WO2018042385A2 - Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments - Google Patents
Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments Download PDFInfo
- Publication number
- WO2018042385A2 WO2018042385A2 PCT/IB2017/055281 IB2017055281W WO2018042385A2 WO 2018042385 A2 WO2018042385 A2 WO 2018042385A2 IB 2017055281 W IB2017055281 W IB 2017055281W WO 2018042385 A2 WO2018042385 A2 WO 2018042385A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- binding protein
- cell
- cells
- chain variable
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7155—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4214—Receptors for cytokines
- A61K40/4217—Receptors for interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- CRS cytokine release syndrome
- Embodiments are provided in the form of methods, compositions, medical devices, and kits involving an isolated and engineered chimeric interleukin 6 receptor alpha (IL-6Ra) binding protein.
- IL-6Ra interleukin 6 receptor alpha
- compositions, medical devices, and kits include therapeutic compositions or a kit that has at least one therapeutic composition that comprises one or more of the following: an isolated chimeric interleukin 6 receptor alpha (IL-6Ra) binding protein, a nucleic acid encoding a chimeric IL-6Ra binding protein, one or more cells expressing a chimeric IL-6Ra binding protein, or one or more cells that have a nucleic acid encoding a chimeric IL-6Ra binding protein.
- IL-6Ra isolated chimeric interleukin 6 receptor alpha
- a chimeric interleukin 6 receptor alpha (IL-6Ra) binding protein comprising a heavy chain variable region comprising CDR1 (SEQ ID NO:5), CDR2 (SEQ ID NO:6), and CDR3 (SEQ ID NO:7) attached by a heterologous linker to a light chain variable region comprising CDR4 (SEQ ID NO:8), CDR5 (SEQ ID NO:9), and CDR6 (SEQ ID NO: 10).
- a chimeric IL-6Ra binding protein has at least or at most 1, 2, 3, 4, 5, or 6 amino acid substitutions, deletions, or additions in one or more of CDR1, CDR2, CDR3, CDR4, CDR5, and/or CDR6.
- a chimeric IL-6Ra binding protein has 60, 65, 70, 75, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% (or any range derivable therein) sequence identity with the amino acid sequence of CDR1, CDR2, CDR3, CDR4, CDR5, and/or CDR6 or with the heavy chain variable domain (SEQ ID NO:3) or with light chain variable domain (SEQ ID NO:4) or with the V L -V H single chain variable fragment (scFv) (SEQ ID NO: l) or with the V H -V L SCFV (SEQ ID NO:2).
- the chimeric IL-6Ra binding protein is isolated and/or purified.
- the IL6Ra binding protein comprises SEQ ID NO: l or SEQ ID NO:2.
- Further embodiments concern an scFv that is essentially or comprises SEQ ID NO: l or SEQ ID NO:2.
- the chimeric IL-6Ra binding protein is an scFv, (scFv) 2 , scFvFc, Fab, Fab', or F(ab) 2 .
- the scFv portion comprises all or part of SEQ ID NOs: l-10.
- the protein is 1, 2, 3, 4 or more polypeptides.
- the IL-6Ra binding protein is one polypeptide.
- the chimeric chimeric IL-6Ra binding protein is a fusion protein.
- the fusion protein is one polypeptide.
- Certain embodiments concern a chimeric IL-6Ra binding protein that is a single chain variable fragment (scFv).
- scFv single chain variable fragment
- the heavy chain variable region is on the N-terminal side of the light chain variable region, which means the heavy chain variable region is closer to the N-terminus of the polypeptide.
- SEQ ID NO:2 is an example of this configuration.
- the light chain variable region is on the N-terminal side of the heavy chain variable region, which means the light chain variable region is closer to the N-terminus of the polypeptide than the heavy chain variable region.
- SEQ ID NO: l is an example of this structure.
- a chimeric IL-6Ra binding protein comprises a linker.
- the linker is between the heavy chain variable region and the light chain variable region (or vice versa).
- the linker comprises the amino acid sequence GSTSGSGKPGSGEGSTKG (SEQ ID NO: 11) in some embodiments or has 10, 11, 12, 13, 14, 15, 16, 17, or 18 contiguous amino acids from the sequence of SEQ ID NO: l l.
- the linker is 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identical in amino acid sequence to SEQ ID NO: 11.
- Some chimeric IL-6Ra binding proteins also have a leader or signal peptide at or toward the N-terminus of a polypeptide.
- the leader or signal peptide refers to a short (5-30 amino acids long) peptide present at the N-terminus of a polypeptide to promote or allow for secretion of that polypeptide.
- a chimeric IL-6Ra binding protein may include an isolation tag, which refers to a peptide tag that is used to isolate or purify the protein or polypeptide.
- the tag may or may not be removable, such as by cleavage.
- the tag may be a chitin binding protein (CBP), a maltose binding protein (MBP), glutathione-S -transferase (GST), a His tag (such as Hisx6).
- CBP chitin binding protein
- MBP maltose binding protein
- GST glutathione-S -transferase
- His tag such as Hisx6
- the isolation tag is a chromatography tag that is used to alter chromatographic properties of the protein to afford different resolution across a particular separation technique.
- FLAG tag such as DYKDDDDK, which is a series of polyanionic amino acids.
- Another isolation tag may be an epitope tag, which refers to a short peptide sequence can be used in conjunction with an antibody.
- Epitope tags include, but are not limited to, a V5 tag, a c-myc tag, an HA tag, or an NE tag.
- Some embodiments involve an isolated chimeric interleukin 6 receptor alpha (IL-6Ra) binding protein comprising a leader peptide, heavy chain variable region comprising CDR1 (SEQ ID NO:5), CDR2 (SEQ ID NO:6), and CDR3 (SEQ ID NO:7) attached by a heterologous linker to a light chain variable region comprising CDR4 (SEQ ID NO:8), CDR5 (SEQ ID NO:9), and CDR6 (SEQ ID NO: 10), wherein the heterologous linker comprises the amino acid sequence GSTSGSGKPGSGEGSTKG (SEQ ID NO: 11) and the IL-6Ra binding protein is a single-chain variable fragment (scFv).
- IL-6Ra interleukin 6 receptor alpha
- Embodiments do not involve tocilizumab (also known as atlizumab), which is sold under the trade names of Actemra and RoActemra and is a humanized monoclonal antibody unless specifically included.
- the IL-6Ra binding protein reduces the expression of one or more cytokines from a T cell.
- the T cell expresses a chimeric antigen receptor or another protein that activates T cells.
- the IL-6Ra binding protein reduces the expression of any of the following cytokines: TNF-a, IL-6, IL-2, IL-4, and GM-CSF (or any combination thereof).
- an IL-6Ra binding protein reduces the expression of one or more of those cytokines by, by at least, or by at most 10%, 20%, 30%, 40%, or 50% (or any range derivable therein) as compared to a cell not exposed to the IL-6Ra binding protein.
- a IL-6Ra scFv reduces the expression of any of the following cytokines: TNF-a, IL-6, IL-2, IL-4, and GM-CSF (or any combination thereof).
- an IL-6Ra scFv reduces the expression of one or more of those cytokines by, by at least, or by at most 10%, 20%, 30%, 40%, or 50% (or any range derivable therein) as compared to a cell exposed to tocilizumab. In other embodiments, an IL-6Ra scFv reduces the expression of one or more cytokines greater than tocilizumab. Methods similarly may involve an IL-6Ra scFv that reduces the expression of one or more cytokines greater than tocilizumab.
- methods involve an IL-6Ra scFv that reduces the expression of TNF-a, IL-6, IL-2, IL-4, and/or GM-CSF greater than tocilizumab.
- the IL-6 receptor alpha single chain variable fragment that reduces expression of one or more cytokines comprises a heavy chain variable region comprising CDR1 (SEQ ID NO:5), CDR2 (SEQ ID NO:6), and CDR3 (SEQ ID NO:7) attached by a heterologous linker to a light chain variable region comprising CDR4 (SEQ ID NO:8), CDR5 (SEQ ID NO:9), and CDR6 (SEQ ID NO: 10).
- a "chimeric interleukin 6 receptor alpha (IL-6Ra) binding protein” refers to a protein that specifically binds to IL-6 receptor alpha and that contains at least two amino acid regions (each region is at least 10 contiguous amino acids), each region being from a different gene, and wherein the chimeric protein is not found in nature.
- the chimeric IL-6Ra protein is a single polypeptide.
- a chimeric IL-6Ra binding protein does not refer to an IL-6Ra antibody that is found in nature.
- Isolated refers to the separation or purification of the protein from either other proteins or one or more other components of a cell.
- Other aspects concern a cell or cells that express a chimeric IL-6Ra binding protein.
- the cells may express the chimeric IL-6Ra binding protein on its surface or they may express and secrete the chimeric IL-6Ra binding protein.
- T cells express the chimeric IL-6Ra binding protein.
- the T cells may be among other blood cells or they may be in a pool of enriched T cells.
- the T cells may be conventional T cells of naive, central memory, effector memory, or effector phenotypes; or they may be regulatory T cells of natural or induced phenotypes.
- the T cells express one or more of the following markers: CD4, CD8, CD25, CD27, CD28, CD45RA, CD45RO, CD57, CD62L, CD69, CD95, CD 127, CCR7, IL-7Ra, or Foxp3.
- the T cell is a CD4+ T cell.
- the T cell is a CD8+ T cell.
- nucleic acid molecule encoding the chimeric IL-6Ra binding protein. Certain embodiments involve a nucleic acid molecule that also comprises a promoter controlling expression of the chimeric IL-6R binding protein. In some embodiments, the promoter is constitutive. In other embodiments, the promoter responds positively to at least one cytokine or is responsive to one or more transcription factors that are upregulated in expression or activity when cytokines are upregulated. Promoters may respond positively to one or more of the following cytokines: IL-6, TNF-a, IFN- ⁇ , IL- ⁇ , IL-2, IL-8, or IL-10.
- a promoter responsive to a transcription factor that is increased when T cells are activated NFAT-1 is such a transcription factor, as is NF-KB.
- NFAT-1 is such a transcription factor, as is NF-KB.
- there is an expression construct comprising the nucleic acid molecule encoding an IL-6Ra binding protein.
- Certain embodiments concern one or more cells that contain a nucleic acid construct encoding an IL-6Ra binding protein.
- the cell is a T cell.
- the cells have been transfected or infected with the expression construct, which may or may not integrate into the genome of one or more host cells.
- a T cell comprising a heterologous expression construct encoding an IL-6R0C scFv comprising a leader peptide, a heavy chain variable region comprising CDR1 (SEQ ID NO:5), CDR2 (SEQ ID NO:6), and CDR3 (SEQ ID NO:7) attached by a heterologous linker to a light chain variable region comprising CDR4 (SEQ ID NO:8), CDR5 (SEQ ID NO:9), and CDR6 (SEQ ID NO: 10), wherein the heterologous linker comprises the amino acid sequence GSTSGSGKPGSGEGSTKG (SEQ ID NO: 11).
- the IL-6Ra binding protein is a single chain antibody fragment (scFv).
- the expression construct comprises a cytokine-responsive promoter, meaning the promoter has increased expression when cytokines are increased.
- cytokines are increased when T cells are activated.
- cytokines are increased when T- cell activation triggers a systemic immune response.
- cytokines are increased when tumor-cell lysis triggers a systemic immune response.
- IL-6Ra binding proteins in certain embodiments, there are methods for reducing the risk of cytokine release syndrome (CRS), methods for inhibiting IL-6Ra, methods for treating cancer, methods for treating an autoimmune disease, methods for reducing the toxicity of one or more cytokines, methods for reducing toxicity of T-cell activation, and methods for manufacturing an IL-6Ra therapeutic composition.
- CRS cytokine release syndrome
- Embodiments also concern use of a chimeric IL-6Ra binding protein for the treatment of the cytokine release syndrome, for the treatment of cancer, and/or for the treatment of an autoimmune disease.
- methods comprise administering to a patient at risk for cytokine release syndrome a composition comprising an isolated IL-6 receptor alpha (IL-6Ra) binding protein or cells comprising a heterologous nucleic acid molecule encoding the IL-6Ra binding protein.
- IL-6Ra isolated IL-6 receptor alpha
- the patient has cancer and/or an autoimmune disease.
- the patient has or will receive adoptive T-cell therapy.
- the patient is administered the composition after adoptive T-cell transfer.
- the patient is administered the composition along with adoptive T-cell transfer.
- the patient has or will receive lymphodepletion.
- the patient may receive or may have received adoptive T cell therapy within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
- the patient has an autoimmune disease.
- the patient is administered T cells comprising a heterologous nucleic acid molecule encoding an IL-6Ra binding protein.
- the patient is administered T cells that are autologous.
- methods include also administering to the patient an antihistamine, a corticosteroid, a steroid, acetaminophen, furosemide, and/or intravenous fluids or any other treatment used for cytokine release syndrome or other toxicity or side effects associated with T-cell engaging therapies.
- the patient has one or more symptoms of cytokine release syndrome.
- there are methods for reducing the toxicity of adoptive cell therapy in a cancer patient comprising administering to the patient a composition comprising an isolated IL-6 receptor alpha (IL-6Ra) binding protein or cells comprising a heterologous nucleic acid molecule encoding the IL-6Ra binding protein.
- Additional embodiments include methods for treating an autoimmune disease in a patient comprising administering to the patient a composition comprising a composition comprising an isolated IL-6 receptor alpha (IL-6Ra) binding protein or cells comprising a heterologous nucleic acid molecule encoding the IL-6Ra binding protein.
- IL-6Ra isolated IL-6 receptor alpha
- Other embodiments concern methods for treating a cancer patient comprising administering to the patient a composition comprising an isolated IL-6 receptor alpha (IL-6Ra) binding protein or cells comprising a heterologous nucleic acid molecule encoding the IL-6Ra binding protein, wherein the patient has been or will be treated with immunotherapy.
- the patient has been or will be treated with an anti-T cell antibody.
- anti-T cell antibodies include anti-thymocyte globulin, Muromonab-CD3, TGN1412, anti-CD20, anti-CD19, rituximab, and tisagenlecleucel.
- the immunotherapy is adoptive cell therapy.
- the methods of the disclosure comprise administering to the patient a composition comprising cells comprising a heterologous nucleic acid molecule encoding the IL-6Ra binding protein and a tumor-targeting receptor.
- Other embodiments concern methods for reducing the toxicity of one or more cytokines comprising administering to a patient with an autoimmune disease or condition or a patient being treated with immunotherapy an effective amount of a composition comprising a single chain variable fragment comprising the isolated IL-6Ra binding protein comprises a heavy chain variable region comprising CDR1 (SEQ ID NO:5), CDR2 (SEQ ID NO:6), and CDR3 (SEQ ID NO:7) attached by a heterologous linker to a light chain variable region comprising CDR4 (SEQ ID NO:8), CDR5 (SEQ ID NO:9), and CDR6 (SEQ ID NO: 10).
- the polypeptides described herein may include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more variant amino acids within at least, or at most 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33
- the subject is a human subject.
- murines e.g., rats, mice
- lagomorphs e.g., rabbits
- non-human primates humans
- canines felines
- ungulates e.g., equines, bovines, ovines, porcines, caprines
- FIG. 1 Anti-IL-6Rcc scFvs inhibit IL-6 signaling in HepG2 cells.
- HepG2 human hepatocarcinoma cells were seeded in a 12-well plate and incubated with indicated amounts of scFv for 3 hours. The indicated wells were subsequently treated with 4 ng/ml of IL-6 and incubated for another 30 minutes before cell harvest.
- pSTAT3 phosphorylated STAT3
- FIG. 2 Anti-IL-6Rcc scFv inhibits IL-6 signaling in primary human T cells.
- Primary human CD4+ and CD8+ T cells were seeded in a 12-well plate and treated as described for FIG. 1.
- the V L -V H SCFV (SEQ ID NO: l) was added in the indicated amounts, and IL-6 was added to the indicated wells.
- pSTAT3 and GAPDH (loading control) were detected by western blot.
- FIG. 3 Constitutive expression of anti-IL-6Rcc scFv significantly reduces the production of inflammatory cytokines by primary human T cells.
- Primary human CD4+ T cells expressing an anti-CD 19 chimeric antigen receptor (CAR) with ("anti-IL-6Roc scFv,” middle bars) or without ("No scFv or mAb"; left bars) constitutive expression of the anti-IL- 6Roc scFv were co-incubated with peripheral blood mononuclear cells (PBMCs) from the same donor plus wild-type (CD19+) Raji lymphoma cells at a 1: 1: 1 ratio for 12 hours.
- PBMCs peripheral blood mononuclear cells
- Non-scFv-expressing CD19 CAR-T cells treated with 90 g/ml of the monoclonal antibody tocilizumab were included as control samples ("Tocilizumab"; right bars).
- Cytokine levels in culture media were quantified by a cytometric bead-based assay. Values shown are the means of three technical replicates with error bars indicating ⁇ 1 standard deviation. Statistical significance was evaluated by two-tailed, equal-variance Student's Mest; * p ⁇ 0.05; ** p ⁇ 0.01; *** p ⁇ 0.001. The results shown are representative of two independent experiments using cells from two different healthy blood donors.
- FIG. 4 Constitutive expression of anti-IL-6Rcc scFv does not inhibit T-cell proliferation or cytotoxicity in CD4+ T cells.
- Primary human CD4+ T cells constitutively expressing the anti-CD 19 CAR with or without the anti-IL-6Roc scFv were co-incubated with wild-type (WT; CD19+) or CD19- mutant Raji lymphoma cells at a 2: 1 effector-to-target (E:T) ratio.
- WT wild-type
- E:T effector-to-target
- Viable T-cell and Raji-cell counts were obtained by flow cytometry every two days. Both Raji cell lines stably express EGFP to enable separation from T cells during flow- cytometry analysis.
- T cells co-incubated with WT Raji were harvested and re-challenged with fresh WT Raji cells at a 2: 1 E:T ratio. Viable cell counts were monitored for another 12 days during the second challenge. Values shown are the means of three technical replicates with error bars indicating ⁇ 1 standard deviation. The results shown are representative of four independent experiments using cells from two different healthy blood donors.
- FIG. 5 Constitutive expression of anti-IL-6Rcc scFv does not alter T-cell subtype differentiation upon antigen stimulation in CD4+ T cells.
- CD4+ primary human T cells were surface- stained with antibody for CCR7, CD45RA, and CD57 to determine the T-cell subtype.
- T E / EM CCR7-/CD45RA-/CD57- ;
- T E /Exh CCR7-/CD45RA-/CD57+;
- TEMRA CCR7-/CD45RA+;
- T cm CCR7+/CD45RA-;
- Tnaive CCR7+/CD45RA+.
- Values shown are the means of three technical replicates with error bars indicating ⁇ 1 standard deviation.
- the results shown are representative of four independent experiments using cells from two different healthy blood donors.
- FIG. 6 Constitutive expression of anti-IL-6Rcc scFv does not inhibit T-cell proliferation or cytotoxicity in CD8+ T cells.
- Primary human CD8+ T cells constitutively expressing the anti-CD 19 CAR with or without the anti-IL-6Roc scFv were co-incubated with wild-type (WT; CD19+) or CD19- mutant Raji lymphoma cells at a 2: 1 effector-to-target (E:T) ratio.
- E:T effector-to-target
- Viable T-cell and Raji-cell counts were obtained by flow cytometry every two days.
- Both Raji cell lines stably express EGFP to enable separation from T cells during flow- cytometry analysis. Values shown are the means of three technical replicates with error bars indicating + 1 standard deviation. The results shown are representative of three independent experiments using cells from two different healthy blood donors.
- FIG. 7 Constitutive expression of anti-IL-6Rcc scFv does not alter T-cell subtype differentiation upon antigen stimulation in CD8+ T cells.
- primary CD8+ human T cells were surface-stained with antibody for CCR7, CD45RA, and CD57 to determine the T-cell subtype.
- T E / EM CCR7-/CD45RA-/CD57- ;
- TE Exh CCR7-/CD45RA-/CD57+;
- TEMRA CCR7-/CD45RA+;
- T cm CCR7+/CD45RA-;
- Tnaive CCR7+/CD45RA+.
- Values shown are the means of three technical replicates with error bars indicating ⁇ 1 standard deviation.
- the results shown are representative of four independent experiments using cells from three different healthy blood donors.
- FIG. 8 Constitutive expression of anti-IL-6Rcc scFv does not alter exhaustion marker expression in primary human T cells upon antigen stimulation.
- Primary human T cells constitutively expressing the anti-CD 19 CAR with or without anti-IL-6Roc scFv were co-incubated with WT Raji cells at a 2: 1 E:T ratio.
- PD-1, TIM-3, and LAG-3 expression levels were quantified by surface antibody staining and flow cytometry every two days.
- Three trials were performed with CD8+ T cells and four trials were performed with CD4+ T cells for a total of seven independent experiments. Each trial included three technical replicates per condition.
- Each data point in the plots represents the mean value of triplicates from one trial. The average value of seven trials for each time point is indicated by the black horizontal bar.
- Embodiments disclosed herein include polypeptides that bind to IL-6R0C, which modulates the inflammatory effects of IL-6. Further embodiments include cells that express IL-6R -binding polypeptides, as well as methods of using the cells and polypeptides in cancer therapy, autoimmune therapy, and anti-inflammatory therapy, among others. These and other non-limiting aspects of the present invention are discussed in further detail in the following sections.
- Embodiments disclosed herein may include chimeric antigen receptors (CARs), which may be expressed by T cells or other immune cell types.
- CARs are engineered receptors, which graft an arbitrary specificity onto an immune effector cell. Typically, these receptors are used to graft the specificity of a monoclonal antibody onto a T cell.
- the receptors are called chimeric because they are composed of parts from different sources.
- the terms "protein,” “polypeptide,” and “peptide” are used interchangeably herein when referring to a gene product.
- “Homology,” “identity,” or “similarity” refers to sequence similarity between two peptides or between two nucleic acid molecules. Identity can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules share sequence identity at that position. A degree of identity between sequences is a function of the number of matching or homologous positions shared by the sequences. An "unrelated” or “non-homologous” sequence shares less than 40% identity, or less than 25% identity, with one of the sequences of the current disclosure.
- amino portion N-terminus
- amino terminus amino terminus
- carboxy portion C-terminus
- carboxy terminus carboxy terminus
- subject refers to a vertebrate, for example a primate, a mammal or preferably a human.
- Mammals include, but are not limited to equines, canines, bovines, ovines, murines, rats, simians, humans, farm animals, sport animals and pets.
- xeno-free (XF) or "animal component-free (ACF)" or “animal free,” when used in relation to a medium, an extracellular matrix, or a culture condition, refers to a medium, an extracellular matrix, or a culture condition which is essentially free from heterogeneous animal-derived components.
- any proteins of a non-human animal, such as mouse would be xeno components.
- the xeno-free matrix may be essentially free of any non-human animal-derived components, therefore excluding mouse feeder cells or MatrigelTM.
- MatrigelTM is a solubilized basement membrane preparation extracted from the Engelbreth-Holm-Swarm (EHS) mouse sarcoma, a tumor rich in extracellular matrix proteins to include laminin (a major component), collagen IV, heparin sulfate proteoglycans, and entactin/nidogen.
- EHS Engelbreth-Holm-Swarm
- the compositions described herein or cells of the disclosure are cultured in and/or prepared in/with xeno-free or animal component-free or animal free medium.
- Cells are "substantially free” of certain reagents or elements, such as serum, signaling inhibitors, animal components or feeder cells, exogenous genetic elements or vector elements, as used herein, when they have less than 10% of the element(s), and are "essentially free” of certain reagents or elements when they have less than 1% of the element(s).
- certain reagents or elements such as serum, signaling inhibitors, animal components or feeder cells, exogenous genetic elements or vector elements, as used herein, when they have less than 10% of the element(s), and are “essentially free” of certain reagents or elements when they have less than 1% of the element(s).
- cell populations wherein less than 0.5% or less than 0.1% of the total cell population comprise exogenous genetic elements or vector elements.
- a culture, matrix or medium are "essentially free" of certain reagents or elements, such as serum, signaling inhibitors, animal components or feeder cells, when the culture, matrix or medium respectively have a level of these reagents lower than a detectable level using conventional detection methods known to a person of ordinary skill in the art or these agents have not been extrinsically added to the culture, matrix or medium.
- the serum- free medium may be essentially free of serum.
- a "gene,” “polynucleotide,” “coding region,” “sequence,” “segment,” “fragment,” or “transgene” which "encodes” a particular protein is a nucleic acid molecule which is transcribed and optionally also translated into a gene product, e.g., a polypeptide, in vitro or in vivo when placed under the control of appropriate regulatory sequences.
- the coding region may be present in either a cDNA, genomic DNA, or RNA form. When present in a DNA form, the nucleic acid molecule may be single-stranded (i.e., the sense strand) or double-stranded.
- a gene can include, but is not limited to, cDNA from prokaryotic or eukaryotic mRNA, genomic DNA sequences from prokaryotic or eukaryotic DNA, and synthetic DNA sequences.
- a transcription termination sequence will usually be located 3' to the gene sequence.
- cell is herein used in its broadest sense in the art and refers to a living body which is a structural unit of tissue of a multicellular organism, is surrounded by a membrane structure which isolates it from the outside, has the capability of self-replicating, and has genetic information and a mechanism for expressing it.
- Cells used herein may be naturally-occurring cells or artificially modified cells (e.g., fusion cells, genetically modified cells, etc.).
- stem cell refers to a cell capable of self-replication and pluripotency or multipotency. Typically, stem cells can regenerate an injured tissue.
- Stem cells herein may be, but are not limited to, embryonic stem (ES) cells, induced pluripotent stem cells or tissue stem cells (also called tissue-specific stem cell, or somatic stem cell).
- Embryonic stem (ES) cells are pluripotent stem cells derived from early embryos. An ES cell was first established in 1981, which has also been applied to production of knockout mice since 1989. In 1998, a human ES cell was established, which is currently becoming available for regenerative medicine.
- tissue stem cells have a limited differentiation potential. Tissue stem cells are present at particular locations in tissues and have an undifferentiated intracellular structure. Therefore, the pluripotency of tissue stem cells is typically low. Tissue stem cells have a higher nucleus/cytoplasm ratio and have few intracellular organelles. Most tissue stem cells have low pluripotency, a long cell cycle, and proliferative ability beyond the life of the individual. Tissue stem cells are separated into categories, based on the sites from which the cells are derived, such as the dermal system, the digestive system, the bone marrow system, the nervous system, and the like. Tissue stem cells in the dermal system include epidermal stem cells, hair follicle stem cells, and the like.
- Tissue stem cells in the digestive system include pancreatic (common) stem cells, liver stem cells, and the like.
- Tissue stem cells in the bone marrow system include hematopoietic stem cells, mesenchymal stem cells, and the like.
- Tissue stem cells in the nervous system include neural stem cells, retinal stem cells, and the like.
- iPS cells commonly abbreviated as iPS cells or iPSCs, refer to a type of pluripotent stem cell artificially prepared from a non-pluripotent cell, typically an adult somatic cell, or terminally differentiated cell, such as fibroblast, a hematopoietic cell, a myocyte, a neuron, an epidermal cell, or the like, by introducing certain factors, referred to as reprogramming factors.
- Pluripotency refers to a stem cell that has the potential to differentiate into all cells constituting one or more tissues or organs, or particularly, any of the three germ layers: endoderm (interior stomach lining, gastrointestinal tract, the lungs), mesoderm (muscle, bone, blood, urogenital), or ectoderm (epidermal tissues and nervous system).
- endoderm internal stomach lining, gastrointestinal tract, the lungs
- mesoderm muscle, bone, blood, urogenital
- ectoderm epidermal tissues and nervous system.
- “Pluripotent stem cells” used herein refer to cells that can differentiate into cells derived from any of the three germ layers, for example, direct descendants of totipotent cells or induced pluripotent cells.
- treatment As used herein, the terms “treatment,” “treating,” and the like, refer to obtaining a desired pharmacologic and/or physiologic effect.
- the effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease.
- Treatment covers any treatment of a disease in a mammal, e.g., in a human, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; and (c) relieving the disease, i.e., causing regression of the disease.
- the methods are useful for reducing the size and/or cell number of a solid tumor.
- the method of the disclosure are useful for inhibiting the growth of tumors, such as solid tumors, in a subject.
- an antigen refers to any substance that causes an immune system to produce antibodies against it, or to which a T cell responds.
- an antigen is a peptide that is 5-50 amino acids in length or is at least, at most, or exactly 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 250, or 300 amino acids, or any derivable range therein.
- antibody includes monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies and antibody fragments that may be human, mouse, humanized, chimeric, or derived from another species.
- a "monoclonal antibody” is an antibody obtained from a population of substantially homogeneous antibodies that is being directed against a specific antigenic site.
- Antibody or functional fragment thereof means an immunoglobulin molecule that specifically binds to, or is immunologically reactive with a particular antigen or epitope, and includes both polyclonal and monoclonal antibodies.
- the term antibody includes genetically engineered or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies (e.g., bispecific antibodies, diabodies, triabodies, and tetrabodies).
- the term functional antibody fragment includes antigen binding fragments of antibodies, including e.g., Fab', F(ab')2, Fab, Fv, rlgG, and scFv fragments.
- the term scFv refers to a single chain Fv antibody in which the variable domains of the heavy chain and of the light chain of a traditional two chain antibody have been joined to form one chain.
- scFv single chain variable fragment
- scFvs are recombinant molecules in which the variable regions of light and heavy immunoglobulin chains encoding antigen-binding domains are engineered into a single polypeptide.
- V H and V L sequences are joined by a linker sequence. See, for example, Ahmad (2012) Clinical and Developmental Immunology Article ID 980250, herein specifically incorporated by reference.
- a “therapeutically effective amount” or “efficacious amount” refers to the amount of an agent, or combined amounts of two agents, that, when administered to a mammal or other subject for treating a disease, is sufficient to effect such treatment for the disease.
- the “therapeutically effective amount” will vary depending on the agent(s), the disease and its severity and the age, weight, etc., of the subject to be treated.
- Some embodiments disclosed herein include polypeptides that bind to IL-6Ra, including human IL-6Ra.
- the IL-6Ra-binding proteins can be administered in a pharmaceutical formulation or can be expressed from cells that are administered to a subject. In either case, the IL-6Ra-binding proteins affect immune processes involving IL-6.
- an IL-6Ra-binding protein is expressed by a cell, such as a T cell, the IL-6Ra may modulate the immune function of the cell itself and/or other cells in the vicinity.
- the IL-6Ra-binding protein reduces the secretion of pro-inflammatory cytokines by a cell that expresses the IL-6Ra binding protein or by other cells in the vicinity.
- Such pro-inflammatory cytokines may include TNF-a, IL-6, IL-2, IL-4, GM-CSF, and IL- ⁇ .
- the reduction in cytokine secretion by a cell expressing an IL-6Ra-binding protein can make the cell more effective and safe for use in therapies, such as adoptive T cell therapy.
- Cells that express an IL-6Ra-binding protein can self-modulate IL-6 signaling levels to prevent and/or ameliorate adverse inflammatory events such as cytokine release syndrome.
- IL-6Ra-binding proteins can also be used in treating autoimmune conditions.
- this may be accomplished by expressing an IL-6Ra-binding protein in a regulatory T cell, which will suppress undesirable inflammatory responses and ameliorate the severity of autoimmune attacks. This may also be accomplished by administering an IL-6Ra- binding protein itself to modulate signaling through IL-6Ra.
- the IL-6Ra-binding polypeptide is a single chain Fv (scFv), which comprise the V H and V L domains of an antibody, wherein these domains are present in a single polypeptide chain.
- the antigen-binding domain further comprises a peptide linker between the V H and V L domains, which can enable the scFv to form the desired structure for antigen binding.
- VL-VH SCFV Two different scFv constructs are used in the Examples section below: (1) the VL-VH SCFV and (2) the VH-VL SCFV. These two constructs differ only in the order of the sequences.
- the V L -V H SCFV configuration is N-terminus— VL— linker— VH— C-terminus
- the VH-VL SCFV configuration is N-terminus— V H — linker— V L — C-terminus, where V L refers to the light chain variable fragment and V H refers to the heavy chain variable fragment.
- the amino acid sequences for these scFv constructs are set forth in the table below:
- V H and V L sequences of the anti-IL-6Ra scFvs of SEQ ID NOs: 1 and 2, along with the sequences for the CDRs within these sequences and the linker sequence between the V H and V L sequences in the scFvs are set forth in the following table:
- the scFvs of SEQ ID NOs: l and 2 are constructed from tocilizumab (WO 1992019759 Al, US 5670373, US 7479543, US 8580264), and previously developed anti-IL-6Ra monoclonal antibody, by connecting the V H domain to the V L domain with the linker of SEQ ID NO: 11.
- the IL-6Ra-binidng protein can take a variety of forms that may incorporate one or more of the V H (SEQ ID NO:3), V L , or CDR (SEQ ID NOs:5-l l) sequences disclosed herein or derivatives or variations thereof.
- the binding protein can be an antibody-like molecule that has an antigen binding region, including antibody fragments such as Fab', Fab, F(ab')2, F(ab)2, (scFv)2, single domain antibodies (DABs), Fv, and polypeptides with antibody CDRs, scaffolding domains that display the CDRs (e.g., anticalins) or a nanobody.
- the nanobody can be antigen- specific VHH (e.g., a recombinant VHH) from a camelid IgG2 or IgG3, or a CDR-displaying frame from such camelid Ig.
- Minibodies are sFv polypeptide chains which include oligomerization domains at their C-termini, separated from the sFv by a hinge region.
- the oligomerization domain comprises self-associating a-helices, e.g., leucine zippers, that can be further stabilized by additional disulfide bonds.
- the oligomerization domain is designed to be compatible with vectorial folding across a membrane, a process thought to facilitate in vivo folding of the polypeptide into a functional binding protein.
- minibodies are produced using recombinant methods well known in the art. See, e.g., Pack et al. (1992); Cumber et al. (1992).
- Antibody-like binding peptidomimetics are also contemplated in embodiments. Liu et al. (2003) describe "antibody like binding peptidomimetics" (ABiPs), which are peptides that act as pared-down antibodies and have certain advantages of longer serum half-life as well as less cumbersome synthesis methods.
- ABSiPs antibody like binding peptidomimetics
- Alternative scaffolds for antigen binding peptides such as CDRs are also available and can be used to generate IL-6Ra-binding molecules in accordance with the embodiments.
- CDRs antigen binding peptides
- a person skilled in the art knows how to determine the type of protein scaffold on which to graft at least one of the CDRs arising from the original antibody. More particularly, it is known that to be selected such scaffolds must meet the greatest number of criteria as follows (Skerra, 2000): good phylogenetic conservation; known three-dimensional structure (as, for example, by crystallography, NMR spectroscopy or any other technique known to a person skilled in the art); small size; few or no post-transcriptional modifications; and/or easy to produce, express and purify.
- the origin of such protein scaffolds can be, but is not limited to, the structures selected among: fibronectin and preferentially fibronectin type III domain 10, lipocalin, anticalin (Skerra, 2001), protein Z arising from domain B of protein A of Staphylococcus aureus, thioredoxin A or proteins with a repeated motif such as the "ankyrin repeat” (Kohl et al., 2003), the "armadillo repeat", the "leucine-rich repeat” and the "tetratricopeptide repeat”.
- anticalins or lipocalin derivatives are a type of binding proteins that have affinities and specificities for various target molecules and can be used as target binding molecules.
- Monoclonal antibodies are recognized to have certain advantages, e.g., reproducibility and large-scale production. Embodiments include monoclonal antibodies of the human, murine, monkey, rat, hamster, rabbit and chicken origin.
- Humanized antibodies are also contemplated, as are chimeric antibodies from mouse, rat, or other species, bearing human constant and/or variable region domains, bispecific antibodies, recombinant and engineered antibodies and fragments thereof.
- the term "humanized” immunoglobulin refers to an immunoglobulin comprising a human framework region and one or more CDR's from a non-human (usually a mouse or rat) immunoglobulin.
- the non-human immunoglobulin providing the CDR's is called the "donor” and the human immunoglobulin providing the framework is called the "acceptor”.
- a "humanized antibody” is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin.
- the strength with which an antibody molecule binds an epitope can be measured.
- the affinity of an antibody may be determined by measuring an association constant (K a ) or dissociation constant (Kd).
- K a association constant
- Kd dissociation constant
- Antibodies deemed useful in certain embodiments may have an association constant of about, at least about, or at most about 10 6 , 10 7 , 10 s , 10 9 or 10 10 M or any range derivable therein.
- antibodies may have a dissoaciation constant of about, at least about or at most about 10 "6 , 10 "7 , 10 s , 10 "9 or 10 "10 M or any range derivable therein.
- a polypeptide that specifically binds to IL-6Ra is able to neutralize IL-6Ra and/or prevent binding of IL-6 to IL-6Ra or prevent signaling through IL-6Ra.
- any IL-6Ra-binding protein can be tagged with the leader (i.e. signal) peptide.
- leader i.e. signal
- a "signal peptide” refers to a peptide sequence that directs the transport and localization of the protein within a cell, e.g. to a certain cell organelle (such as the endoplasmic reticulum) and/or the cell surface.
- a signal peptide directs the nascent protein into the endoplasmic reticulum.
- the signal peptide natively attached to the amino-terminal most component is used (e.g. in a scFv with orientation light chain - linker - heavy chain, the native signal of the light-chain is used).
- the signal peptide from the murine kappa light chain is used so that the proteins are secreted from the expressing cells. This also allows the expressed protein to be directly collected from the media in which the producer cells are cultured. Other leader/signal peptides known to those in the art can also be used.
- the signal peptide is cleaved after passage of the endoplasmic reticulum (ER), i.e., is a cleavable signal peptide.
- ER endoplasmic reticulum
- a restriction site is at the carboxy end of the signal peptide to facilitate cleavage.
- the IL-6Ra-binding proteins can also be tagged with markers such as the DYKDDDDK (FLAG) epitope, HA tag, or cMyc tag or other epitope tags, markers, and affinity tags known in the art. This can facilitate isolation, purification, localization, and targeted binding of the IL-6Ra-binding protein.
- the marker is flanked by GGS linkers.
- the polypeptides of the disclosure include peptide linkers (sometimes referred to as a linker).
- a peptide linker may be separating any of the peptide domain/regions described herein.
- a linker may be between the signal peptide and the antigen binding domain, between a V H and V L of an antigen binding domain, between an antigen binding domain and a peptide spacer, between a peptide spacer and a transmembrane domain.
- a peptide linker may have any of a variety of amino acid sequences. Domains and regions can be joined by a peptide linker that is generally of a flexible nature, although other chemical linkages are not excluded.
- a linker can be a peptide of between about 6 and about 40 amino acids in length, or between about 6 and about 25 amino acids in length. These linkers can be produced by using synthetic, linker-encoding oligonucleotides to couple the proteins. [0083] Peptide linkers with a degree of flexibility can be used. The peptide linkers may have virtually any amino acid sequence, bearing in mind that suitable peptide linkers will have a sequence that results in a generally flexible peptide. The use of small amino acids, such as glycine and alanine, are of use in creating a flexible peptide. The creation of such sequences is routine to those of skill in the art.
- Suitable linkers can be readily selected and can be of any of a suitable of different lengths, such as from 1 amino acid (e.g., Gly) to 20 amino acids, from 2 amino acids to 15 amino acids, from 3 amino acids to 12 amino acids, including 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or 7 amino acids to 8 amino acids, and may be 1, 2, 3, 4, 5, 6, or 7 amino acids.
- Exemplary flexible linkers include glycine polymers (G) n , glycine- serine polymers (including, for example, (GS) n , (GSGGS) n and (GGGS) n , where n is an integer of at least one, glycine-alanine polymers, alanine- serine polymers, and other flexible linkers known in the art.
- Glycine and glycine- serine polymers can be used; both Gly and Ser are relatively unstructured, and therefore can serve as a neutral tether between components.
- Glycine polymers can be used; glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains.
- Exemplary spacers can comprise amino acid sequences including, but not limited to, GGSG, GGSGG, GSGSG, GSGGG, GGGSG, GSSSG, and the like. 4. Modifications to Antigen-binding Domains
- variable regions of antigen-binding domains of IL-6Ra-binding proteins of the disclosure can be modified by mutating amino acid residues within V H and/or V L CDR regions to improve one or more binding properties (e.g., affinity) of the protein.
- CDR refers to a complementarity-determining region that is based on a part of the variable chains in immunoglobulins (antibodies) and T-cell receptors, generated by B cells and T cells respectively, where these molecules bind to their specific antigen. Since most sequence variation associated with immunoglobulins and T-cell receptors are found in the CDRs, these regions are sometimes referred to as hypervariable regions.
- Mutations may be introduced by site-directed mutagenesis or PCR-mediated mutagenesis and the effect on antibody binding, or other functional property of interest, can be evaluated in appropriate in vitro or in vivo assays. Preferably conservative modifications are introduced and typically no more than one, two, three, four or five residues within a CDR region are altered.
- the mutations may be amino acid substitutions, additions or deletions.
- Framework modifications can be made to IL-6Ra-binding proteins to decrease immunogenicity, for example, by "backmutating" one or more framework residues to a corresponding germline sequence.
- the antigen binding domain may be multi- specific or multivalent by multimerizing the antigen binding domain with VH and VL region pairs that bind either the same antigen (multi- valent) or a different antigen (multi- specific).
- affinity refers to the equilibrium constant for the reversible binding of two agents and is expressed as a dissociation constant (Kd).
- Kd dissociation constant
- Affinity can be at least 1-fold greater, at least 2-fold greater, at least 3 -fold greater, at least 4-fold greater, at least 5-fold greater, at least 6-fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10-fold greater, at least 20-fold greater, at least 30-fold greater, at least 40-fold greater, at least 50-fold greater, at least 60-fold greater, at least 70-fold greater, at least 80-fold greater, at least 90-fold greater, at least 100-fold greater, or at least 1000-fold greater, or more (or any derivable range therein), than the affinity of an antibody for unrelated amino acid sequences.
- the term “avidity” refers to the resistance of a complex of two or more agents to dissociation after dilution.
- the terms “immunoreactive” and “preferentially binds” are used interchangeably herein with respect to antibodies and/or antigen -binding fragments.
- binding refers to a direct association between two molecules, due to, for example, covalent, electrostatic, hydrophobic, and ionic and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
- polypeptides of the disclosure may be chemically modified. Glycosylation of the polypeptides can be altered, for example, by modifying one or more sites of glycosylation within the polypeptide sequence to increase the affinity of the polypeptide for antigen (U.S. Pat. Nos. 5,714,350 and 6,350,861).
- the polypeptides of the invention can be pegylated to increase biological half-life by reacting the polypeptide with polyethylene glycol (PEG) or a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the polypeptide.
- PEG polyethylene glycol
- a reactive ester or aldehyde derivative of PEG under conditions in which one or more PEG groups become attached to the polypeptide.
- Polypeptide pegylation may be carried out by an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive watersoluble polymer).
- a reactive PEG molecule or an analogous reactive watersoluble polymer.
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
- Methods for pegylating proteins are known in the art and can be applied to the polypeptides of the invention (EP 0 154 316 and EP 0 401 384).
- polypeptides may be chemically modified by conjugating or fusing the polypeptide to serum protein, such as human serum albumin, to increase half-life of the resulting molecule.
- serum protein such as human serum albumin
- the polypeptides of the disclosure may be conjugated to a diagnostic or therapeutic agent and used diagnostically, for example, to monitor the development or progression of a disease and determine the efficacy of a given treatment regimen.
- the polypeptides may also be conjugated to a therapeutic agent to provide a therapy in combination with the therapeutic effect of the polypeptide.
- diagnostic agents include enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions.
- the detectable substance may be coupled or conjugated either directly to the polypeptide, or indirectly, through a linker using techniques known in the art.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase.
- suitable prosthetic group complexes include streptavidin/ biotin and avidin/biotin.
- fluorescent materials examples include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin.
- An example of a luminescent material includes luminol.
- bioluminescent materials include luciferase, luciferin, and aequorin.
- radioactive material examples include .sup.1251, .sup.1311, Indium-I l l, Lutetium-171, Bismuth-212, Bismuth-213, Astatine-211, Copper-62, Copper-64, Copper-67, Yttrium-90, Iodine-125, Iodine-131, Phosphorus-32, Phosphorus-33, Scandium-47, Silver-I l l, Gallium-67, Praseodymium- 142, Samarium-153, Terbium-161, Dysprosium- 166, Holmium-166, Rhenium-186, Ithenium-188, Rhenium-189, Lead-212, Radium-223, Actinium-225, Iron-59, Selenium-75, Arsenic-77, Strontium-89, Molybdenum-99, Rhodium- 1105, Palladium- 109, Praseodymium- 143, Promethium-149, Erbium-169,
- Chelating agents may be attached through amities (Meares et al., 1984 Anal. Biochem. 142: 68-78); sulfhydral groups (Koyama 1994 Chem. Abstr. 120: 217262t) of amino acid residues and carbohydrate groups (Rodwell et al. 1986 PNAS USA 83: 2632-2636; Quadri et al. 1993 Nucl. Med. Biol. 20: 559-570).
- polypeptides may also be conjugated to a therapeutic agent to provide a therapy in combination with the therapeutic effect of the polypeptide.
- Additional suitable conjugated molecules include ribonuclease (RNase), DNase I, an antisense nucleic acid, an inhibitory RNA molecule such as a siRNA molecule, an immuno stimulatory nucleic acid, aptamers, ribozymes, triplex forming molecules, and external guide sequences.
- Aptamers are small nucleic acids ranging from 15-50 bases in length that fold into defined secondary and tertiary structures, such as stern-loops or G-quartets, and can bind small molecules, such as ATP (U.S. Pat. No. 5,631,146) and theophiline (U.S. Pat. No. 5,580,737), as well as large molecules, such as reverse transcriptase (U.S.
- Ribozymes are nucleic acid molecules that are capable of catalyzing a chemical reaction, either intramolecularly or intermolecularly. Ribozymes typically cleave nucleic acid substrates through recognition and binding of the target substrate with subsequent cleavage. Triplex forming function nucleic acid molecules can interact with double-stranded or single- stranded nucleic acid by forming a triplex, in which three strands of DNA form a complex dependant on both Watson-Crick and Hoogsteen base-pairing. Triplex molecules can bind target regions with high affinity and specificity.
- the functional nucleic acid molecules may act as effectors, inhibitors, modulators, and stimulators of a specific activity possessed by a target molecule, or the functional nucleic acid molecules may possess a de novo activity independent of any other molecules.
- IL-6Ra-binding proteins can be expressed in a variety of cell types.
- An expression construct encoding an IL-6Ra-binding protein can be transfected into cells according to a variety of methods known in the art.
- the IL-6Ra-binding protein expression construct can be under control of a constitutive promoter. In some embodiments, it can be under control of a regulatable promoter that drives expression only under certain conditions. This can provide for expression of a IL-6Ra-binding protein only when necessary to respond to a potentially harmful situation or a situation in which it is desirable to reduce signaling through IL-6Ra, such as, for example, when there are increased levels of cytokines present.
- the IL-6Ra-binding protein expression construct may be placed under control of a promoter that is responsive to cytokines such as IL-6, TNF-a, IFN- ⁇ , IL- ⁇ , IL-2, IL-8, and IL-10.
- the IL-6Ra-binding protein expression construct can also be placed under control of a promoter that is linked to T-cell activation, such as one that is controlled by NFAT-1 or NF- ⁇ , both of which are transcription factors that can be activated upon T-cell activation.
- Control of IL-6Ra-binding protein expression allows T cells, such as tumor- targeting T cells, to sense their surroundings and perform real-time modulation of cytokine signaling, both in the T cells themselves and in surrounding endogenous immune cells.
- polynucleotides encoding the proteins, polypeptides, or peptides described herein.
- Polynucleotide sequences contemplated include those encoding IL-6Ra-binding proteins and CARs.
- polynucleotide refers to a nucleic acid molecule that either is recombinant or has been isolated free of total genomic nucleic acid. Included within the term “polynucleotide” are oligonucleotides (nucleic acids 100 residues or less in length), recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like. Polynucleotides include, in certain aspects, regulatory sequences, isolated substantially away from their naturally occurring genes or protein encoding sequences.
- Polynucleotides may be single- stranded (coding or antisense) or double- stranded, and may be RNA, DNA (genomic, cDNA or synthetic), analogs thereof, or a combination thereof. Additional coding or non-coding sequences may, but need not, be present within a polynucleotide.
- the term “gene,” “polynucleotide,” or “nucleic acid” is used to refer to a nucleic acid that encodes a protein, polypeptide, or peptide (including any sequences required for proper transcription, post-translational modification, or localization). As will be understood by those in the art, this term encompasses genomic sequences, expression cassettes, cDNA sequences, and smaller engineered nucleic acid segments that express, or may be adapted to express, proteins, polypeptides, domains, peptides, fusion proteins, and mutants.
- a nucleic acid encoding all or part of a polypeptide may contain a contiguous nucleic acid sequence encoding all or a portion of such a polypeptide. It also is contemplated that a particular polypeptide may be encoded by nucleic acids containing variations having slightly different nucleic acid sequences but, nonetheless, encode the same or substantially similar protein.
- nucleic acid segments and recombinant vectors incorporating nucleic acid sequences that encode a polypeptide (e.g., an antibody or fragment thereof) that binds to IL-6Ra are isolated nucleic acid segments and recombinant vectors incorporating nucleic acid sequences that encode a polypeptide (e.g., an antibody or fragment thereof) that binds to IL-6Ra.
- a polypeptide e.g., an antibody or fragment thereof
- recombinant may be used in conjunction with a polypeptide or the name of a specific polypeptide, and this generally refers to a polypeptide produced from a nucleic acid molecule that has been manipulated in vitro or that is a replication product of such a molecule.
- nucleic acid segments regardless of the length of the coding sequence itself, may be combined with other nucleic acid sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably. It is therefore contemplated that a nucleic acid fragment of almost any length may be employed, with the total length preferably being limited by the ease of preparation and use in the intended recombinant nucleic acid protocol.
- a nucleic acid sequence may encode a polypeptide sequence with additional heterologous coding sequences, for example to allow for purification of the polypeptide, transport, secretion, post-translational modification, or for therapeutic benefits such as targeting or efficacy.
- a tag or other heterologous polypeptide may be added to the modified polypeptide-encoding sequence, wherein “heterologous” refers to a polypeptide that is not the same as the modified polypeptide.
- polynucleotide variants having substantial identity to the sequences disclosed herein; those comprising at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or higher sequence identity, including all values and ranges there between, compared to a polynucleotide sequence provided herein using the methods described herein (e.g., BLAST analysis using standard parameters).
- the isolated polynucleotide will comprise a nucleotide sequence encoding a polypeptide that has at least 90%, preferably 95% and above, identity to an amino acid sequence described herein, over the entire length of the sequence; or a nucleotide sequence complementary to said isolated polynucleotide.
- Polypeptides may be encoded by a nucleic acid molecule.
- the nucleic acid molecule can be in the form of a nucleic acid vector.
- vector is used to refer to a carrier nucleic acid molecule into which a heterologous nucleic acid sequence can be inserted for introduction into a cell where it can be replicated and expressed.
- a nucleic acid sequence can be "heterologous,” which means that it is in a context foreign to the cell in which the vector is being introduced or to the nucleic acid in which is incorporated, which includes a sequence homologous to a sequence in the cell or nucleic acid but in a position within the host cell or nucleic acid where it is ordinarily not found.
- Vectors include DNAs, RNAs, plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs).
- viruses bacteriophage, animal viruses, and plant viruses
- artificial chromosomes e.g., YACs.
- One of skill in the art would be well equipped to construct a vector through standard recombinant techniques (for example Sambrook et al., 2001; Ausubel et al., 1996, both incorporated herein by reference).
- Vectors may be used in a host cell to produce an antibody that binds IL-6Ra.
- expression vector refers to a vector containing a nucleic acid sequence coding for at least part of a gene product capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide.
- Expression vectors can contain a variety of "control sequences,” which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host organism. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well and are described herein.
- a “promoter” is a control sequence.
- the promoter is typically a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors.
- the phrases "operatively positioned,” “operatively linked,” “under control,” and “under transcriptional control” mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and expression of that sequence.
- a promoter may or may not be used in conjunction with an “enhancer,” which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
- a specific initiation signal also may be required for efficient translation of coding sequences. These signals include the ATG initiation codon or adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may need to be provided. One of ordinary skill in the art would readily be capable of determining this and providing the necessary signals.
- Vectors can include a multiple cloning site (MCS), which is a nucleic acid region that contains multiple restriction enzyme sites, any of which can be used in conjunction with standard recombinant technology to digest the vector.
- MCS multiple cloning site
- RNA molecules will undergo RNA splicing to remove introns from the primary transcripts.
- Vectors containing genomic eukaryotic sequences may require donor and/or acceptor splicing sites to ensure proper processing of the transcript for protein expression. (See Chandler et al., 1997, incorporated herein by reference.)
- the vectors or constructs will generally comprise at least one termination signal.
- a “termination signal” or “terminator” is comprised of the DNA sequences involved in specific termination of an RNA transcript by an RNA polymerase. Thus, in certain embodiments a termination signal that ends the production of an RNA transcript is contemplated.
- a terminator may be necessary in vivo to achieve desirable message levels. In eukaryotic systems, the terminator region may also comprise specific DNA sequences that permit site-specific cleavage of the new transcript so as to expose a polyadenylation site. This signals a specialized endogenous polymerase to add a stretch of about 200 A residues (polyA) to the 3' end of the transcript.
- RNA molecules modified with this polyA tail appear to more stable and are translated more efficiently.
- terminator comprises a signal for the cleavage of the RNA, and it is more preferred that the terminator signal promotes polyadenylation of the message.
- polyadenylation signal to effect proper polyadenylation of the transcript.
- a vector in a host cell may contain one or more origins of replication sites (often termed "ori"), which is a specific nucleic acid sequence at which replication is initiated.
- ori origins of replication sites
- ARS autonomously replicating sequence
- the terms "cell,” “cell line,” and “cell culture” may be used interchangeably. All of these terms also include their progeny, which is any and all subsequent generations. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations.
- "host cell” refers to a prokaryotic or eukaryotic cell, and it includes any transformable organism that is capable of replicating a vector or expressing a heterologous gene encoded by a vector. A host cell can, and has been, used as a recipient for vectors or viruses.
- a host cell may be "transfected” or “transformed,” which refers to a process by which exogenous nucleic acid, such as a recombinant protein-encoding sequence, is transferred or introduced into the host cell.
- a transformed cell includes the primary subject cell and its progeny.
- Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
- control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
- One of skill in the art would further understand the conditions under which to incubate all of the above described host cells to maintain them and to permit replication of a vector. Also understood and known are techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.
- compositions discussed above Numerous expression systems exist that comprise at least a part or all of the compositions discussed above.
- Prokaryote- and/or eukaryote-based systems can be employed for use with an embodiment to produce nucleic acid sequences, or their cognate polypeptides, proteins and peptides. Many such systems are commercially and widely available.
- the insect cell/baculovirus system can produce a high level of protein expression of a heterologous nucleic acid segment, such as described in U.S. Patents 5,871,986, 4,879,236, both herein incorporated by reference, and which can be bought, for example, under the name MAXBAC® 2.0 from INVITROGEN® and BACPACKTM BACULO VIRUS EXPRESSION SYSTEM FROM CLONTECH®.
- a heterologous nucleic acid segment such as described in U.S. Patents 5,871,986, 4,879,236, both herein incorporated by reference, and which can be bought, for example, under the name MAXBAC® 2.0 from INVITROGEN® and BACPACKTM BACULO VIRUS EXPRESSION SYSTEM FROM CLONTECH®.
- expression systems include STRATAGENE® ' s COMPLETE CONTROLTM Inducible Mammalian Expression System, which involves a synthetic ecdysone-inducible receptor, or its pET Expression System, an E. coli expression system.
- STRATAGENE® ' s COMPLETE CONTROLTM Inducible Mammalian Expression System
- pET Expression System an E. coli expression system.
- an inducible expression system is available from INVITROGEN®, which carries the T-REXTM (tetracycline-regulated expression) System, an inducible mammalian expression system that uses the full-length CMV promoter.
- INVITROGEN® also provides a yeast expression system called the Pichia methanolica Expression System, which is designed for high-level production of recombinant proteins in the methylotrophic yeast Pichia methanolica.
- a vector such as an expression construct, to produce a nucleic acid sequence or its cognate polypeptide, protein, or peptide.
- Suitable methods for nucleic acid delivery to effect expression of compositions are believed to include virtually any method by which a nucleic acid (e.g., DNA, including viral and nonviral vectors) can be introduced into a cell, a tissue or an organism, as described herein or as would be known to one of ordinary skill in the art.
- a nucleic acid e.g., DNA, including viral and nonviral vectors
- Such methods include, but are not limited to, direct delivery of DNA such as by injection (U.S. Patents 5,994,624, 5,981,274, 5,945,100, 5,780,448, 5,736,524, 5,702,932, 5,656,610, 5,589,466 and 5,580,859, each incorporated herein by reference), including microinjection (Harland and Weintraub, 1985; U.S.
- Patent 5,789,215 incorporated herein by reference
- electroporation U.S. Patent No. 5,384,253, incorporated herein by reference
- calcium phosphate precipitation Graham and Van Der Eb, 1973; Chen and Okayama, 1987; Rippe et al., 1990
- DEAE dextran followed by polyethylene glycol
- direct sonic loading Fechheimer et al., 1987
- liposome mediated transfection Nicolau and Sene, 1982; Fraley et al., 1979; Nicolau et al., 1987; Wong et al., 1980; Kaneda et al., 1989; Kato et al., 1991
- microprojectile bombardment PCT Application Nos.
- organelle(s), cell(s), tissue(s) or organism(s) may be stably or transiently transformed.
- Other methods include viral transduction, such as gene transfer by lentiviral or retroviral transduction.
- an IL-6Ra-binding protein is encoded by an expression construct that has the following structure: murine 5' - IgG kappa leader sequence - FLAG tag - V L - scFv linker - V H - 3' .
- DNA sequence encodes such a construct (underlined sequences are the murine IgG kappa leader and the scFv linker sequences): ATGGAGACAGACACACTCCTGCTATGGGTGCTGCTGCTCTGGGTTCCAGGTTCCA CAGGTGACGGAGGCAGCGACTATAAAGATGACGATGACAAAGGAGGTAGCGAT ATACAAATGACTCAATCACCTTCCTCACTTTCCGCCAGCGTGGGTGATCGAGTGA CCATCACATGCCGCGCTTCACAGGACATCTCCTCTTACCTGAACTGGTACCAGCA GAAACCCGGGAAAGCCCCAAAGCTGTTGATCTACTATACATCAAGACTGCACTCT GGCGTCCCCTCTAGGTTCAGTGGATCTGGCTCAGGTACTGACTTCACGTTCACTA TTTCCAGCCTGCAGCCGGAAGATATTGCTACCTACTATTGTCAGCAGGGAAATAC CCTCCCATATACCTTTGGGCAGGGGACAAAGGTGGAAATCAAGCGGACGGTAGC TGCTCCG
- the cell is an immune cell or a T cell.
- T cell includes all types of immune cells expressing CD3 including T-helper cells (CD4 + cells), cytotoxic T-cells (CD8 + cells), T-regulatory cells (T re g), suppressor T cells, and gamma-delta T cells.
- a "cytotoxic cell” includes CD8 + T cells, natural-killer (NK) cells, and neutrophils, which cells are capable of mediating cytotoxicity responses.
- the cell is a progenitor cell or stem cell.
- the progenitor or stem cell is in vitro differentiated into an immune cell.
- the cell is ex vivo.
- immune cells includes cells of the immune system that are involved in defending the body against both infectious disease and foreign materials. Immune cells may include, for example, neutrophils, eosinophils, basophils, natural killer cells, lymphocytes such as B cells and T cells, and monocytes.
- Suitable mammalian cells include primary cells and immortalized cell lines.
- Suitable mammalian cell lines include human cell lines, non-human primate cell lines, rodent (e.g., mouse, rat) cell lines, and the like.
- Suitable mammalian cell lines include, but are not limited to, HeLa cells (e.g., American Type Culture Collection (ATCC) No. CCL-2), CHO cells (e.g., ATCC Nos. CRL9618, CCL61, CRL9096), human embryonic kidney (HEK) 293 cells (e.g., ATCC No. CRL-1573), Vera cells, NIH 3T3 cells (e.g., ATCC No.
- Huh-7 cells BHK cells (e.g., ATCC No. CCL10), PC12 cells (ATCC No. CRL1721), COS cells, COS-7 cells (ATCC No. CRL1651), RATI cells, mouse L cells (ATCC No. CCLI.3), HLHepG2 cells, Hut-78, Jurkat, HL-60, NK cell lines (e.g., NKL, NK92, and YTS), and the like.
- BHK cells e.g., ATCC No. CCL10
- PC12 cells ATCC No. CRL1721
- COS cells COS-7 cells
- RATI cells mouse L cells (ATCC No. CCLI.3)
- HLHepG2 cells Hut-78
- Jurkat HL-60
- NK cell lines e.g., NKL, NK92, and YTS
- the cell is not an immortalized cell line, but is instead a cell (e.g., a primary cell) obtained from an individual.
- a cell e.g., a primary cell
- the cell is an immune cell obtained from an individual.
- the cell is a T lymphocyte obtained from an individual.
- the cell is a cytotoxic cell obtained from an individual.
- the cell is a stem cell or progenitor cell obtained from an individual.
- cells disclosed herein are used in adoptive cell therapy or adoptive cell transfer, which involves administration of therapeutic cells to subjects.
- This therapy can involve administration of tumor- infiltrating lymphocytes, cytotoxic T lymphotytes (CTLs), helper T (Th) cells, and Treg cells, and other immune cells and other types of cells.
- CTLs cytotoxic T lymphotytes
- Th helper T
- Treg cells and other immune cells and other types of cells.
- the therapeutic cells may originate from a patient or from a donor.
- cells are extracted from a patient, genetically modified and cultured in vitro and returned to the same patient.
- Cells disclosed herein can be administered to a subject to treat, for example, cancer, autoimmune diseases, infections, and inflammatory disorders.
- expression of IL-6Ra binding proteins by cells used in adoptive T cell therapy can reduce or eliminate side effects that may occur as a result of adoptive T cell therapy, such as cytokine release syndrome and other inflammatory or autoimmune conditions that involve IL-6 signaling through IL-6Ra.
- administration of IL-6Ra-binding proteins in conjunction with therapeutic T cells can eliminate, reduce, or mitigate the side effects of adoptive T cell therapy.
- therapeutic cells used in adoptive cell therapies express chimeric antigen receptors (CARs).
- CARs are fusion proteins that are commonly composed of an extracellular antigen-binding domain (which may be an scFv), an extracellular spacer, a transmembrane domain, costimulatory signaling regions (the number of which varies depending on the specific CAR design), and a CD3-zeta signaling domain/endodomain.
- Immune cells including T cells and natural killer (NK) cells, can be engineered to express CARs by a variety of methods known in the art, including viral transduction, DNA nucleofection, and RNA nucleofection.
- the cells comprise a cancer-specific CAR.
- cancer-specific in the context of CARs refers to CARs that have an antigen binding specificity for a cancer-specific molecule, such as a cancer- specific antigen.
- the cancer specific CAR is in a cell with a CAR specific for another target, such as a TGF- ⁇ CAR.
- the cancer- specific CAR and another CAR are on separate polypeptides.
- the CAR is a bi-specific CAR that has antigen binding for a cancer- specific molecule and for another antigen, such as TGF- ⁇ .
- a bi-specific CAR may have a signaling peptide, a cancer molecule- specific scFv, optionally a peptide linker/spacer, followed by an scFv that binds another antigen, followed by a spacer, a transmembrane domain, and a costimulatory domain.
- the bi-specific CAR comprises one or more additional peptide segments described herein.
- CARs of the disclosure may comprise a CD20 scFv.
- An exemplary CD20 scFv comprises the following:
- DIVLTQS PAILS AS PGEKVTMTCRAS S S VN YMD W YQKKPGS S PKPWIY ATS NLAS G V P ARFS GS GS GTS YS LTIS RVE AED A AT Y YC QQWS FNPPTFGGGTKLEIKGS TS GGGS G GGSGGGGSS E VQLQQS G AELVKPG AS VKMS CKAS G YTFTS YNMH V WKQTPGQGLE WIG AIYPGNGDTS YNQKFKGKATLT ADKS S S T A YMQLS S LTS EDS AD Y YC ARS N Y Y GS S YWFFD VWG AGTT VT VS S (SEQ ID NO: 12).
- CARs of the disclosure may comprise a CD19 scFv.
- An exemplary CD 19 scFv comprises the following:
- an anti-CD19 CAR is encoded by a DNA construct with the following structure: GM-CSF signal peptide - HA tag - CD19 scFv - IgG4 hinge - CD28 tm - 4-1BB co-stimulatory domain - CD3 zeta. This construct has the following sequence:
- cancer-specific molecules in addition to CD 19 and CD20
- CARs can include CAIX, CD33, CD44v7/8, CEA, EGP-2, EGP-40, erb-B2, erb-B3, erb-B4, FBP, fetal acetycholine receptor, GD2, GD3, Her2/neu, IL-13R-a2, KDR, k-light chain, LeY, LI cell adhesion molecule, MAGE-Al, mesothelin, MUCl, NKG2D ligands, oncofetal antigen (h5T4), PSCA, PSMA, TAA targeted by mAb IgE, TAG-72, and VEGF-R2.
- the cancer-specific molecule comprises Her2.
- CARs include a signal peptide directs the transport and localization of the protein within a cell, e.g. to a certain cell organelle (such as the endoplasmic reticulum) and/or the cell surface.
- a signal peptide directs the nascent protein into the endoplasmic reticulum. This is essential if the receptor is to be glycosylated and anchored in the cell membrane.
- the signal peptide natively attached to the amino-terminal most component is used (e.g. in a scFv with orientation light chain - linker - heavy chain, the native signal of the light-chain is used).
- the signal peptide has the sequence METDTLLLWVLLLWVPGSTG (SEQ ID NO: 14), MLLVTS LLLCELPHP AFLLIPDT (SEQ ID NO: 15), or
- the signal peptide is cleaved after passage of the endoplasmic reticulum (ER), i.e. is a cleavable signal peptide.
- ER endoplasmic reticulum
- a restriction site is at the carboxy end of the signal peptide to facilitate cleavage.
- the antigen-binding domain of a CAR is an antigen-binding protein, such as a single-chain variable fragment (scFv) based on antibodies against the target antigen.
- Framework modifications can be made to the antigen-binding domain to decrease immunogenicity, for example, by "backmutating" one or more framework residues to the corresponding germline sequence.
- the antigen binding domain may be multi- specific or multivalent by multimerizing the antigen binding domain with V H and V L region pairs that bind either the same antigen (multi-valent) or a different antigen (multi- specific).
- a spacer region links the antigen-binding domain to the transmembrane domain of a CAR. It should be flexible enough to allow the antigen-binding domain to orient in different directions to facilitate antigen recognition.
- the simplest form is the hinge region from IgG.
- Alternatives include the CH2CH3 region of immunoglobulin and portions of CD3.
- the CH2CH3 region may have L235E/N297Q or L235D/N297Q modifications, or at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity of the CH2CH3 region.
- the IgG hinge suffices. However the best spacer often has to be determined empirically.
- the spacer is from IgG4.
- flanking polypeptide region refers to a flexible polypeptide connector region (also referred to herein as “hinge region” or “spacer”) providing structural flexibility and spacing to flanking polypeptide regions and can consist of natural or synthetic polypeptides.
- a "hinge” derived from an immunoglobulin is generally defined as stretching from Glu216 to Pro230 of human IgGl (Burton (1985) Molec. Immunol., 22: 161- 206).
- Hinge regions of other IgG isotypes may be aligned with the IgGl sequence by placing the first and last cysteine residues forming inter-heavy chain disulfide (S-S) bonds in the same positions.
- the hinge region may be of natural occurrence or non-natural occurrence, including but not limited to an altered hinge region as described in U.S. Pat. No. 5,677,425.
- the hinge region can include complete hinge region derived from an antibody of a different class or subclass from that of the CHi domain.
- the term "hinge” can also include regions derived from CD8 and other receptors that provide a similar function in providing flexibility and spacing to flanking regions.
- the peptide spacer can have a length of at least, at most, or exactly 4, 5, 6, 7, 8, 9, 10, 15, 16, 17, 18, 19, 20, 20, 25, 30, 35, 40, 45, 50, 75, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 260, 270, 280, 290, 300, 325, 350, or 400 amino acids (or any derivable range therein).
- the peptide spacer consists of or comprises a hinge region from an immunoglobulin.
- Immunoglobulin hinge region amino acid sequences are known in the art; see, e.g., Tan et al. (1990) Proc. Natl. Acad. Sci. USA 87: 162; and Huck et al. (1986) Nucl. Acids Res.
- the length of a peptide spacer may have effects on the response to the target antigen and/or expansion properties.
- a shorter spacer such as less than 50, 45, 40, 30, 35, 30, 25, 20, 15, or 10 amino acids may have the advantage of a decrease in the concentration of target antigen required for an effective activation response.
- an immunoglobulin hinge region can include one of the following amino acid sequences: DKTHT (SEQ ID NO: 17); CPPC (SEQ ID NO: 18); CPEPKSCDTPPPCPR (SEQ ID NO: 19); ELKTPLGDTTHT (SEQ ID NO:20); KSCDKTHTCP (SEQ ID NO:21); KCCVDCP (SEQ ID NO:22); KYGPPCP (SEQ ID NO:23); EPKSCDKTHTCPPCP (SEQ ID NO:24) (human IgGl hinge); ERKCCVECPPCP (SEQ ID NO:25) (human IgG2 hinge); ELKTPLGDTTHTCPRCP (SEQ ID NO:26) (human IgG3 hinge); SPNMVPHAHHAQ (SEQ ID NO:27); ESKYGPPCPPCP (SEQ ID NO:28) or ESKYGPPCPSCP (SEQ ID NO:29) (human IgG4 hinge-based) and the like.
- the hinge region can comprise an amino acid sequence of a human IgGl, IgG2, IgG3, or IgG4, hinge region.
- the hinge region can include one or more amino acid substitutions and/or insertions and/or deletions compared to a wild-type (naturally-occurring) hinge region.
- His229 of human IgGl hinge can be substituted with Tyr, so that the hinge region comprises the sequence EPKSCDKTYTCPPCP (SEQ ID NO:30).
- the hinge region can comprise an amino acid sequence derived from human CD8; e.g., the hinge region can comprise the amino acid sequence: TTTPAPRPPTPAPTIAS QPLS LRPEACRPAAGGA VHTRGLDFACD (SEQ ID NO:31), or a variant thereof.
- TTTPAPRPPTPAPTIAS QPLS LRPEACRPAAGGA VHTRGLDFACD SEQ ID NO:31
- the transmembrane domain of the CAR is a hydrophobic alpha helix that spans the membrane. Generally, the transmembrane domain from the most membrane proximal component of the endodomain is used. Different transmembrane domains result in different receptor stability.
- the transmembrane domain is interposed between the peptide spacer and the endodomain. In some embodiments, the transmembrane domain is interposed between the peptide spacer and a co- stimulatory region. In some embodiments, a linker is between the transmembrane domain and a co- stimulatory region or endodomain.
- Any transmembrane domain that provides for insertion of a polypeptide into the cell membrane of a eukaryotic (e.g., mammalian) cell is suitable for use.
- the transmembrane sequence IYIW APLAGTC G VLLLS LVITLYC (SEQ ID NO:32) can be used.
- the transmembrane domain is CD8 beta derived: LGLLV AGVLVLLVS LGVAIHLCC (SEQ ID NO:33); CD4 derived: ALIVLGGVAGLLLFIGLGIFFCVRC (SEQ ID NO:34); CD3 zeta derived: LC YLLD GILFIYG VILT ALFLR V (SEQ ID NO:35); CD28 derived: WVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO:36); CD134 (OX40) derived: VAAILGLGLVLGLLGPLAILLALYLL (SEQ ID NO:37); or CD7 derived: ALP A ALA VIS FLLGLGLG V AC VLA (SEQ ID NO:38).
- co-stimulatory domains described herein are part of the endodomain.
- the most commonly used endodomain component is CD3-zeta, which contains 3 ITAMs. This transmits an activation signal to the T cell after antigen is bound.
- CD3-zeta may not provide a fully competent activation signal and additional co-stimulatory signaling is needed.
- chimeric CD28 and OX40 can be used with CD3-Zeta to transmit a proliferative/survival signal, or all three can be used together.
- endodomains suitable for use in CARs include any desired signaling domain that provides a distinct and detectable signal (e.g., increased production of one or more cytokines by the cell; change in transcription of a target gene; change in activity of a protein; change in cell behavior, e.g., cell death; cellular proliferation; cellular differentiation; cell survival; modulation of cellular signaling responses; etc.) in response to activation by way of binding of the antigen to the antigen binding domain.
- the endodomain includes at least one (e.g., one, two, three, four, five, six, etc.) ITAM motif as described herein.
- the endodomain includes DAP10/CD28 type signaling chains.
- Endodomains suitable for use in CARs include immunoreceptor tyrosine-based activation motif (ITAM)-containing intracellular signaling polypeptides.
- ITAM immunoreceptor tyrosine-based activation motif
- An ITAM motif is YXiX 2 (L/I), where Xi and X 2 are independently any amino acid (SEQ ID NO:39).
- the endodomain comprises 1, 2, 3, 4, or 5 IT AM motifs.
- an IT AM motif is repeated twice in an endodomain, where the first and second instances of the IT AM motif are separated from one another by 6 to 8 amino acids, e.g., (YX 1 X 2 (L I))(X3)n(YXiX2(L I)), where n is an integer from 6 to 8, and each of the 6-8 X 3 can be any amino acid (SEQ ID NO:40).
- a suitable endodomain may be an ⁇ motif-containing portion that is derived from a polypeptide that contains an IT AM motif.
- a suitable endodomain can be an IT AM motif-containing domain from any IT AM motif-containing protein.
- a suitable endodomain need not contain the entire sequence of the entire protein from which it is derived.
- suitable ITAM motif-containing polypeptides include, but are not limited to: DAP12; FCERIG (Fc epsilon receptor I gamma chain); CD3D (CD3 delta); CD3E (CD3 epsilon); CD3G (CD3 gamma); CD3Z (CD3 zeta); and CD79A (antigen receptor complex-associated protein alpha chain).
- the endodomain is derived from DAP12 (also known as TYROBP; TYRO protein tyrosine kinase binding protein; KARAP; PLOSL; DN AX- activation protein 12; KAR-associated protein; TYRO protein tyrosine kinase- binding protein; killer activating receptor associated protein; killer- activating receptor- associated protein; etc.).
- DAP12 also known as TYROBP; TYRO protein tyrosine kinase binding protein; KARAP; PLOSL; DN AX- activation protein 12; KAR-associated protein; TYRO protein tyrosine kinase- binding protein; killer activating receptor associated protein; killer- activating receptor- associated protein; etc.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to
- a suitable endodomain polypeptide can comprise an ITAM motif-containing portion of the full length DAP 12 amino acid sequence.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to ESPYOELOGORSDVYSDLNTO (SEQ ID NO:45).
- the endodomain is derived from FCER1G (also known as FCRG; Fc epsilon receptor I gamma chain; Fc receptor gamma-chain; fc-epsilon Rl-gamma; fcRgamma; fceRI gamma; high affinity immunoglobulin epsilon receptor subunit gamma; immunoglobulin E receptor, high affinity, gamma chain; etc.).
- FCER1G also known as FCRG
- Fc epsilon receptor I gamma chain Fc receptor gamma-chain
- fcRgamma fceRI gamma
- high affinity immunoglobulin epsilon receptor subunit gamma immunoglobulin E receptor, high affinity, gamma chain; etc.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity to MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYE KS DG V YTGLS TRNQET YETLKHEKPPQ (SEQ ID NO:46).
- a suitable endodomain polypeptide can comprise an ITAM motif-containing portion of the full length FCER1G amino acid sequence.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to DGVYTGLS TRNOET YETLKHE (SEQ ID NO:47).
- the endodomain is derived from T-cell surface glycoprotein CD3 delta chain (also known as CD3D; CD3-DELTA; T3D; CD3 antigen, delta subunit; CD3 delta; CD3d antigen, delta polypeptide (TiT3 complex); OKT3, delta chain; T-cell receptor T3 delta chain; T-cell surface glycoprotein CD3 delta chain; etc.).
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 170 aa, of either of the following amino acid sequences (2 isoforms):
- a suitable endodomain polypeptide can comprise an ITAM motif-containing portion of the full length CD3 delta amino acid sequence.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to DOVYOPLRDRDDAOYSHLGGN (SEQ ID NO:50).
- the endodomain is derived from T-cell surface glycoprotein CD3 epsilon chain (also known as CD3e, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 epsilon chain, AI504783, CD3, CD3epsilon, T3e, etc.).
- T-cell surface glycoprotein CD3 epsilon chain also known as CD3e, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 epsilon chain, AI504783, CD3, CD3epsilon, T3e, etc.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 205 aa, of the following amino acid sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEI LWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLY LRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWS
- a suitable endodomain polypeptide can comprise an ITAM motif-containing portion of the full length CD3 epsilon amino acid sequence.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to NPD YEPIRKGQRDLYS GLNQR (SEQ ID NO:52).
- the endodomain is derived from T-cell surface glycoprotein CD3 gamma chain (also known as CD3G, T-cell receptor T3 gamma chain, CD3-GAMMA, T3G, gamma polypeptide (TiT3 complex), etc.).
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 180 aa, of the following amino acid sequence: MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFK DGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNA ATISGFLFAEIVSIFVLAVGVYFIAGODGVR
- a suitable endodomain polypeptide can comprise an ITAM motif-containing portion of the full length CD3 gamma amino acid sequence.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to DOLYOPLKDREDDOYSHLOGN (SEQ ID NO:54).
- the endodomain is derived from T-cell surface glycoprotein CD3 zeta chain (also known as CD3Z, T-cell receptor T3 zeta chain, CD247, CD3-ZETA, CD3H, CD3Q, T3Z, TCRZ, etc.).
- a suitable intracellular signaling domain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 160 aa, of either of the following amino acid sequences (2 isoforms): MKWKALFT A AILQ AQLPITE AQS FGLLDPKLC YLLD GILFIYG VILT ALFLRVKFS RS A DAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELO KDKM
- a suitable endodomain polypeptide can comprise an ITAM motif-containing portion of the full length CD3 zeta amino acid sequence.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to any of the following amino acid sequences: RVKFSRSADAPAYOQGONOLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPO EGLYNELOKDKMAEAYSEIGMKGERRRGKGHDGLYOGLSTATKDTYDALHMQALP PR (SEQ ID NO: 82); NOLYNELNLGRREEYDVLDKR (SEQ ID NO:57); EGLYNELQKDKMAEAYSEIGMK (SEQ ID NO:58); or
- the endodomain is derived from CD79A (also known as B-cell antigen receptor complex-associated protein alpha chain; CD79a antigen (immunoglobulin-associated alpha); MB-1 membrane glycoprotein; ig-alpha; membrane- bound immunoglobulin-associated protein; surface IgM-associated protein; etc.).
- CD79A also known as B-cell antigen receptor complex-associated protein alpha chain
- CD79a antigen immunoglobulin-associated alpha
- MB-1 membrane glycoprotein ig-alpha
- membrane- bound immunoglobulin-associated protein surface IgM-associated protein; etc.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 150 aa, from about 150 aa to about 200 aa, or from about 200 aa to about 220 aa, of either of the following amino acid sequences (2 isoforms):
- a suitable endodomain polypeptide can comprise an ITAM motif-containing portion of the full length CD79A amino acid sequence.
- a suitable endodomain polypeptide can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: ENLYEGLNLDDCS M YEDIS RG (SEQ ID NO:62).
- suitable endodomains can comprise a DAP10/CD28 type signaling chain.
- An example of a DAP 10 signaling chain is the amino acid sequence: RPRRSPAQDGKVYINMPGRG (SEQ ID NO:63).
- a suitable endodomain comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the entire length of the amino acid sequence RPRRSPAQDGKVYINMPGRG (SEQ ID NO:64).
- a CD28 signaling chain is the amino acid sequence FW VLV V VGG VLAC YS LLVT V AFIIFW VRS KRS RLLHS D YMNMTPRRPGPTRKH YQP YAPPRDFAAYRS (SEQ ID NO:65).
- a suitable endodomain comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the entire length of the amino acid sequence
- a ZAP70 polypeptide e.g., a polypeptide comprising an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to a contiguous stretch of from about 300 amino acids to about 400 amino acids, from about 400 amino acids to about 500 amino acids, or from about 500 amino acids to 619 amino acids, of the following amino acid sequence: MPDPAAHLPFFYGSIS RAE AEEHLKLAGM ADGLFLLRQCLRS LGGYVLS LVHD VRFHHFPIERQLNGTYAIAG GKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQ TWKLEGE ALEQAIIS Q APQVEKLIATT AHERMPWYHS SLTREE AERKLYS GAQTDGK FLLRPRKEQGTYALSLIYGKTVY
- CARs can include detection peptides.
- Suitable detection peptides include hemagglutinin (HA; e.g., YPYDVPDYA (SEQ ID NO:68); FLAG (e.g., DYKDDDDK (SEQ ID NO:69); c-myc (e.g., EQKLISEEDL; SEQ ID NO:70), and the like.
- Other suitable detection peptides are known in the art.
- CARs may also include peptide linkers (sometimes referred to as a linker).
- a peptide linker may be separating any of the peptide domain/regions described herein.
- a linker may be between the signal peptide and the antigen binding domain, between the V H and V L of the antigen binding domain, between the antigen binding domain and the peptide spacer, between the peptide spacer and the transmembrane domain, flanking the co- stimulatory region or on the N- or C- region of the co-stimulatory region, and/or between the transmembrane domain and the endodomain.
- the peptide linker may have any of a variety of amino acid sequences.
- Domains and regions can be joined by a peptide linker that is generally of a flexible nature, although other chemical linkages are not excluded.
- a linker can be a peptide of between about 6 and about 40 amino acids in length, or between about 6 and about 25 amino acids in length. These linkers can be produced by using synthetic, linker-encoding oligonucleotides to couple the proteins.
- Peptide linkers with a degree of flexibility can be used.
- the peptide linkers may have virtually any amino acid sequence, bearing in mind that suitable peptide linkers will have a sequence that results in a generally flexible peptide.
- the use of small amino acids, such as glycine and alanine, are of use in creating a flexible peptide. The creation of such sequences is routine to those of skill in the art.
- Suitable linkers can be readily selected and can be of any of a suitable of different lengths, such as from 1 amino acid (e.g., Gly) to 20 amino acids, from 2 amino acids to 15 amino acids, from 3 amino acids to 12 amino acids, including 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or 7 amino acids to 8 amino acids, and may be 1, 2, 3, 4, 5, 6, or 7 amino acids.
- Exemplary flexible linkers include glycine polymers (G) n , glycine- serine polymers (including, for example, (GS) come, (GSGGS) context (SEQ ID NO:71) and (GGGS) structuri (SEQ ID NO:72), where n is an integer of at least one, glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art.
- Glycine and glycine- serine polymers can be used; both Gly and Ser are relatively unstructured, and therefore can serve as a neutral tether between components.
- Glycine polymers can be used; glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains.
- Exemplary spacers can comprise amino acid sequences including, but not limited to, GGSG (SEQ ID NO:73), GGSGG (SEQ ID NO:74), GSGSG (SEQ ID NO:75), GSGGG (SEQ ID NO:76), GGGSG (SEQ ID NO:77), GSSSG (SEQ ID NO:78), and the like.
- Non-limiting examples of suitable co-stimulatory regions in CARs include, but are not limited to, polpeptides from 4-1BB (CD137), CD28, ICOS, OX-40, BTLA, CD27, CD30, GITR, and HVEM.
- a co- stimulatory region may have a length of at least, at most, or exactly 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, or 300 amino acids or any range derivable therein.
- the co-stimulatory region is derived from an intracellular portion of the transmembrane protein 4-1BB (also known as TNFRSF9; CD137; 4-1BB; CDwl37; ILA; etc.).
- a suitable co-stimulatory region can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity to KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO:79).
- the co- stimulatory region is derived from an intracellular portion of the transmembrane protein CD28 (also known as Tp44).
- a suitable co-stimulatory region can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity to FW VRS KRS RLLHS D YMNMTPRRPGPTRKH YQP Y APPRDF A A YRS (SEQ ID NO:80).
- the co- stimulatory region is derived from an intracellular portion of the transmembrane protein ICOS (also known as AILIM, CD278, and CVID1).
- a suitable co- stimulatory region can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity to TKKKYS S S VHDPNGE YMFMRA VNT AKKS RLTD VTL (SEQ ID NO:81).
- the co- stimulatory region is derived from an intracellular portion of the transmembrane protein OX-40 (also known as TNFRSF4, RP5-902P8.3, ACT35, CD134, OX40, TXGP1L).
- a suitable co- stimulatory region can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity to RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI (SEQ ID NO: 82).
- the co- stimulatory region is derived from an intracellular portion of the transmembrane protein BTLA (also known as BTLAl and CD272).
- BTLA also known as BTLAl and CD272.
- a suitable co- stimulatory region can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity to
- the co- stimulatory region is derived from an intracellular portion of the transmembrane protein CD27 (also known as S 152, T14, TNFRSF7, and Tp55).
- a suitable co- stimulatory region can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity to HQRRKYRS NKGES P VEP AEPCR YS CPREEEGS TIPIQED YRKPEP AC SP (SEQ ID NO:84).
- the co- stimulatory region is derived from an intracellular portion of the transmembrane protein CD30 (also known as TNFRSF8, D1S 166E, and Ki-1).
- a suitable co-stimulatory region can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity to
- the co- stimulatory region is derived from an intracellular portion of the transmembrane protein GITR (also known as TNFRSF18, RP5-902P8.2, AITR, CD357, and GITR-D).
- GITR also known as TNFRSF18, RP5-902P8.2, AITR, CD357, and GITR-D.
- a suitable co- stimulatory region can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity to HIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV
- the co- stimulatory region derived from an intracellular portion of the transmembrane protein HVEM (also known as TNFRSF14, RP3-395M20.6, ATAR, CD270, HVEA, HVEM, LIGHTR, and TR2).
- a suitable co-stimulatory region can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% amino acid sequence identity to CVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSP NH (SEQ ID NO:87).
- aspects of the current disclosure relate to methods of treating a condition, for stimulating an immune response, for regulating an immune response, for suppressing an immune response, and for reducing the risk of an adverse immune response, such as cytokine release syndrome. These actions may be done in vitro, in vivo, or ex vivo.
- the methods relate to cells capable of stimulating an immune response in the presence of a cancer cell.
- the method generally involves genetically modifying a mammalian cell with an expression vector, or an RNA (e.g., in vitro transcribed RNA), comprising nucleotide sequences encoding a polypeptide of the disclosure or directly transferring the polypeptide to the cell.
- the cell can be an immune cell (e.g., a T lymphocyte or NK cell), a stem cell, a progenitor cell, etc.
- the cell is a cell described herein.
- the genetic modification is carried out ex vivo.
- a T lymphocyte, a stem cell, or an NK cell is obtained from an individual; and the cell obtained from the individual is genetically modified to express a polypeptide of the disclosure.
- the genetically modified cell is activated ex vivo (i.e., a target antigen is contacted with the cells ex vivo).
- the genetically modified cell is introduced into an individual (e.g., the individual from whom the cell was obtained); and the genetically modified cell is activated in vivo (i.e., by endogenously produced target antigen).
- the methods further comprise the administration of additional therapeutic agents, such as bi-specific T cell engagers (BITE).
- BITE bi-specific T cell engagers
- Such therapeutic agents may be administered in peptide form to the patient or expressed in cells of the disclosure, such as those that that comprise the IL-6Ra binding protein.
- the BITE may have antigen specificity for a cancer antigen/cancer molecule known in the art and/or described herein and may also have antigen specificity for a T cell molecule such as CD3.
- the methods relate to administration of the cells or peptides described herein for the treatment of a cancer or administration to a person with a cancer.
- the cancer is adrenal cancer, anal cancer, bile duct cancer, bladder cancer, bone cancer, brain/CNS tumors in children or adults, breast cancer, cervical cancer, colon/rectum cancer, endometrial cancer, esophagus cancer, Ewing family of tumors, eye cancer, gallbladder cancer, gastrointestinal carcinoid tumors, gastrointestinal stromal tumor (GIST), gestation trophoblastic disease, hodgkin disease, kaposi sarcoma, kidney cancer, laryngeal and hypopharyngeal cancer, leukemia, acute lymphocytic leuckemia, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, chronic myelomonocytic leukemia, liver cancer, lung cancer, non-small cell lung cancer, small cell lung cancer,
- Embodiments can be used to treat or ameliorate a number of immune-mediated, inflammatory, or autoimmune-inflammatory diseases, e.g., allergies, asthma, diabetes (e.g. type 1 diabetes), graft rejection, etc.
- diseases or disorders also include, but are not limited to arthritis (rheumatoid arthritis such as acute arthritis, chronic rheumatoid arthritis, gout or gouty arthritis, acute gouty arthritis, acute immunological arthritis, chronic inflammatory arthritis, degenerative arthritis, type II collagen-induced arthritis, infectious arthritis, Lyme arthritis, proliferative arthritis, psoriatic arthritis, Still's disease, vertebral arthritis, and systemic juvenile-onset rheumatoid arthritis, osteoarthritis, arthritis chronica progrediente, arthritis deformans, polyarthritis chronica primaria, reactive arthritis, and ankylosing spondylitis), inflammatory hyperproliferative skin diseases, psoriasis such as plaque psoriasis
- vasculitides including vasculitis, large-vessel vasculitis (including polymyalgia rheumatica and gianT cell (Takayasu's) arteritis), medium-vessel vasculitis (including Kawasaki's disease and polyarteritis nodosa/periarteritis nodosa), microscopic polyarteritis, immunovasculitis, CNS vasculitis, cutaneous vasculitis, hypersensitivity vasculitis, necrotizing vasculitis such as systemic necrotizing vasculitis, and ANCA-associated vasculitis, such as Churg-Strauss vasculitis or syndrome (CSS) and ANCA
- the patient is one that does not have a particular indication described above.
- the patient does not have and/or has not been diagnosed with rheumatoid arthritis.
- the patient does not have a chronic autoimmune condition.
- chronic refers to an illness that is persisting for a long time or constantly recurring.
- the present disclosure includes methods for modulating immune responses in a subject in need thereof.
- the disclosure includes cells and proteins that may be in the form of a pharmaceutical composition that can be used to induce or modify an immune response.
- compositions according to the current disclosure will typically be via any common route. This includes, but is not limited to parenteral, orthotopic, intradermal, subcutaneous, intramuscular, intraperitoneal, intranasal, or intravenous injection.
- compositions of the invention are administered in a manner compatible with the dosage formulation, and in such amount as will be therapeutically effective and immune modifying.
- the quantity to be administered depends on the subject to be treated. Precise amounts of active ingredient required to be administered depend on the judgment of the practitioner.
- the manner of application may be varied widely. Any of the conventional methods for administration of pharmaceutical compositions comprising cellular components are applicable.
- the dosage of the pharmaceutical composition will depend on the route of administration and will vary according to the size and health of the subject.
- administrations of at most about or at least about 3, 4, 5, 6, 7, 8, 9, 10 or more.
- the administrations may range from 2-day to 12-week intervals, more usually from one to two week intervals.
- the course of the administrations may be followed by assays for alloreactive immune responses and T cell activity.
- phrases “pharmaceutically acceptable” or “pharmacologically acceptable” refer to molecular entities and compositions that do not produce an adverse, allergic, or other untoward reaction when administered to an animal, or human.
- pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like. The use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredients, its use in immunogenic and therapeutic compositions is contemplated.
- the pharmaceutical compositions of the current disclosure are pharmaceutically acceptable compositions.
- compositions of the disclosure can be formulated for parenteral administration, e.g., formulated for injection via the intravenous, intramuscular, sub-cutaneous, or even intraperitoneal routes.
- such compositions can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for use to prepare solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and, the preparations can also be emulsified.
- injectables either as liquid solutions or suspensions
- solid forms suitable for use to prepare solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and, the preparations can also be emulsified.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil, or aqueous propylene glycol. It also should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- Sterile injectable solutions are prepared by incorporating the active ingredients (i.e. cells of the disclosure) in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- An effective amount of a composition is determined based on the intended goal.
- the term "unit dose” or “dosage” refers to physically discrete units suitable for use in a subject, each unit containing a predetermined quantity of the composition calculated to produce the desired responses discussed herein in association with its administration, i.e., the appropriate route and regimen.
- the quantity to be administered depends on the result and/or protection desired. Precise amounts of the composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting dose include physical and clinical state of the subject, route of administration, intended goal of treatment (alleviation of symptoms versus cure), and potency, stability, and toxicity of the particular composition.
- solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically or prophylactically effective.
- the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above.
- Anti-IL-6Ra scFv constructs inhibit IL-6 signaling
- This disclosure describes single-chain variable fragments (scFvs) that bind to IL-6Ra.
- scFvs single-chain variable fragments
- two different anti-IL-6Ra scFv constructs are used: a V H V L construct (SEQ ID NO:2) and a V L V H construct (SEQ ID NO: l). These constructs differ only in that the positions of the V H and V L sequences are switched.
- IL-6 is a cytokine that has pro-inflammatory effects.
- IL-6 signals through IL-6Ra, which is the ligand-binding component of IL-6's cell surface receptor.
- IL-6 signaling through IL-6Ra plays a role in a pro-inflammatory cytokine signaling processes, including in cytokine release syndrome.
- IL-6 also stimulates the inflammatory and auto-immune processes in many diseases, including diabetes, atherosclerosis, depression, Alzheimer's Disease, systemic lupus erythematosus, multiple myeloma, prostate cancer, Behcet's disease, and rheumatoid arthritis.
- Both of the anti-IL-6Ra scFvs are effective at inhibiting IL-6 signaling in HepG2 cells.
- HepG2 human hepatocarcinoma cells were seeded in a 12-well plate and incubated with 1, 2, or 5 ⁇ g of scFv for 3 hours. Some of the wells, as indicated in FIG. 1, were subsequently treated with 4 ng/ml of IL-6 and incubated for another 30 minutes before cell harvest. The presence of phosphorylated STAT3 (pSTAT3), a major signaling molecule in the IL-6 signaling pathway, was probed by western blot. The results in FIG.
- V L -V H scFv (SEQ ID NO: l) was added to the wells in the concentrations indicated in FIG. 2, along with IL-6 in the indicated wells.
- the presence of pSTAT3 was once again probed by western blot.
- the results in FIG. 2 indicate that the anti-IL-6Roc scFv inhibits IL-6 signaling in a dose-dependent manner in both CD4+ and CD8+ primary human T cells.
- Cells were sorted by magnetic cell separation based on the HA-tag on anti-CD 19 CAR.
- primary T cells were expanded by a Rapid Expansion Protocol, in which 0.5 x 10 6 of T cells are mixed with 3.5 x 10 6 irradiated TM-LCL, 50 U/ml rhIL-2 and 1 ng/ml rhIL-15 in 25 ml of complete RPMI media in a T25 flask. Cytokines are replenished every 2 days. Cells are used for experiments after day 9 of the REP. [0202] The inventors tested the effect of expressing the anti-IL-6Roc scFv in T cells.
- CD4+ T cells expressing the anti-CD 19 chimeric antigen receptor (CAR) with or without constitutive expression of the anti-IL-6Roc scFv were co-incubated with peripheral blood mononuclear cells (PBMCs) from the same donor as the CD4+ T cells plus wild-type (CD19+) Raji lymphoma cells at a 1: 1: 1 ratio for 12 hours.
- PBMCs peripheral blood mononuclear cells
- Non-scFv-expressing CD 19 CAR-T cells with 90 g/ml of the monoclonal antibody tocilizumab were included as control samples.
- Levels of the cytokines in culture media as indicated in FIG. 3 were quantified by a cytometric bead-based assay. Values shown in FIG.
- WT wild-type
- E:T effector-to-target
- T cells in the experiment described in the preceding paragraph were surface- stained with antibody for CCR7, CD45RA, and CD57 to determine the T-cell subtype.
- Subtype TE/EM CCR7-/CD45RA-/CD57-; subtype ⁇ /Exh: CCR7-/CD45RA-/CD57+; subtype TEMRA: CCR7-/CD45RA+; subtype T cm : CCR7+/CD45RA-; subtype T n aiv e : CCR7+/CD45RA+.
- FIGS. 5 and 7 are the means of three technical replicates with error bars indicating ⁇ 1 standard deviation.
- the results shown in FIG. 5 are representative of four independent experiments using cells from two different healthy blood donors, and the results in FIG. 7 are representative of four independent experiments using cells from three different healthy blood donors.
- FIGS. 5 and 7 there were very few TEMRA or Tnaive cells in any of the samples.
- the results in FIGS. 5-7 show that constitutive expression of anti-IL-6Roc scFv does not alter T cell subtype differentiation upon antigen stimulation, further confirming that the efficacy of adoptive T cell therapy would not be diminished by using T cells that express an anti-IL-6Roc scFv.
- T cell exhaustion is a state of T cell dysfunction characterized by poor effector function, expression of inhibitory receptors, and a distinct transcriptional state. Exhaustion can limit the efficacy of T cells used in adoptive T cell therapy. Markers of exhaustion include PD-1, TIM-3, and LAG-3.
- Markers of exhaustion include PD-1, TIM-3, and LAG-3.
- primary human T cells constitutively expressing the anti-CD 19 CAR with or without anti-IL-6Roc scFv were co-incubated with WT Raji cells at a 2: 1 E:T ratio. PD-1, TIM-3, and LAG-3 expression levels were quantified by surface antibody staining and flow cytometry every two days.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Cell Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Virology (AREA)
- Biomedical Technology (AREA)
- Developmental Biology & Embryology (AREA)
- Hematology (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201780067444.9A CN109963590B (zh) | 2016-09-02 | 2017-09-01 | 涉及白介素-6受体α结合单链可变片段的方法和组合物 |
| CA3039136A CA3039136A1 (en) | 2016-09-02 | 2017-09-01 | Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments |
| KR1020197009353A KR20190057308A (ko) | 2016-09-02 | 2017-09-01 | 인터류킨-6 수용체 알파-결합 단일 사슬 가변 단편을 포함하는 방법 및 조성물 |
| JP2019512186A JP2019530440A (ja) | 2016-09-02 | 2017-09-01 | インターロイキン6受容体α結合単鎖可変断片を含む方法および組成物 |
| US16/329,367 US11701384B2 (en) | 2016-09-02 | 2017-09-01 | Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments |
| EP17845645.5A EP3506943B1 (en) | 2016-09-02 | 2017-09-01 | Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments |
| AU2017319702A AU2017319702B2 (en) | 2016-09-02 | 2017-09-01 | Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments |
| US18/322,281 US20230372400A1 (en) | 2016-09-02 | 2023-05-23 | Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662383237P | 2016-09-02 | 2016-09-02 | |
| US62/383,237 | 2016-09-02 | ||
| US201662440991P | 2016-12-30 | 2016-12-30 | |
| US62/440,991 | 2016-12-30 | ||
| US201762443509P | 2017-01-06 | 2017-01-06 | |
| US62/443,509 | 2017-01-06 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/329,367 A-371-Of-International US11701384B2 (en) | 2016-09-02 | 2017-09-01 | Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments |
| US18/322,281 Division US20230372400A1 (en) | 2016-09-02 | 2023-05-23 | Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2018042385A2 true WO2018042385A2 (en) | 2018-03-08 |
| WO2018042385A3 WO2018042385A3 (en) | 2018-04-19 |
Family
ID=61300216
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2017/055281 Ceased WO2018042385A2 (en) | 2016-09-02 | 2017-09-01 | Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments |
Country Status (8)
| Country | Link |
|---|---|
| US (2) | US11701384B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3506943B1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2019530440A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20190057308A (cg-RX-API-DMAC7.html) |
| CN (1) | CN109963590B (cg-RX-API-DMAC7.html) |
| AU (1) | AU2017319702B2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3039136A1 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2018042385A2 (cg-RX-API-DMAC7.html) |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3550020A4 (en) * | 2016-12-05 | 2019-12-04 | Shanghai Unicar-therapy Bio-Medicine Technology Co., Ltd | IL-6R-KNOCKOUT-CAR-T TRANSGENIC VECTOR FOR THE PREVENTION OF CRS, METHOD OF MANUFACTURING THEREOF AND APPLICATION THEREOF |
| WO2020146239A1 (en) * | 2019-01-07 | 2020-07-16 | Celledit Llc | Modified immune cells co-expressing chimeric antigen receptor and il-6 antagonist for reducing toxicity and uses thereof in adoptive cell therapy |
| WO2021007260A3 (en) * | 2019-07-08 | 2021-03-04 | Research Institute At Nationwide Children's Hospital | Antibody compositions for disrupting biofilms |
| JP2021518111A (ja) * | 2018-03-14 | 2021-08-02 | シアトル チルドレンズ ホスピタル (ディービーエイ シアトル チルドレンズ リサーチ インスティテュート) | ゼータカインにより指向性を付与したIL−13受容体α2標的T細胞免疫療法 |
| US11274144B2 (en) | 2013-06-13 | 2022-03-15 | Research Institute At Nationwide Children's Hospital | Compositions and methods for the removal of biofilms |
| US11564982B2 (en) | 2017-01-04 | 2023-01-31 | Research Institute At Nationwide Children's Hospital | DNABII vaccines and antibodies with enhanced activity |
| WO2023250400A1 (en) * | 2022-06-22 | 2023-12-28 | Juno Therapeutics, Inc. | Treatment methods for second line therapy of cd19-targeted car t cells |
| US11965176B2 (en) | 2018-03-14 | 2024-04-23 | Hunan Siweikang Therapeutics Co. Ltd | Modification of immune cells for reducing toxicity and uses thereof in adoptive cell therapy |
| US12098188B2 (en) | 2017-01-04 | 2024-09-24 | Research Institute At Nationwide Children's Hospital | Antibody fragments for the treatment of biofilm-related disorders |
| US12239763B2 (en) | 2015-07-31 | 2025-03-04 | Research Institute At Nationwide Children's Hospital | Peptides and antibodies for the removal of biofilms |
| US12365710B2 (en) | 2018-10-05 | 2025-07-22 | Research Institute At Nationwide Children's Hospital | HMGB1 protein derivatives for the removal of biofilms |
| RU2851685C2 (ru) * | 2019-07-08 | 2025-11-27 | Рисёрч Институт Эт Нейшнуайд Чилдрен'З Хоспитал | Композиции антител для разрушения биопленок |
| US12583904B2 (en) | 2017-06-02 | 2026-03-24 | Juno Therapeutics, Inc. | Articles of manufacture and methods for treatment using adoptive cell therapy |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3234120B1 (en) | 2014-12-15 | 2025-09-03 | The Regents of the University of California | Cytotoxic molecules responsive to intracellular ligands for selective t cell mediated killing |
| FI3240805T3 (fi) | 2014-12-15 | 2025-02-17 | Univ California | Cd19- ja cd20-vasteellinen bispesifinen tai-veräjän kimeerinen antigeenireseptori |
| GB2599814A (en) | 2019-05-31 | 2022-04-13 | Univ Johns Hopkins | Bispecific binding agents |
| US20220251222A1 (en) * | 2019-05-31 | 2022-08-11 | The Johns Hopkins University | IL-6Ralpha/IL-8R BISPECIFIC BINDING AGENTS FOR INHIBITING CANCER CELL MIGRATION |
| CN113368086B (zh) * | 2021-08-11 | 2021-12-03 | 龙麻(上海)医药研发有限责任公司 | 一种大麻素组合物及其在制备治疗帕金森、阿尔茨海默等神经退行性疾病的药物中的应用 |
Citations (40)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4684611A (en) | 1982-02-11 | 1987-08-04 | Rijksuniversiteit Leiden | Process for the in-vitro transformation of plant protoplasts with plasmid DNA |
| EP0322094A1 (en) | 1987-10-30 | 1989-06-28 | Delta Biotechnology Limited | N-terminal fragments of human serum albumin |
| US4879236A (en) | 1984-05-16 | 1989-11-07 | The Texas A&M University System | Method for producing a recombinant baculovirus expression vector |
| US4952500A (en) | 1988-02-01 | 1990-08-28 | University Of Georgia Research Foundation, Inc. | Cloning systems for Rhodococcus and related bacteria |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| EP0486525A1 (en) | 1989-08-01 | 1992-05-27 | Cemu Bioteknik Ab | STABILIZED PROTEIN OR PEPTIDE CONJUGATES. |
| WO1992019759A1 (fr) | 1991-04-25 | 1992-11-12 | Chugai Seiyaku Kabushiki Kaisha | Anticorps humains reconstitues diriges contre un recepteur de l'interleukine 6 humaine |
| US5302523A (en) | 1989-06-21 | 1994-04-12 | Zeneca Limited | Transformation of plant cells |
| WO1994009699A1 (en) | 1992-10-30 | 1994-05-11 | British Technology Group Limited | Investigation of a body |
| US5322783A (en) | 1989-10-17 | 1994-06-21 | Pioneer Hi-Bred International, Inc. | Soybean transformation by microparticle bombardment |
| US5384253A (en) | 1990-12-28 | 1995-01-24 | Dekalb Genetics Corporation | Genetic transformation of maize cells by electroporation of cells pretreated with pectin degrading enzymes |
| WO1995006128A2 (en) | 1993-08-25 | 1995-03-02 | Dekalb Genetics Corporation | Fertile, transgenic maize plants and methods for their production |
| US5538880A (en) | 1990-01-22 | 1996-07-23 | Dekalb Genetics Corporation | Method for preparing fertile transgenic corn plants |
| US5543293A (en) | 1990-06-11 | 1996-08-06 | Nexstar Pharmaceuticals, Inc. | DNA ligands of thrombin |
| US5550318A (en) | 1990-04-17 | 1996-08-27 | Dekalb Genetics Corporation | Methods and compositions for the production of stably transformed, fertile monocot plants and cells thereof |
| US5563055A (en) | 1992-07-27 | 1996-10-08 | Pioneer Hi-Bred International, Inc. | Method of Agrobacterium-mediated transformation of cultured soybean cells |
| US5580737A (en) | 1990-06-11 | 1996-12-03 | Nexstar Pharmaceuticals, Inc. | High-affinity nucleic acid ligands that discriminate between theophylline and caffeine |
| US5580859A (en) | 1989-03-21 | 1996-12-03 | Vical Incorporated | Delivery of exogenous DNA sequences in a mammal |
| US5591616A (en) | 1992-07-07 | 1997-01-07 | Japan Tobacco, Inc. | Method for transforming monocotyledons |
| US5610042A (en) | 1991-10-07 | 1997-03-11 | Ciba-Geigy Corporation | Methods for stable transformation of wheat |
| US5631146A (en) | 1995-01-19 | 1997-05-20 | The General Hospital Corporation | DNA aptamers and catalysts that bind adenosine or adenosine-5'-phosphates and methods for isolation thereof |
| US5656610A (en) | 1994-06-21 | 1997-08-12 | University Of Southern California | Producing a protein in a mammal by injection of a DNA-sequence into the tongue |
| US5670373A (en) | 1988-01-22 | 1997-09-23 | Kishimoto; Tadamitsu | Antibody to human interleukin-6 receptor |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| US5702932A (en) | 1992-07-20 | 1997-12-30 | University Of Florida | Microinjection methods to transform arthropods with exogenous DNA |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| US5736524A (en) | 1994-11-14 | 1998-04-07 | Merck & Co.,. Inc. | Polynucleotide tuberculosis vaccine |
| US5780448A (en) | 1995-11-07 | 1998-07-14 | Ottawa Civic Hospital Loeb Research | DNA-based vaccination of fish |
| US5786462A (en) | 1990-06-11 | 1998-07-28 | Nexstar Pharmaceuticals, Inc. | High affinity ssDNA ligands of HIV-1 reverse transcriptase |
| US5789215A (en) | 1991-08-20 | 1998-08-04 | Genpharm International | Gene targeting in animal cells using isogenic DNA constructs |
| US5871986A (en) | 1994-09-23 | 1999-02-16 | The General Hospital Corporation | Use of a baculovirus to express and exogenous gene in a mammalian cell |
| US5945100A (en) | 1996-07-31 | 1999-08-31 | Fbp Corporation | Tumor delivery vehicles |
| US5981274A (en) | 1996-09-18 | 1999-11-09 | Tyrrell; D. Lorne J. | Recombinant hepatitis virus vectors |
| US5994624A (en) | 1997-10-20 | 1999-11-30 | Cotton Incorporated | In planta method for the production of transgenic plants |
| US20050106660A1 (en) | 2001-09-27 | 2005-05-19 | Martin Vogt | Muteins of apolipoprotein d |
| US20060058510A1 (en) | 1997-09-26 | 2006-03-16 | Arne Skerra | Anticalins |
| US20060088908A1 (en) | 2001-09-27 | 2006-04-27 | Arne Skerra | Mutiens of human neutrophil gelatinase-associated lipocalin and related proteins |
| WO2006056464A2 (en) | 2004-11-26 | 2006-06-01 | Pieris Ag | Compound with affinity for the cytotoxic t lymphocyte-associated antigen (ctla-4) |
| US8580264B2 (en) | 2010-11-08 | 2013-11-12 | Genentech, Inc. | Subcutaneously administered anti-IL-6 receptor antibody |
Family Cites Families (48)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4797368A (en) | 1985-03-15 | 1989-01-10 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus as eukaryotic expression vector |
| US5139941A (en) | 1985-10-31 | 1992-08-18 | University Of Florida Research Foundation, Inc. | AAV transduction vectors |
| EP0939121B2 (de) | 1989-09-12 | 2007-12-26 | AHP Manufacturing B.V. | TFN-bindende Proteine |
| US6319494B1 (en) | 1990-12-14 | 2001-11-20 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| EP1400536A1 (en) | 1991-06-14 | 2004-03-24 | Genentech Inc. | Method for making humanized antibodies |
| US5138941A (en) | 1991-06-28 | 1992-08-18 | Strauss Frederick J | Wooden crusher for recyclable metal cans |
| IL104570A0 (en) | 1992-03-18 | 1993-05-13 | Yeda Res & Dev | Chimeric genes and cells transformed therewith |
| WO1994012520A1 (en) * | 1992-11-20 | 1994-06-09 | Enzon, Inc. | Linker for linked fusion polypeptides |
| JP2002510968A (ja) * | 1997-05-07 | 2002-04-09 | ブリストル−マイヤーズ スクイブ カンパニー | 組換え抗体−酵素融合タンパク質 |
| JP2002516061A (ja) | 1997-10-14 | 2002-06-04 | ダーウィン モレキュラー コーポレイション | チミジンキナーゼ変異体ならびにチミジンキナーゼ活性およびグアニル酸キナーゼ活性を有する融合タンパク質 |
| US6492497B1 (en) | 1999-04-30 | 2002-12-10 | Cambridge Antibody Technology Limited | Specific binding members for TGFbeta1 |
| US7066469B2 (en) | 2002-08-06 | 2006-06-27 | University of Kentucky Research Foundation Board of Supervisors of Louisiana State University | Seal assembly for machinery housing |
| US20040043949A1 (en) | 2002-08-30 | 2004-03-04 | Christopher Richardson | Therapeutic system targeting pathogen proteases and uses thereof |
| UA80296C2 (en) | 2002-09-06 | 2007-09-10 | Biogen Inc | Imidazolopyridines and methods of making and using the same |
| WO2004085611A2 (en) | 2003-03-21 | 2004-10-07 | The Research Foundation Of State University Of New York | Model for mutually exclusive domain folding molecular switch |
| BRPI0413197A (pt) | 2003-08-01 | 2006-10-03 | Amgen Inc | cristal de eta wercept; método para fabricar um cristal de etanercept; composição; uso de um cristal de etanercept |
| US7435596B2 (en) | 2004-11-04 | 2008-10-14 | St. Jude Children's Research Hospital, Inc. | Modified cell line and method for expansion of NK cell |
| EP1740615B1 (en) | 2004-03-31 | 2014-11-05 | Genentech, Inc. | Humanized anti-tgf-beta antibodies |
| WO2006046661A1 (ja) * | 2004-10-28 | 2006-05-04 | Osaka University | インターロイキン-6阻害剤 |
| TR201901929T4 (tr) | 2005-02-08 | 2019-03-21 | Genzyme Corp | TGFBeta'ya antikorlar. |
| US20090068158A1 (en) | 2005-12-09 | 2009-03-12 | Medin Jeffrey A | Thymidylate kinase mutants and uses thereof |
| CN101330914A (zh) | 2005-12-16 | 2008-12-24 | 爱尔康公司 | 使用alk5调节剂控制眼内压 |
| TWI440469B (zh) | 2008-09-26 | 2014-06-11 | Chugai Pharmaceutical Co Ltd | Improved antibody molecules |
| CA2764729C (en) | 2009-06-26 | 2019-04-02 | Sea Lane Biotechnologies, Llc | Expression of surrogate light chains |
| EP2566954B2 (en) * | 2010-05-04 | 2022-11-02 | Yeda Research and Development Co. Ltd. | Immunotherapy using redirected allogeneic cells |
| US9089520B2 (en) | 2010-05-21 | 2015-07-28 | Baylor College Of Medicine | Methods for inducing selective apoptosis |
| PH12013501201A1 (en) | 2010-12-09 | 2013-07-29 | Univ Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
| US20130071414A1 (en) | 2011-04-27 | 2013-03-21 | Gianpietro Dotti | Engineered cd19-specific t lymphocytes that coexpress il-15 and an inducible caspase-9 based suicide gene for the treatment of b-cell malignancies |
| CA2861491C (en) | 2012-02-13 | 2020-08-25 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | Bispecific chimeric antigen receptors and therapeutic uses thereof |
| US20130280220A1 (en) | 2012-04-20 | 2013-10-24 | Nabil Ahmed | Chimeric antigen receptor for bispecific activation and targeting of t lymphocytes |
| DK3456734T3 (da) | 2012-10-04 | 2022-04-19 | Res Found Dev | Serinproteasemolekyler og behandlinger |
| EP2730289A1 (en) | 2012-11-07 | 2014-05-14 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Novel immunoproteases |
| MX361088B (es) | 2012-11-21 | 2018-11-26 | Janssen Biotech Inc | Anticuerpos del receptor del factor de crecimiento epidérmico aislado/del receptor del factor de crecimiento de hepatocitos (egfr/c-met) biespecíficos. |
| LT2971048T (lt) | 2013-03-11 | 2019-02-25 | Genzyme Corporation | Inžineriniu būdu gauti anti-tgf-beta antikūnai ir antigeną surišantys fragmentai |
| CN113307880B (zh) | 2014-01-13 | 2025-07-04 | 希望之城公司 | 在Fc间隔物区中具有突变的嵌合抗原受体(CAR)及其使用方法 |
| WO2015121454A1 (en) | 2014-02-14 | 2015-08-20 | Cellectis | Cells for immunotherapy engineered for targeting antigen present both on immune cells and pathological cells |
| CA2939411A1 (en) | 2014-02-27 | 2015-09-03 | Ucl Business Plc | Ligand |
| US20170333480A1 (en) | 2014-11-05 | 2017-11-23 | Board Of Regents, The University Of Texas System | Gene modified immune effector cells and engineered cells for expansion of immune effector cells |
| HRP20191873T1 (hr) | 2014-12-12 | 2020-01-24 | Bluebird Bio, Inc. | Kimerni antigenski receptori |
| EP3256492A4 (en) | 2015-02-09 | 2018-07-11 | University of Florida Research Foundation, Inc. | Bi-specific chimeric antigen receptor and uses thereof |
| PL3368571T3 (pl) | 2015-10-30 | 2023-05-02 | The Regents Of The University Of California | Polipeptydy odpowiadające na transformujący czynnik wzrostu beta i sposoby ich zastosowania |
| EP4212547A1 (en) | 2015-12-03 | 2023-07-19 | Juno Therapeutics, Inc. | Modified chimeric receptors and related compositions and methods |
| KR20230148844A (ko) | 2016-03-29 | 2023-10-25 | 유니버시티 오브 써던 캘리포니아 | 암을 표적하는 키메라 항원 수용체 |
| CN105837693A (zh) | 2016-05-30 | 2016-08-10 | 李斯文 | 一种基于bcma的抗原嵌合受体及其制备方法和应用 |
| CN109562126A (zh) | 2016-06-24 | 2019-04-02 | 美商生物细胞基因治疗有限公司 | 嵌合抗原受体(car)、组合物及其使用方法 |
| EP3548055A4 (en) | 2016-12-02 | 2020-08-19 | University of Southern California | SYNTHETIC IMMUNE RECEPTORS AND THEIR PROCESSES FOR USE |
| CN108148863B (zh) * | 2016-12-05 | 2019-12-17 | 上海优卡迪生物医药科技有限公司 | 一种封闭il6r的用于缓解crs的car-t转基因载体及其构建方法和应用 |
| CA3287539A1 (en) | 2017-06-21 | 2026-03-02 | Icell Gene Therapeutics Llc | CHIMERIC ANTIGEN RECEPTORS (CARs), COMPOSITIONS AND METHODS THEREOF |
-
2017
- 2017-09-01 AU AU2017319702A patent/AU2017319702B2/en not_active Ceased
- 2017-09-01 EP EP17845645.5A patent/EP3506943B1/en active Active
- 2017-09-01 WO PCT/IB2017/055281 patent/WO2018042385A2/en not_active Ceased
- 2017-09-01 KR KR1020197009353A patent/KR20190057308A/ko not_active Withdrawn
- 2017-09-01 CN CN201780067444.9A patent/CN109963590B/zh active Active
- 2017-09-01 CA CA3039136A patent/CA3039136A1/en active Pending
- 2017-09-01 US US16/329,367 patent/US11701384B2/en active Active
- 2017-09-01 JP JP2019512186A patent/JP2019530440A/ja not_active Withdrawn
-
2023
- 2023-05-23 US US18/322,281 patent/US20230372400A1/en active Pending
Patent Citations (46)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4684611A (en) | 1982-02-11 | 1987-08-04 | Rijksuniversiteit Leiden | Process for the in-vitro transformation of plant protoplasts with plasmid DNA |
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4879236A (en) | 1984-05-16 | 1989-11-07 | The Texas A&M University System | Method for producing a recombinant baculovirus expression vector |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| EP0322094A1 (en) | 1987-10-30 | 1989-06-28 | Delta Biotechnology Limited | N-terminal fragments of human serum albumin |
| US5670373A (en) | 1988-01-22 | 1997-09-23 | Kishimoto; Tadamitsu | Antibody to human interleukin-6 receptor |
| US4952500A (en) | 1988-02-01 | 1990-08-28 | University Of Georgia Research Foundation, Inc. | Cloning systems for Rhodococcus and related bacteria |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5589466A (en) | 1989-03-21 | 1996-12-31 | Vical Incorporated | Induction of a protective immune response in a mammal by injecting a DNA sequence |
| US5580859A (en) | 1989-03-21 | 1996-12-03 | Vical Incorporated | Delivery of exogenous DNA sequences in a mammal |
| US5464765A (en) | 1989-06-21 | 1995-11-07 | Zeneca Limited | Transformation of plant cells |
| US5302523A (en) | 1989-06-21 | 1994-04-12 | Zeneca Limited | Transformation of plant cells |
| EP0486525A1 (en) | 1989-08-01 | 1992-05-27 | Cemu Bioteknik Ab | STABILIZED PROTEIN OR PEPTIDE CONJUGATES. |
| US5322783A (en) | 1989-10-17 | 1994-06-21 | Pioneer Hi-Bred International, Inc. | Soybean transformation by microparticle bombardment |
| US5538880A (en) | 1990-01-22 | 1996-07-23 | Dekalb Genetics Corporation | Method for preparing fertile transgenic corn plants |
| US5538877A (en) | 1990-01-22 | 1996-07-23 | Dekalb Genetics Corporation | Method for preparing fertile transgenic corn plants |
| US5550318A (en) | 1990-04-17 | 1996-08-27 | Dekalb Genetics Corporation | Methods and compositions for the production of stably transformed, fertile monocot plants and cells thereof |
| US5543293A (en) | 1990-06-11 | 1996-08-06 | Nexstar Pharmaceuticals, Inc. | DNA ligands of thrombin |
| US5786462A (en) | 1990-06-11 | 1998-07-28 | Nexstar Pharmaceuticals, Inc. | High affinity ssDNA ligands of HIV-1 reverse transcriptase |
| US5580737A (en) | 1990-06-11 | 1996-12-03 | Nexstar Pharmaceuticals, Inc. | High-affinity nucleic acid ligands that discriminate between theophylline and caffeine |
| US5384253A (en) | 1990-12-28 | 1995-01-24 | Dekalb Genetics Corporation | Genetic transformation of maize cells by electroporation of cells pretreated with pectin degrading enzymes |
| US7479543B2 (en) | 1991-04-25 | 2009-01-20 | Chugai Seiyaku Kabushiki Kaisha | Reshaped human antibody to human interleukin-6 receptor |
| WO1992019759A1 (fr) | 1991-04-25 | 1992-11-12 | Chugai Seiyaku Kabushiki Kaisha | Anticorps humains reconstitues diriges contre un recepteur de l'interleukine 6 humaine |
| US5789215A (en) | 1991-08-20 | 1998-08-04 | Genpharm International | Gene targeting in animal cells using isogenic DNA constructs |
| US5610042A (en) | 1991-10-07 | 1997-03-11 | Ciba-Geigy Corporation | Methods for stable transformation of wheat |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
| US5591616A (en) | 1992-07-07 | 1997-01-07 | Japan Tobacco, Inc. | Method for transforming monocotyledons |
| US5702932A (en) | 1992-07-20 | 1997-12-30 | University Of Florida | Microinjection methods to transform arthropods with exogenous DNA |
| US5563055A (en) | 1992-07-27 | 1996-10-08 | Pioneer Hi-Bred International, Inc. | Method of Agrobacterium-mediated transformation of cultured soybean cells |
| WO1994009699A1 (en) | 1992-10-30 | 1994-05-11 | British Technology Group Limited | Investigation of a body |
| WO1995006128A2 (en) | 1993-08-25 | 1995-03-02 | Dekalb Genetics Corporation | Fertile, transgenic maize plants and methods for their production |
| US5656610A (en) | 1994-06-21 | 1997-08-12 | University Of Southern California | Producing a protein in a mammal by injection of a DNA-sequence into the tongue |
| US5871986A (en) | 1994-09-23 | 1999-02-16 | The General Hospital Corporation | Use of a baculovirus to express and exogenous gene in a mammalian cell |
| US5736524A (en) | 1994-11-14 | 1998-04-07 | Merck & Co.,. Inc. | Polynucleotide tuberculosis vaccine |
| US5631146A (en) | 1995-01-19 | 1997-05-20 | The General Hospital Corporation | DNA aptamers and catalysts that bind adenosine or adenosine-5'-phosphates and methods for isolation thereof |
| US5780448A (en) | 1995-11-07 | 1998-07-14 | Ottawa Civic Hospital Loeb Research | DNA-based vaccination of fish |
| US5945100A (en) | 1996-07-31 | 1999-08-31 | Fbp Corporation | Tumor delivery vehicles |
| US5981274A (en) | 1996-09-18 | 1999-11-09 | Tyrrell; D. Lorne J. | Recombinant hepatitis virus vectors |
| US20060058510A1 (en) | 1997-09-26 | 2006-03-16 | Arne Skerra | Anticalins |
| US20100285564A1 (en) | 1997-09-26 | 2010-11-11 | Pieris Ag | Anticalins |
| US5994624A (en) | 1997-10-20 | 1999-11-30 | Cotton Incorporated | In planta method for the production of transgenic plants |
| US20050106660A1 (en) | 2001-09-27 | 2005-05-19 | Martin Vogt | Muteins of apolipoprotein d |
| US20060088908A1 (en) | 2001-09-27 | 2006-04-27 | Arne Skerra | Mutiens of human neutrophil gelatinase-associated lipocalin and related proteins |
| WO2006056464A2 (en) | 2004-11-26 | 2006-06-01 | Pieris Ag | Compound with affinity for the cytotoxic t lymphocyte-associated antigen (ctla-4) |
| US8580264B2 (en) | 2010-11-08 | 2013-11-12 | Genentech, Inc. | Subcutaneously administered anti-IL-6 receptor antibody |
Non-Patent Citations (40)
| Title |
|---|
| AHMAD, CLINICAL AND DEVELOPMENTAL IMMUNOLOGY ARTICLE ID 980250, 2012 |
| AHMAD, CLINICAL AND DEVELOPMENTAL IMMUNOLOGY, 2012 |
| BURTON, MOLEC. IMMUNOL., vol. 22, 1985, pages 161 - 206 |
| CARBONELLI ET AL., FEMS MICROBIOL. LETT., vol. 177, no. 1, 1999, pages 75 - 82 |
| CHANDLER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, no. 8, 1997, pages 3596 - 601 |
| CHENOKAYAMA, MOL. CELL BIOL., vol. 7, no. 8, 1987, pages 2745 - 2752 |
| COCEA, BIOTECHNIQUES, vol. 23, no. 5, 1997, pages 814 - 816 |
| CUMBER ET AL., J. IMMUNOLOGY, vol. 149B, 1992, pages 120 - 126 |
| FECHHEIMER ET AL., PROC NATL. ACAD. SCI. USA, vol. 84, 1987, pages 8463 - 8467 |
| FRALEY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 76, 1979, pages 3348 - 3352 |
| GOPAL, MOL. CELL BIOL., vol. 5, 1985, pages 1188 - 1190 |
| GRAHAMVAN DER EB, VIROLOGY, vol. 52, 1973, pages 456 - 467 |
| HARLANDWEINTRAUB, J. CELL BIOL., vol. 101, no. 3, 1985, pages 1094 - 1099 |
| HARLOWAUSUBEL ET AL.: "Antibodies: A Laboratory Manual", 1996, COLD SPRING HARBOR LABORATORY |
| HUCK ET AL., NUCL. ACIDS RES., 1986 |
| JAINA M. PATEL ET AL., IMMUNOTHERAPY, vol. 6, no. 6, 2014, pages 675 - 678 |
| KAEPPLER ET AL., PLANT CELL REP., vol. 8, 1990, pages 415 - 418 |
| KANEDA ET AL., SCIENCE, vol. 243, 1989, pages 375 - 378 |
| KATO ET AL., J. BIOL. CHEM., vol. 266, 1991, pages 3361 - 3364 |
| KOHL ET AL., PROC. NATL. ACAD. SCI., USA, vol. 100, no. 4, 2003, pages 1700 - 1705 |
| KOYAMA, CHEM., vol. 120, 1994, pages 217262 |
| LEVENSON ET AL., HUM. GENE THER., vol. 9, no. 8, 1998, pages 1233 - 1236 |
| LIU ET AL., CELL MOL. BIOL., vol. 49, no. 2, 2003, pages 209 - 216 |
| LIU ET AL.: "antibody like binding peptidomimetics", ABIPS, 2003 |
| MEARES ET AL., ANAL. BIOCHEM., vol. 142, 1984, pages 68 - 78 |
| NICOLAU ET AL., METHODS ENZYMOL., vol. 149, 1987, pages 157 - 176 |
| NICOLAUSENE, BIOCHIM. BIOPHYS. ACTA, vol. 721, 1982, pages 185 - 190 |
| OMIRULLEH ET AL., PLANT MOL. BIOL., vol. 21, no. 3, 1993, pages 415 - 28 |
| PACK ET AL., BIOCHEM., vol. 31, 1992, pages 1579 - 1584 |
| PACK ET AL., THE OLIGOMERIZATION DOMAIN COMPRISES SELF-ASSOCIATING A-HELICES, 1992 |
| POTRYKUS ET AL., MOL. GEN. GENET., vol. 199, no. 2, 1985, pages 169 - 177 |
| QUADRI ET AL., NUCL. MED. BIOL., vol. 20, 1993, pages 559 - 570 |
| RIPPE ET AL., MOL. CELL BIOL., vol. 10, 1990, pages 689 - 695 |
| RODWELL ET AL., PNAS USA, vol. 83, 1986, pages 2632 - 2636 |
| SHANNON L. MAUDE ET AL., NIH PUBLIC ACCESS AUTHOR MANUSCRIPT, 2014, pages 1 - 9 |
| SKERRA, J. BIOTECHNOL., vol. 74, no. 4, 2001, pages 257 - 75 |
| SKERRA, J. MOL. RECOGN., vol. 13, 2000, pages 167 - 187 |
| TAN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 162 |
| TAN: "87", PROC. NATL. ACAD. SCI. USA, 1990, pages 162 |
| WONG ET AL., GENE, vol. 10, 1980, pages 87 - 94 |
Cited By (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11274144B2 (en) | 2013-06-13 | 2022-03-15 | Research Institute At Nationwide Children's Hospital | Compositions and methods for the removal of biofilms |
| US12221472B2 (en) | 2013-06-13 | 2025-02-11 | Research Institute At Nationwide Children's Hospital | Compositions and methods for the removal of biofilms |
| US11629182B2 (en) | 2013-06-13 | 2023-04-18 | Research Institute Of Nationwide Children's Hospital | Compositions and methods for the removal of biofilms |
| US12239763B2 (en) | 2015-07-31 | 2025-03-04 | Research Institute At Nationwide Children's Hospital | Peptides and antibodies for the removal of biofilms |
| EP3550020A4 (en) * | 2016-12-05 | 2019-12-04 | Shanghai Unicar-therapy Bio-Medicine Technology Co., Ltd | IL-6R-KNOCKOUT-CAR-T TRANSGENIC VECTOR FOR THE PREVENTION OF CRS, METHOD OF MANUFACTURING THEREOF AND APPLICATION THEREOF |
| US12098188B2 (en) | 2017-01-04 | 2024-09-24 | Research Institute At Nationwide Children's Hospital | Antibody fragments for the treatment of biofilm-related disorders |
| US11564982B2 (en) | 2017-01-04 | 2023-01-31 | Research Institute At Nationwide Children's Hospital | DNABII vaccines and antibodies with enhanced activity |
| US12419944B2 (en) | 2017-01-04 | 2025-09-23 | Research Institute At Nationwide Children's Hospital | DNABII vaccines and antibodies with enhanced activity |
| US12583904B2 (en) | 2017-06-02 | 2026-03-24 | Juno Therapeutics, Inc. | Articles of manufacture and methods for treatment using adoptive cell therapy |
| JP7314161B2 (ja) | 2018-03-14 | 2023-07-25 | シアトル チルドレンズ ホスピタル (ディービーエイ シアトル チルドレンズ リサーチ インスティテュート) | ゼータカインにより指向性を付与したIL-13受容体α2標的T細胞免疫療法 |
| US11965176B2 (en) | 2018-03-14 | 2024-04-23 | Hunan Siweikang Therapeutics Co. Ltd | Modification of immune cells for reducing toxicity and uses thereof in adoptive cell therapy |
| JP2023134631A (ja) * | 2018-03-14 | 2023-09-27 | シアトル チルドレンズ ホスピタル (ディービーエイ シアトル チルドレンズ リサーチ インスティテュート) | ゼータカインにより指向性を付与したIL-13受容体α2標的T細胞免疫療法 |
| JP7696958B2 (ja) | 2018-03-14 | 2025-06-23 | シアトル チルドレンズ ホスピタル ディー/ビー/エイ シアトル チルドレンズ リサーチ インスティテュート | ゼータカインにより指向性を付与したIL-13受容体α2標的T細胞免疫療法 |
| JP2021518111A (ja) * | 2018-03-14 | 2021-08-02 | シアトル チルドレンズ ホスピタル (ディービーエイ シアトル チルドレンズ リサーチ インスティテュート) | ゼータカインにより指向性を付与したIL−13受容体α2標的T細胞免疫療法 |
| US12365710B2 (en) | 2018-10-05 | 2025-07-22 | Research Institute At Nationwide Children's Hospital | HMGB1 protein derivatives for the removal of biofilms |
| WO2020146239A1 (en) * | 2019-01-07 | 2020-07-16 | Celledit Llc | Modified immune cells co-expressing chimeric antigen receptor and il-6 antagonist for reducing toxicity and uses thereof in adoptive cell therapy |
| US12209118B2 (en) | 2019-07-08 | 2025-01-28 | Research Institute At Nationwide Children's Hospital | Antibody compositions for disrupting biofilms |
| US11104723B2 (en) | 2019-07-08 | 2021-08-31 | Research Institute At Nationwide Children's Hospital | Antibody compositions for disrupting biofilms |
| WO2021007260A3 (en) * | 2019-07-08 | 2021-03-04 | Research Institute At Nationwide Children's Hospital | Antibody compositions for disrupting biofilms |
| RU2851685C2 (ru) * | 2019-07-08 | 2025-11-27 | Рисёрч Институт Эт Нейшнуайд Чилдрен'З Хоспитал | Композиции антител для разрушения биопленок |
| WO2023250400A1 (en) * | 2022-06-22 | 2023-12-28 | Juno Therapeutics, Inc. | Treatment methods for second line therapy of cd19-targeted car t cells |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2017319702B2 (en) | 2024-11-14 |
| KR20190057308A (ko) | 2019-05-28 |
| JP2019530440A (ja) | 2019-10-24 |
| CA3039136A1 (en) | 2018-03-08 |
| US20230372400A1 (en) | 2023-11-23 |
| EP3506943B1 (en) | 2025-01-29 |
| EP3506943A4 (en) | 2020-04-22 |
| WO2018042385A3 (en) | 2018-04-19 |
| CN109963590B (zh) | 2024-03-15 |
| AU2017319702A1 (en) | 2019-04-11 |
| US11701384B2 (en) | 2023-07-18 |
| EP3506943A2 (en) | 2019-07-10 |
| CN109963590A (zh) | 2019-07-02 |
| US20200179448A1 (en) | 2020-06-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230372400A1 (en) | Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments | |
| US12590145B2 (en) | Bi-specific chimeric antigen receptor | |
| AU2016200435B2 (en) | Anti-ox40 antibodies and methods of using the same | |
| US9163085B2 (en) | Anti-OX40 antibodies and methods of treating cancer | |
| US20260070970A1 (en) | Methods and compositions involving chimeric binding polypeptides | |
| WO2020221873A1 (en) | Car t-cells targeting bcma and uses thereof | |
| US20240043534A1 (en) | Methods and compositions comprising modified fab scaffolds and protein g fab binding domains | |
| US20150004178A1 (en) | Anti-human sema4a antibodies useful to treat disease | |
| WO2025120015A1 (en) | Cd5 targeting antibodies with depleting and t or b-cell activation effects | |
| HK40091180A (zh) | 转化生长因子-β应答多肽及其使用方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17845645 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2019512186 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20197009353 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3039136 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2017845645 Country of ref document: EP Effective date: 20190402 |
|
| ENP | Entry into the national phase |
Ref document number: 2017319702 Country of ref document: AU Date of ref document: 20170901 Kind code of ref document: A |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17845645 Country of ref document: EP Kind code of ref document: A2 |