohols, poly oxy ethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
  • suspending agents such as ethoxylated isostearyl alcohols, poly oxy ethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
  • one or more chimeric polypeptide therapeutic agents of the present disclosure may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7)
  • pharmaceutically acceptable carriers such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders
  • compositions may also comprise buffering agents.
  • Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
  • Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions,
  • the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
  • the oral compositions can also include adjuvants such as wetting agents, emulsifying and
  • suspending agents sweetening, flavoring, coloring, perfuming, and preservative agents.
  • methods of the disclosure include topical administration, either to skin or to mucosal membranes such as those on the cervix and vagina.
  • the topical formulations may further include one or more of the wide variety of agents known to be effective as skin or stratum corneum penetration enhancers. Examples of these are 2- pyrrolidone, N-methyl-2-pyrrolidone, dimethylacetamide, dimethylformamide, propylene glycol, methyl or isopropyl alcohol, dimethyl sulfoxide, and azone. Additional agents may further be included to make the formulation cosmetically acceptable. Examples of these are fats, waxes, oils, dyes, fragrances, preservatives, stabilizers, and surface active agents.
  • - no - Keratolytic agents such as those known in the art may also be included. Examples are salicylic acid and sulfur.
  • Dosage forms for the topical or transdermal administration include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches, and inhalants.
  • the subject polypeptide therapeutic agents may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers (e.g., HEPES buffer), or propellants which may be required.
  • the ointments, pastes, creams and gels may contain, in addition to a subject chimeric polypeptide agent, excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
  • Powders and sprays can contain, in addition to a subject chimeric polypeptides, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates, and polyamide powder, or mixtures of these substances.
  • Sprays can additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.
  • compositions suitable for parenteral administration may comprise one or more chimeric polypeptides in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers (e.g., HEPES buffer), bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
  • nonaqueous carriers which may be employed in the pharmaceutical compositions of the disclosure include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
  • vegetable oils such as olive oil
  • injectable organic esters such as ethyl oleate.
  • Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents.
  • microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the inject
  • I l l - be brought about by the inclusion of agents which delay absorption, such as aluminum monostearate and gelatin.
  • Injectable depot forms are made by forming microencapsule matrices of one or more polypeptide therapeutic agents in biodegradable polymers such as polylactide- polyglycolide. Depending on the ratio of drug to polymer, and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissue.
  • the chimeric polypeptides of the present disclosure are formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings.
  • the composition may also include a solubilizing agent and a local anesthetic such as lidocaine to ease pain at the site of the injection.
  • a solubilizing agent such as lidocaine to ease pain at the site of the injection.
  • the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline.
  • an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to
  • the chimeric polypeptides of the present disclosure are formulated for subcutaneous administration to human beings.
  • the chimeric polypeptides of the present disclosure are formulated for intrathecal, intracranial and/or intraventricular delivery.
  • a chimeric polypeptide of the disclosure for use in treating Lafora Disease or for use in decreasing glycogen accumulation in neurons, such as in a subject having Lafora Disease is formulated for intrathecal, intracranial and/or intraventricular delivery.
  • a method of the disclosure such as a method of treating Lafora Disease or for decreasing glycogen accumulation in neurons comprising delivering a chimeric polypeptide of the disclosure intrathecally, intracranially and/or intraventricularly.
  • the chimeric polypeptides of the present disclosure are formulated for deliver to the heart, such as for intramyocardial or intrapericaridal delivery.
  • the composition is intended for local administration to the liver via the hepatic portal vein, and the chimeric polypeptides are formulated accordingly.
  • a particular formulation is suitable for use in the context of deliver via more than one route.
  • a formulation suitable for intravenous infusion may also be suitable for delivery via the hepatic portal vein.
  • a formulation is suitable for use in the context of one route of delivery, but is not suitable for use in the context of a second route of delivery.
  • the amount of the chimeric polypeptides of the disclosure which will be effective in the treatment of a tissue-related condition or disease can be determined by standard clinical techniques.
  • in vitro assays may optionally be employed to help identify optimal dosage ranges.
  • the precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the condition, and should be decided according to the judgment of the practitioner and each subject's circumstances.
  • suitable dosage ranges for intravenous administration are generally about 20-5000 micrograms of the active chimeric polypeptide per kilogram body weight.
  • Suitable dosage ranges for intranasal administration are generally about 0.01 pg/kg body weight to 1 mg/kg body weight.
  • Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
  • compositions of the disclosure are non-pyrogenic.
  • the compositions are substantially pyrogen free.
  • the formulations of the disclosure are pyrogen-free formulations which are substantially free of endotoxins and/or related pyrogenic substances.
  • Endotoxins include toxins that are confined inside a microorganism and are released only when the microorganisms are broken down or die.
  • Pyrogenic substances also include fever-inducing, thermostable substances (glycoproteins) from the outer membrane of bacteria and other microorganisms. Both of these substances can cause fever, hypotension and shock if administered to humans. Due to the potential harmful effects, even low amounts of endotoxins must be removed from intravenously administered pharmaceutical drug solutions.
  • FDA Food & Drug Administration
  • EU endotoxin units
  • the endotoxin and pyrogen levels in the composition are less then 10 EU/mg, or less then 5 EU/mg, or less then 1 EU/mg, or less then 0.1 EU/mg, or less then 0.01 EU/mg, or less then 0.001 EU/mg.
  • the disclosure provides a composition, such as a
  • compositions comprising a chimeric polypeptide of the disclosure formulated with one or more pharmaceutically acceptable carriers and/or excipients.
  • Such compositions include compositions comprising any of the internalizing moiety portions, described herein, and an alpha-amylase portion comprising, as described herein.
  • the disclosure provides compositions comprising an alpha-amylase-containing chimeric polypeptide.
  • any of the compositions described herein may be based on any of the alpha-amylase portions and/or internalizing moiety portions described herein.
  • any such compositions may be described based on any of the structural and/or functional features described herein.
  • compositions may be used in any of the methods described herein, such as administered to cells and/or to subjects in need of treatment, such as administered to cells and/or to subjects having Lafora Disease. Any such compositions may be used to deliver alpha-amylase activity into cells, such as into muscle and/or liver cells in a patient in need thereof (e.g., a patient having Lafora Disease).
  • compositions including any of the compositions described herein, may be provided, for example, in a bottle or syringe and stored prior to administration.
  • mice engineered to be deficient in malin display a phenotype similar to that observed in human cases of Lafora Disease. Specifically, malin " " mice presented in an age- dependent manner neurodegeneration, increased synaptic excitability, and propensity to suffer myoclonic seizures. Valles-Ortega et al., 2011, EMBO Mol Med, 3(11):667-681. In addition, these mice accumulated glycogen-filled inclusion bodies that were most abundant in the hippocampus and cerebellum, but that were also found in skeletal and cardiac muscle cells. Valles-Ortega et al. Glycogen was also found to be less branched in the cells of malin " " mice as compared to glycogen observed in the cells of healthy control mice.
  • mice engineered to be deficient in laforin also display some phenotypic similarities to human cases of Lafora Disease. Specifically, laforin " " mice are born developmentally normal, but develop an age-dependent ataxia and myoclonus epilepsy. Ganesh et al., 2002, Hum Mol Genet, 1 1(1 1): 1251-62. In addition, laforin " " mice display widespread degeneration of neurons by two months of age and the development of inclusion bodies by 4-12 months of age. Ganesh et al., 2002. Mice deficient for laforin also display hyperphosphorylation and aggregation of tau protein in the brain. Puri et al., 2009, J Biol Chem, 284(34):22657-63.
  • the present disclosure contemplates methods of surveying improvements in disease phenotypes using any of the alpha-amylase (e.g., a mature alpha-amylase) constructs of the disclosure disclosed herein in any one or more animal models, such as the mouse models described herein.
  • alpha-amylase e.g., a mature alpha-amylase
  • animal models such as the mouse models described herein.
  • various parameters can be examined in experimental animals treated with a subject chimeric polypeptide, and such animals can be compared to controls.
  • Exemplary parameters that can be assessed to evaluate potential efficacy include, but are not limited to: increase in lifespan; increase in glycogen clearance, decrease in glycogen accumulation, and improved muscle strength, for example in open field and open wire hang paradigms, improved heart function, improved liver function or decrease in liver size.
  • Increase in glycogen clearance and decrease in glycogen accumulation may be assessed, for example, by periodic acid Schiff staining in a biopsy (e.g., muscle (e.g., cardiac or diaphragm), liver or neuronal) from a treated or untreated animal model. Further parameters that may be observed include a reduction in: neurodegeneration, number/duration/intensity of seizures, number or size of inclusion bodies, amount of glycogen hyperphosphorylation, ataxia, tau
  • the disclosure provides a method of decreasing cytoplasmic glycogen accumulation in a subject having any of the foregoing conditions.
  • any of the parameters disclosed herein may be monitored in the skeletal muscle (e.g., diaphragm), liver, cardiac muscle, and or brain neurons from a Lafora Disease animal model.
  • PK/PD/TK of the final product can be examined in larger animals such as rats, dogs, and primates.
  • the above models are exemplary of suitable animal model systems for assessing the activity and effectiveness of the subject chimeric polypeptides and/or formulations. These models have correlations with symptoms of Lafora Disease, and thus provide appropriate models for studying Lafora Disease. Activity of the subject chimeric polypeptides and/or formulations is assessed in any one or more of these models, and the results compared to that observed in wildtype control animals and animals not treated with the chimeric polypeptides (or treated with alpha-amylase alone). Similarly, the subject chimeric polypeptides can be evaluated using cells in culture, for example, cells prepared from any of the foregoing mutant mice or other animals, as well as wild type cells, such as fibroblasts, myoblasts or hepatocytes.
  • Cells from subjects having the disease may also be used.
  • An example of an in vitro assay for testing activity of the chimeric polypeptides disclosed herein would be to treat Lafora Disease cells with or without the chimeric polypeptides and then, after a period of incubation, stain the cells for the presence of glycogen, e.g., by using a periodic acid Schiff (PAS) stain.
  • PAS periodic acid Schiff
  • the amount of inclusion bodies and glycogen hyperphosphorylation may also be monitored.
  • Cell proliferation, morphology and cell death may also be monitored in treated or untreated cells.
  • Chimeric polypeptides of the disclosure have numerous uses, including in vitro and in vivo uses. In vivo uses include not only therapeutic uses but also diagnostic and research uses in, for example, any of the foregoing animal models. By way of example, chimeric polypeptides of the disclosure may be used as research reagents and delivered to animals to understand alpha-amylase bioactivity, localization and trafficking, protein-protein interactions, enzymatic activity, and impacts on animal physiology in healthy or diseased animals.
  • Chimeric polypeptides may also be used in vitro to evaluate, for example, alpha- amylase bioactivity, localization and trafficking, protein-protein interactions, and enzymatic activity in cells in culture, including healthy, diseased (but not alpha-amylase deficient) and laforin, alpha-amylase and/or malin deficient cells in culture.
  • the disclosure contemplates that chimeric polypeptides of the disclosure may be used to deliver alpha-amylase to cytoplasm, lysosome, and/or autophagic vesicles of cells, including cells in culture.
  • the cultured cells are obtained from a Lafora Disease subject, such as from a Lafora Disease human patient or from a Lafora Disease animal model.
  • the chimeric polypeptides may be used in a hypoxic cell model, similar to that described in Pelletier et aL Frontiers in Oncology, 2(18): 1-9.
  • cell free systems may be used to assess, for example, enzymatic activity of the subject chimeric polypeptides.
  • glycogen may be obtained from a sample from a healthy and/or a diseased subject (e.g. from a Lafora Disease subject), and the ability of any of the chimeric polypeptides disclosed herein to hydrolyze the glycogen may be assessed, e.g., in a manner similar to that described in the Example section provided herein.
  • the glycogen for used in such cell-free systems may be obtained from a muscle (e.g., diaphragm or cardiac muscle), liver, or neuronal (e.g., brain) cells from a subject (e.g., from a Lafora Disease subject).
  • the subject is a human Lafora Disease patient or an animal model of Lafora Disease.
  • Chimeric polypeptide such as alpha-amylase chimeric polypeptides, may further be used to identify protein-protein interactions in systems where a protein such as alpha- amylase is not deficient, such as in Forbes-Cori Disease. Chimeric polypeptides may further be used to understand the relative benefit of decreasing accumulation of glycogen in certain cell types but potentially not all cell types in which symptoms are present. Chimeric polypeptides may be used to identify substrates for alpha-amylase particularly in settings where endogenous alpha-amylase is not mutated. Chimeric polypeptides are useful for evaluating trafficking of alpha-amylase and the chimeric polypeptides in healthy, as well as diseased cells where glycogen accumulation is due to different underlying causes.
  • the disclosure also provides a pharmaceutical package or kit comprising one or more containers filled with at least one chimeric polypeptide of the disclosure.
  • a pharmaceutical package or kit comprising one or more containers filled with at least one chimeric polypeptide of the disclosure.
  • Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of
  • the kit includes additional materials to facilitate delivery of the subject chimeric polypeptides.
  • the kit may include one or more of a catheter, tubing, infusion bag, syringe, and the like.
  • the chimeric polypeptide is packaged in a lyophilized form, and the kit includes at least two containers: a container comprising the lyophilized chimeric polypeptide and a container comprising a suitable amount of water, buffer (e.g., HEPES buffer), or other liquid suitable for reconstituting the lyophilized material.
  • buffer e.g., HEPES buffer
  • Chimeric polypeptides comprising a mature alpha-amylase polypeptide portion and an internalizing moiety portion were made recombinantly in two different mammalian cell lines, CHO-3E7 and HEK-293 6E cells.
  • An alpha-amylase polypeptide comprising a mature alpha-amylase polypeptide (e.g., a polypeptide having the amino acid sequence of SEQ ID NO: 1) was fused to a Fab of a humanized 3E10 antibody comprising the heavy chain variable domain set forth in SEQ ID NO: 7 .
  • an alpha-amylase polypeptide having the amino acid sequence of SEQ ID NO: 1 was fused to the C-terminus of the heavy chain constant region of a humanized 3E10 Fab fragment (which included the signal sequence of SEQ ID NO: 4) by means of a linker having the amino acid sequence of SEQ ID NO: 6 to generate a fusion polypeptide having the amino acid sequence of SEQ ID NO: 9.
  • the light chain comprises the amino acid sequence of SEQ ID NO: 8 and the signal sequence of SEQ ID NO: 5 to provide the sequence of SEQ ID NO: 10.
  • Fab-alpha-amylase comprising both the heavy chain and light chains is referred to in the experimental designs described below. This Fab was made by expressing a vector encoding the light chain and a vector encoding the heavy chain-amylase fusion in either of two cell lines. Although two separate vectors were used, a single vector encoding both the heavy and light chain could also have been employed.
  • a nucleotide sequence encoding the recombinant heavy chain (SEQ ID NO: 9) and a nucleotide sequence encoding the light chain (SEQ ID NO: 10) was codon optimized for mammalian cell expression and cloned into the pTT5 vector using standard methods.
  • Low endotoxin, giga-prep scale production of the expression plasmid encoding the sequence of SEQ ID NO: 9 and the expression plasmid encoding the sequence of SEQ ID NO: 10 resulted in 7.0 mg of each plasmid DNA (each, a vector).
  • CHO-3E7 and HEK-293-6E cells were then each transfected with these two plasmids in a manner summarized below,
  • the culture media was F17 supplemented with 0.1% Pluronic F-68, 4 mM GlutaMAX.
  • Cells were maintained at a density between 0.5-5 x 10 6 cells/mL in shake flasks. The flasks were incubated at 37°C in a humidified 5% C0 2 environment with shaking at 135 rpm. Cultures were harvested 8 days post-transfection via centrifugation for 5 minutes at 1000 x g. The conditioned culture supernatant was clarified by centrifugation for 30 minutes at
  • Fab-alpha-amylase was purified from the CHO-3E7 cells using a CaptureSelect IgG-CHl affinity matrix (Life Technologies, #194320001).
  • the CaptureSelect IgG-CHl affinity resin (bed volume of 5 mL) was equilibrated in Buffer A (lxPBS (2.7 mM KC1, 1.7 mM KH 2 P0 4 , 136 mM NaCl, 10.1 mM Na 2 HP0 4 ), pH 7.2 (23 °C)).
  • Buffer A lxPBS (2.7 mM KC1, 1.7 mM KH 2 P0 4 , 136 mM NaCl, 10.1 mM Na 2 HP0 4 ), pH 7.2 (23 °C)
  • Fab-alpha-amylase from 4L of exhausted supernatant was batch bound with the CaptureSelect IgG-CHl affinity resin at 4°C overnight with stirring.
  • the resin was collected in a 2.5 cm diameter Econo-column and washed with approximately 15 column volumes (CV) of Buffer A, 15 CV of Buffer B (1 X PBS, 500 mM NaCl, pH 7.2 (23°C)) and 15 CV Buffer A.
  • the resin- bound Fab-alpha-amylase was eluted with ⁇ 4 CV of Buffer C (30 mM NaOAc, pH 3.5-3.6 (23°C)) followed by ⁇ 4 CV of Buffer D (100 mM Glycine, pH 2.7 (23°C)) collecting the protein in 2 mL fractions diluted in 1/lOth volume Buffer E (3 M NaAcetate, ⁇ pH 9.0 (23°C)) to neutralize.
  • the flasks were incubated at 37°C in a humidified 5% C0 2 environment with shaking at 135 rpm. Cultures were harvested 6 days post-transfection via centrifugation for 5 minutes at 1000 x g. The conditioned culture supernatant was clarified by centrifugation for 30 minutes at 9300 x g.
  • Fab-alpha-amylase was purified from the FIEK-293-6E cells using a CaptureSelect
  • IgG-CHl affinity matrix (Life Technologies, #194320001).
  • the CaptureSelect IgG-CHl affinity resin was equilibrated in buffer A (lxPBS (2.7 mM KC1, 1.7 mM KH 2 P0 4 , 136 mM NaCl, 10.1 mM Na 2 HP0 4 ), pH 7.2 (23 °C)).
  • Fab-alpha-amylase from 20 L of exhausted supernatant was batch bound with the CaptureSelect IgG-CHl affinity resin (40 mL bed volume) at 4°C overnight with stirring.
  • the resin was collected in a 5 cm diameter Econo-column and washed with approximately 15 column volumes (CV) of Buffer A, 15 CV of Buffer B (1 X PBS, 500 mM NaCl, pH 7.2 (23°C)) and 15 CV buffer A.
  • the resin- bound fusion protein was eluted with ⁇ 4 CV of Buffer C (30 mM NaOAc, pH 3.5-3.6 (23°C)) followed by ⁇ 4 CV of Buffer D (100 mM Glycine, pH 2.7 (23°C)) collecting the protein in 10 mL fractions diluted in 1/lOth volume Buffer E (3M NaAcetate, ⁇ pH 9.0 (23°C)) to neutralize.
  • Buffer C 30 mM NaOAc, pH 3.5-3.6 (23°C)
  • Buffer D 100 mM Glycine, pH 2.7 (23°C)
  • the combined CaptureSelect IgG-CHl affinity pool (250 mL) was dialyzed against 3 x 4 L of dialysis buffer (20 mM Histidine, 150 mM NaCl, pH 6.5 (23°C)) at 4°C.
  • the dialyzed pool was concentrated to -10 mg/mL using a VivaCell 100 (1 OK MWCO, PES membrane) centrifugal device prior to final analysis and storage at -80°C.
  • Select fractions were analyzed by SDS-PAGE and by size exclusion chromotography, where it was confirmed that the Fab-alpha-amylase was being produced and successfully purified (data not shown).
  • a protein comprising a full-length humanized 3E10 antibody and the alpha-amylase protein may be generated.
  • Other chimeric proteins of the disclosure may be, for example, similarly made, and any such proteins may be used in any of the methods described herein.
  • Fab-alpha-amylase The ability of Fab-alpha-amylase to digest glycogen was assessed in a cell-free assay.
  • Twenty mL of citrate/phosphate buffers from pH 3.5-7.0 were prepared by adding 0.1 M citric acid and 0.2 M sodium phosphate dibasic in the amounts indicated in Table 1. The buffers were spiked in 10% Tween-80 to 0.02% final, and pH was verified with a pH meter. The 0.1M sodium acetate pH 4.3 + 0.02% tween-80 was also prepared.
  • the glucose standards and digested glycogen test samples (40 ⁇ , ⁇ ) were then pipetted into 96 well plate in triplicate, and 80 ⁇ _, Glucose Oxidase kit Reagent Mix (Sigma GAGO20-1KT; prepared as described in kit) was added to each well at room temperature with a multi-channel pipette, mixed well and incubated at 37°C for 30 minutes. The reaction was terminated by adding 80 ⁇ _, 12 N sulfuric acid with multi-channel pipette and mixing well. The plate was then read at 540 nm. No meaningful glycogen digestion was observed in the negative control samples. By comparison, glycogen digestion was observed in samples having the Fab-alpha-amylase protein, with the most robust activity observed at slightly acidic pHs. Representative results from test samples are shown below in Table 2.
  • the Fab-alpha-amylase protein was also found to be inactive at a pH of 4.3 (Data
  • polyglucosan bodies are isolated from a Lafora Disease animal model (e.g., the mouse model of Ganesh et al., 2002, Hum Mol Genet, 1 1 : 1251-1262) in a manner similar to that described in Zeng et al., 2012, FEBS J, 279(14):2467-78.
  • forebrain cortical neurons are microdissected from the brains of postnatal day 2 Epm2a wildtype or knockout mice into Neurobasal medium in a manner similar to that described in Wang et al., 2013, Mol Neurobiol, 48(1):49-61.
  • Polyglucosan is then isolated in a manner similar to that described in Wang et al.
  • Purified Fab-Alpha- Amylase fusion proteins are incubated with the isolated polyglucosan at various doses and for various timepoints, and the ability of the Fab-alpha-amylase to digest the polyglucosan is monitored.
  • N2A cells may be used in which a Lafora Disease phenotype is mimicked by treating these cells with the ER stressor thapsigargin in a manner similar to that described in Wang et al.
  • the primary neuron cells or ER-stressed N2A cells (or control unstressed N2A cells) are then administered (or not) the Fab-alpha-amylase proteins, and the effect of the proteins on polyglucosan levels is monitored by PAS staining.
  • a reduction in PAS staining in the protein treated cells is consistent with the polyglucosan being cleared from the cells by the chimeric polypeptides.
  • the effect of Fab-alpha-amylase on glycogen levels is tested on primary cells from a GSDIII and/or GSDIV human patient or animal model, or in an animal model.
  • the effect of the Fab-alpha-amylase on glycogen levels is tested in a hypoxia cell model.
  • the hypoxia tumor cell model is the same or similar to the one described in Pelletier et al., Frontiers in Oncology, 2(18): 1-9, where it was shown that hyopoxia induces glycogen accumulation in certain cell types.
  • non-cancerous cells e.g. , Chinese hamser lung fibroblasts (CCL39) or mouse embryonic fibroblasts (MEF)
  • cancerous cells e.g.
  • LSI 74 or BE colon carcinoma cells are cultured at normoxic or hypoxic (1% 0 2 ) conditions for 96 hours in the presence or absence of the Fab-alpha-amylase. Glycogen levels are assessed by electron microscopy and/or Periodic Acid Schiff staining. A reduction in glycogen levels in the Fab-alpha- amylase treated hypoxic cells as compared to the untreated hypoxic cells is assessed.
  • FIG. 1 A comparison of -Fab-amylase and +Fab-amylase at 0.01 mg/ml and 0.1 mg/ml is provided.
  • the reduction of glycogen in ENT2+ C2C 12 myotubes by Fab-amylase is demonstrated by comparing glycogen (mg)/protein (mg) levels for non- transfected C2C12 myotubes to treated C2C12 myotubes (FIG. 2).
  • Treated C2C12 myotubes are prepared by transfecting C2C12 myotubes with PTG and then treating the transfected myotubes with 0.01 mg/ml Fab-Amylase in the media after 24 hours.
  • Lafora Disease may be characterized by the accumulation of glycogen-filled inclusion bodies (also referred to herein as Lafora bodies or polyglucosan bodies) within the cytoplasm of the cells in the brain, heart, liver, muscle and skin.
  • glycogen-filled inclusion bodies also referred to herein as Lafora bodies or polyglucosan bodies
  • Inclusion bodies can be purified in a manner similar to that described in Yokoi et al., Arch Neurol, 19(1): 15-33. Inclusion bodies may also be purified by utilizing an improved purification scheme that involves four steps: (1) homogenizing the tissue, resuspending the mixture and centrifuging; (2) digesting overnight with Proteinase K; (3) filtering; and (4) washing with SDS and buffer. Samples from the homogenate, pellet and final sample may be assessed for yield (e.g., percentage of Lafora bodies successfully purified/isolated from the tissue lysate). The improved purification scheme was utilized on tissue samples obtained from the brain (FIG. 3 A and FIG. 3C), heart (FIG. 3B), and skeletal muscle (FIG.
  • FIG. 3D 3D of a Lafora knock out mouse.
  • the samples demonstrated that there are some apparent visual similarities and differences between isolated Lafora bodies from a Lafora knock out mouse (e.g., laforin _/" ). Even within the brain there is evidence of heterogeneity with larger aggregated Lafora bodies (FIG. 3C).
  • the yield (mg per g tissue) from the homogenate, pellet and final sample obtained from the brain, heart, and skeletal muscle was measured (FIG. 3E) showing a 50-70% yield of purified inclusion bodies in the skeletal muscle.
  • the yield (mg per g tissue) of iodine and total glucose is measured from the brain, heart, and skeletal muscle samples (FIG. 3F).
  • the efficacy of Fab-fusions can be assessed using the purified inclusion bodies.
  • a degradation assay is performed applying Fab-amylase and Fab-glucosidase to purified inclusion bodies isolated from tissue of the brain, heart, and skeletal muscle of Lafora knock out mice. The results show that Fab-amylase, and not Fab-glucosidase, degrades the purified inclusion bodies (FIG. 4A).
  • the effect of Fab-amylase on inclusion bodies is further assessed by measuring the inclusion body content ⁇ g per mL extract) of samples obtained from wild type mice and knock out mice treated with -Fab-amylase and +Fab- amylase ex vivo (FIG. 4B).
  • the activity of Fab-amylase can be measured using an amylase activity colorimetric assay kit (BioVision). The methods for using the assay kit are optimized by identifying a choice of time points to measure the sample at OD 405 nm and selecting the optimum time point.
  • Fab-amylase activity (nmol P per mg tissue) is measured in the muscle at various time points post injection, including at 1 hour post-injection, 2 hours post-injection, 4 hours post-injection, and 24 hours post-injection (FIG. 5 A).
  • Amylase activity nmol P/min/g tissue is also measured for various sections of the brain (as identified in upper panel of FIG. 5B) immediately post-injection and 1 hour post-injection (FIG. 5B, lower panel).
  • mice engineered to be deficient in malin display a phenotype similar to that observed in human cases of Lafora Disease. Specifically, malin " " mice presented in an age- dependent manner neurodegeneration, increased synaptic excitability, and propensity to suffer myoclonic seizures. Valles-Ortega et al., 2011, EMBO Mol Med, 3(11):667-681. In addition, these mice accumulated glycogen-filled inclusion bodies that were most abundant in the hippocampus and cerebellum, but that were also found in skeletal and cardiac muscle cells. Valles-Ortega et al. Glycogen was also found to be less branched in the cells of malin " " mice as compared to glycogen observed in the cells of healthy control mice.
  • mouse models that could be used in the in vivo experiments described herein include the laforin " " mouse model described in Ganesh et al., 2002, Hum Mol Genet, l l(l l): 1251-62.
  • the evaluation dose of the Fab-alpha-amylase delivered to the Lafora Disease mice is determined empirically. To minimize the confounding effect of a neutralizing immune response to Fab-alpha-amylase and to maximize the ability to demonstrate a therapeutic effect, two high doses of 5 mg/kg of Fab-alpha-amylase are delivered in one week, followed by assessment of changes in disease endpoints. The development of anti-Fab- alpha-amylase antibodies is also monitored.
  • Fab-alpha-amylase is formulated and diluted in a buffer that is consistent with intravenous injection (e.g. sterile saline solution or a buffered solution of 50 mM Tris-HCl, pH 7.4, 0.15 M NaCl).
  • a buffer that is consistent with intravenous injection
  • Plasma samples are collected by cardiac puncture at the time that animals are sacrificed for tissue dissection. Serum is removed and frozen at -80°C. To minimize the effects of thawing and handling all analysis of Fab-alpha-amylase circulating in the blood is performed on the same day.
  • Sampled tissues are divided for immunoblot, glycogen analysis, formalin-fixed paraffin-embedded tissue blocks and frozen sections in OCT.
  • Heart, liver, lung, spleen, kidneys, quadriceps, EDL, soleus, diaphragm, brain, and biceps tissue (50-100 mg) are subdivided and frozen in plastic tubes for further processing for immunoblot and glycogen analysis.
  • Additional samples of heart, liver, lung, spleen, kidneys, quadriceps, EDL, soleus, diaphragm, brain and biceps are subdivided, frozen in OCT tissue sectioning medium, or fixed in 3% glutaraldehyde formaldehyde fixation for 24 to 48 hours at 4°C and embedded in Epon resin, or fixed in 10% BF and processed into paraffin blocks.
  • Some samples are homogenized in 30%KOH for 15 min, and glycogen levels are determined using an amyloglucosidase-based assay described in Valles-Ortega et al. In addition, glycogen branching are assessed in the homogenized samples using the methods described in Valles- Ortega et al.
  • Epon-resin embedded samples are cut at 1 ⁇ and stained with PAS-Richardson's stain for glycogen staining.
  • Reduced levels of glycogen accumulation in tissues (e.g., muscle or liver) of Lafora Disease mice treated with Fab-alpha-amylase as compared to control -treated Lafora Disease mice is indicative that the Fab-alpha-amylase is capable of reducing glycogen levels in vivo.
  • Exogenously delivered Fab-alpha-amylase are detected using a polyclonal or monoclonal anti-alpha-amylase antibody. Ten micrometer frozen sections are cut and placed on Superfrost Plus microscope slides.
  • Immunoblotting is used to detect 3E10 and alpha-amylase immune reactive material in Fab-alpha-amylase treated muscles (e.g., diaphragm), heart and brain tissues. Protein isolation and immunoblot detection of 3E10 and alpha-amylase are performed according to routine immunoblot methods. Alpha-amylase is detected with an antibody specific for this protein. Antibody detection of blotted proteins use BT/BCIP as a substrate. Controls include vehicle and treated Lafora Disease mice and vehicle and treated homozygous wildtype mice.
  • Fab-alpha-amylase An ELISA specific to human Fab-alpha-amylase is developed and validated using available anti-human amylase antibodies (or anti-CHI antibodies to detect the constant heavy chain of the Fab portion of the Fab-alpha-amylase) and horseradish peroxidase conjugated anti-mouse secondary antibody (Jackson Immunoresearch). Recombinant Fab- alpha-amylase is diluted and used to generate a standard curve. Levels of Fab-alpha- amylase are determined from dilutions of serum (normalized to ng/ml of serum) or tissue extracts (normalized to ng/mg of tissue). Controls include vehicle and treated wildtype and Lafora Disease mice.
  • Purified Fab-alpha-amylase used to inject Lafora Disease mice are plated onto high- binding 96 well ELISA plates at 1 ug/ml in coating buffer (Pierce Biotech), allowed to coat overnight, blocked for 30 minutes in 1% nonfat drymilk (Biorad) in TBS, and rinsed three times in TBS.
  • Tissue glycogen content is assayed using the protocol described in Akman (201 1).
  • Samples of frozen muscle e.g., diaphragm or cardiac muscle
  • brain and liver tissue -30- 60 mg
  • samples of frozen muscle e.g., diaphragm or cardiac muscle
  • brain and liver tissue -30- 60 mg
  • 67 ⁇ of 0.25 m Na2S04 and 535 ⁇ of ethanol is added.
  • samples are centrifuged at 14500g for 20 min at 4°C to collect glycogen.
  • the glycogen pellet is suspended in water (100 ⁇ ), 200 ⁇ of ethanol are added and centrifugation as described above is used to harvest glycogen. This ethanol precipitation step is repeated, and the glycogen pellet is dried in a Speed- Vac.
  • Dried glycogen pellets are suspended in 100 ⁇ of amyloglucosidase [0.3 mg/ml in 0.2 m sodium acetate (pH 4.8)] and incubated at 37°C for 3 h to digest glycogen.
  • an aliquot (5 ⁇ ) of digested glycogen is added to 95 ⁇ of a solution containing 0.3 m triethanolamine (pH 7.6), 0.4 mm MgC12, 0.9 mm NADP, 1 mm ATP and 0.1 ⁇ g of glucose-6-phosphate dehydrogenase/ml.
  • the absorbance at 340 nm is read before and after the addition of 0.1 ⁇ g of hexokinase.
  • the malin _/" mice described by Valles-Ortega et al. were generated in the C57BL6 strain of mice, which are normally resistant to seizures. However, while administration of kainate did not induce any seizures in wildtype C57BL6 mice, malin _/" mice treated with kainate displayed clonic hippocampal seizures. Valles-Ortega et al. Malin _/" mice are treated with kainate and with or without Fab-alpha-amylase.
  • mice treated with kainate and Fab-alpha-amylase display reduced seizures as compared to malin _/" mice treated with kainate but not with any chimeric polypeptides, this is indicative that the chimeric polypeptides are effective in treating some of the neurological defects observed in the malin _/" mice.
  • the total number of parvalbumin positive interneurons is assessed in the
  • hippocampus of malin _/" mice treated with or without Fab-alpha-amylase Valles-Ortega et al. If the hippocampi from mice treated with Fab-alpha-amylase display less parvalbumin- positive neurodegeneration than in the hippocampi from untreated mice, than this is indicative that the chimeric polypeptides are effective in reducing neurodegeneration in the malin _/" mice.
  • Pairwise comparisons employs Student's t-test. Comparisons among multiple groups employ ANOVA. In both cases a p-value ⁇ 0.05 is considered statistically significant.
  • the effect of intramuscular injections of Fab-amylase is assessed by comparing Fab-amylase treated mice with control mice.
  • Fab-amylase treated mice four 20 ul (10 mg/ml) intramuscular injections are administered into the Tibialis anterior (TA) muscle of the right leg over the course of two weeks, while PBS is injected into the left leg.
  • PBS is injected into both the right and left legs of the mice.
  • the mice were sacrificed and the Tibialis anterior muscles were embedded with OCT mounting media, flash frozen in liquid nitrogen cooled isobutane, and then later sectioned for Periodic acid-Schiff (PAS) staining.
  • PBS Periodic acid-Schiff
  • mice that were treated with Fab-amylase showed a reduction in very strong instances of dark pink glycogen detection with PAS staining, as well as an improvement in muscle architecture (e.g., clear distinction between fast and slow muscle fibers).
  • a treated 8.5 month old female mouse demonstrates very dark pink staining in the left leg (PBS treated) (left panel) signifying over accumulated glycogen.
  • the Fab-amylase treated muscle does not show the same staining (right panel).
  • a second treated 8.5 month old female mouse exhibits similar results as seen in FIG. 7.
  • the Fab-amylase treated muscle (right panel) also shows normal fiber differences between fast fibers (small, light purple) and slow fibers (larger, more clear), as compared to the PBS treated muscle (left panel).
  • An 8.5 month old female mouse (specimen #10) acts as a control (FIG. 8) with PBS treated muscles for both the left and right legs (left panel and right panel, respectively).
  • SEQ ID NO: 2 Humanized Variable Heavy Chain Amino Acid Sequence (VH3) EVQLQESGGGVVQPGGSLRLSC AASGFTF SNYGMHWIRQAPGKGLEWVS YIS SGS S TIYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCARRGLLLDYWGQGTL VTVSS
  • SEQ ID NO: 7 Humanized Heavy Chain Amino Acid Sequence (including human IgGl CHI and truncated hinge constant regions)
  • SEQ ID NO: 8 Humanized Light Chain Amino Acid Sequence (including human kappa light chain region)
  • SEQ ID NO: 9 Heavy Chain + Alpha- Amylase Fusion Protein Amino Acid Sequence (Including Leader and Linker Sequences)
  • SEQ ID NO: 11 Heavy Chain IgGl CHI and Truncated Hinge Constant Domain AS TKGP S VFPL AP S SK S T S GGT A ALGCL VKD YFPEP VT V S WNS GALT S GVHTFP A V LQ S SGL YSL S S V VTVP S S SLGTQT YICNVNHKP SNTKVDKKVEPKSCDKTHT
  • SEQ ID NO: 13 GS3 linker
  • HHHHHHH SEQ ID NO: 16 c-Myc tag
  • EQKLISEEDL SEQ ID NO: 17 exemplary 3E10 Variable Heavy Chain (V H having D3 IN substitution; see examples)
  • VQL VE S GGGL VKPGGSRKL S C A AS GF TF SN YGMHW VRQ APEKGLEW V A YIS S GS STIYYADTVKGRFTISRDNAKNTLFLQMTSLRSEDTAMYYCARRGLLLDYWGQGT TLTVSS
  • SEQ ID NO: 18 3E10 Variable Light Chain (V L )
  • QHSREFPWT SEQ ID NO: 33 - amino acid sequence of humanized 3E10 heavy chain (hVHl)
  • SEQ ID NO: 36 Human Pancreatic Alpha Amylase Amino Acid Sequence (GenBank Accession No.: NP_000690.1)
  • SEQ ID NO: 43 Heavy Chain + Alpha- Amylase Fusion Protein Amino Acid Sequence (excluding Linker Sequence)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Psychiatry (AREA)
  • Hospice & Palliative Care (AREA)
  • Obesity (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
PCT/US2017/050787 2016-09-09 2017-09-08 Methods and compositions for treatment of lafora disease Ceased WO2018049237A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
AU2017322483A AU2017322483A1 (en) 2016-09-09 2017-09-08 Methods and compositions for treatment of lafora disease
EP17849664.2A EP3509614A4 (en) 2016-09-09 2017-09-08 METHODS AND COMPOSITIONS FOR THE TREATMENT OF LAFORA DISEASE
CN201780069052.6A CN109963576A (zh) 2016-09-09 2017-09-08 用于治疗拉福拉病的方法和组合物
JP2019513898A JP2019535645A (ja) 2016-09-09 2017-09-08 ラフォラ病の処置のための方法及び組成物
CA3036524A CA3036524A1 (en) 2016-09-09 2017-09-08 Methods and compositions for treatment of lafora disease
US16/332,331 US10781433B2 (en) 2016-09-09 2017-09-08 Methods and compositions for treatment of Lafora disease

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201662385656P 2016-09-09 2016-09-09
US62/385,656 2016-09-09
US201762553048P 2017-08-31 2017-08-31
US62/553,048 2017-08-31

Publications (1)

Publication Number Publication Date
WO2018049237A1 true WO2018049237A1 (en) 2018-03-15

Family

ID=61562328

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/050787 Ceased WO2018049237A1 (en) 2016-09-09 2017-09-08 Methods and compositions for treatment of lafora disease

Country Status (7)

Country Link
US (1) US10781433B2 (enExample)
EP (1) EP3509614A4 (enExample)
JP (1) JP2019535645A (enExample)
CN (1) CN109963576A (enExample)
AU (1) AU2017322483A1 (enExample)
CA (1) CA3036524A1 (enExample)
WO (1) WO2018049237A1 (enExample)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021035181A1 (en) * 2019-08-22 2021-02-25 The Regents Of The University Of California Ube3a for the treatment of angelman syndrome
US10961301B2 (en) 2011-04-01 2021-03-30 Yale University Cell-penetrating anti-DNA antibodies and uses thereof inhibit DNA repair
US11590242B2 (en) 2016-06-15 2023-02-28 Yale University Antibody-mediated autocatalytic, targeted delivery of nanocarriers to tumors
US12486318B2 (en) 2016-06-15 2025-12-02 Yale University Anti-guanosine antibody as a molecular delivery vehicle

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025018822A1 (ko) 2023-07-20 2025-01-23 제닉스큐어 주식회사 라포라병을 예방 또는 치료하기 위한 재조합 아데노 연관 바이러스 및 이를 포함하는 약학적 조성물
KR102814185B1 (ko) 2023-07-20 2025-06-12 제닉스큐어 주식회사 라포라병을 예방 또는 치료하기 위한 재조합 아데노 연관 바이러스 및 이를 포함하는 약학적 조성물

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010148010A1 (en) * 2009-06-15 2010-12-23 4S3 Bioscience Inc. Methods and compositions for treatment of myotubular myopathy using chimeric polypeptides comprising myotubularih 1 (mtm1) polypeptides
US20130273026A1 (en) * 2012-04-12 2013-10-17 Integrative Enzymatics, Inc. Composition and method for modulating inflammatory molecules with amylase
WO2015106290A1 (en) * 2014-01-13 2015-07-16 Valerion Therapeutics, Llc Internalizing moieties

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2901969A1 (en) * 2013-02-20 2014-08-28 Valerion Therapeutics, Llc Methods and compositions for treatment of forbes-cori disease
WO2014130723A1 (en) * 2013-02-20 2014-08-28 Valerion Therapeutics, Llc Methods and compositions for treatment of pompe disease
WO2015192092A1 (en) * 2014-06-13 2015-12-17 Valerion Therapeutics, Llc Methods and compositions for treatment of glycogen storage diseases and glycogen metabolism disorders
EP3186278A4 (en) * 2014-08-27 2018-04-04 Valerion Therapeutics, LLC Internalizing moieties for treatment of cancer

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010148010A1 (en) * 2009-06-15 2010-12-23 4S3 Bioscience Inc. Methods and compositions for treatment of myotubular myopathy using chimeric polypeptides comprising myotubularih 1 (mtm1) polypeptides
US20130273026A1 (en) * 2012-04-12 2013-10-17 Integrative Enzymatics, Inc. Composition and method for modulating inflammatory molecules with amylase
WO2015106290A1 (en) * 2014-01-13 2015-07-16 Valerion Therapeutics, Llc Internalizing moieties

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3509614A4 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10961301B2 (en) 2011-04-01 2021-03-30 Yale University Cell-penetrating anti-DNA antibodies and uses thereof inhibit DNA repair
US11590242B2 (en) 2016-06-15 2023-02-28 Yale University Antibody-mediated autocatalytic, targeted delivery of nanocarriers to tumors
US12486318B2 (en) 2016-06-15 2025-12-02 Yale University Anti-guanosine antibody as a molecular delivery vehicle
WO2021035181A1 (en) * 2019-08-22 2021-02-25 The Regents Of The University Of California Ube3a for the treatment of angelman syndrome
US20220305098A1 (en) * 2019-08-22 2022-09-29 The Regents Of The University Of California Ube3a for the treatment of angelman syndrome

Also Published As

Publication number Publication date
CN109963576A (zh) 2019-07-02
US20190316104A1 (en) 2019-10-17
JP2019535645A (ja) 2019-12-12
US10781433B2 (en) 2020-09-22
EP3509614A1 (en) 2019-07-17
EP3509614A4 (en) 2020-04-22
CA3036524A1 (en) 2018-03-15
AU2017322483A1 (en) 2019-04-04

Similar Documents

Publication Publication Date Title
US10703824B2 (en) Internalizing moieties
US10781433B2 (en) Methods and compositions for treatment of Lafora disease
US10781434B2 (en) Methods and compositions for treatment of glycogen storage diseases and glycogen metabolism disorders
US20210040464A1 (en) Methods and compositions for treatment of polyglucosan disorders
US20180028676A1 (en) Methods and compositions for treatment of forbes-cori disease
CN110028584B (zh) 针对egfr蛋白和met蛋白的双特异性抗体
CN103379915A (zh) Hsa相关组合物及使用方法
KR20130020765A (ko) Hsa-관련 조성물 및 사용방법
AU2015206407A1 (en) Bi-specific CD3 and CD19 antigen-binding constructs
AU2014218854A1 (en) Methods and compositions for treatment of Pompe disease
US20210395716A1 (en) Methods and compositions for treatment of protein aggregation-based disorders

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17849664

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3036524

Country of ref document: CA

Ref document number: 2019513898

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017322483

Country of ref document: AU

Date of ref document: 20170908

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017849664

Country of ref document: EP

Effective date: 20190409