WO2018041985A1 - Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates - Google Patents

Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates Download PDF

Info

Publication number
WO2018041985A1
WO2018041985A1 PCT/EP2017/071937 EP2017071937W WO2018041985A1 WO 2018041985 A1 WO2018041985 A1 WO 2018041985A1 EP 2017071937 W EP2017071937 W EP 2017071937W WO 2018041985 A1 WO2018041985 A1 WO 2018041985A1
Authority
WO
WIPO (PCT)
Prior art keywords
alkyl
formula
compound
phenyl
mmol
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2017/071937
Other languages
English (en)
French (fr)
Inventor
Hackenberger CHRISTIAN
Marc André KASPER
Maria GLANZ
Tom SAUER
Dominik SCHUMACHER
Jonas HELMA-SMETS
Heinrich Leonhardt
Andreas STENGL
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Forschungsverbund Berlin FVB eV
Ludwig Maximilians Universitaet Muenchen LMU
Original Assignee
Forschungsverbund Berlin FVB eV
Ludwig Maximilians Universitaet Muenchen LMU
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN201780053946.6A priority Critical patent/CN109689112B/zh
Priority to AU2017320913A priority patent/AU2017320913B2/en
Priority to CN202311230447.3A priority patent/CN117903297A/zh
Priority to JP2019512835A priority patent/JP7217225B2/ja
Priority to CA3032251A priority patent/CA3032251C/en
Priority to US16/328,199 priority patent/US11161873B2/en
Priority to EP17772314.5A priority patent/EP3506949A1/en
Application filed by Forschungsverbund Berlin FVB eV, Ludwig Maximilians Universitaet Muenchen LMU filed Critical Forschungsverbund Berlin FVB eV
Publication of WO2018041985A1 publication Critical patent/WO2018041985A1/en
Anticipated expiration legal-status Critical
Priority to US17/460,791 priority patent/US11746124B2/en
Priority to JP2023007868A priority patent/JP2023055766A/ja
Priority to US18/349,727 priority patent/US12171837B2/en
Priority to US18/960,256 priority patent/US20250090672A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/07Tetrapeptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/549Sugars, nucleosides, nucleotides or nucleic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68031Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6855Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6889Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F9/00Compounds containing elements of Groups 5 or 15 of the Periodic Table
    • C07F9/02Phosphorus compounds
    • C07F9/28Phosphorus compounds with one or more P—C bonds
    • C07F9/38Phosphonic acids [RP(=O)(OH)2]; Thiophosphonic acids ; [RP(=X1)(X2H)2(X1, X2 are each independently O, S or Se)]
    • C07F9/44Amides thereof
    • C07F9/4461Amides thereof the amide moiety containing a substituent or a structure which is considered as characteristic
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F9/00Compounds containing elements of Groups 5 or 15 of the Periodic Table
    • C07F9/02Phosphorus compounds
    • C07F9/28Phosphorus compounds with one or more P—C bonds
    • C07F9/38Phosphonic acids [RP(=O)(OH)2]; Thiophosphonic acids ; [RP(=X1)(X2H)2(X1, X2 are each independently O, S or Se)]
    • C07F9/44Amides thereof
    • C07F9/4461Amides thereof the amide moiety containing a substituent or a structure which is considered as characteristic
    • C07F9/4473Amides thereof the amide moiety containing a substituent or a structure which is considered as characteristic of cycloaliphatic amines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F9/00Compounds containing elements of Groups 5 or 15 of the Periodic Table
    • C07F9/02Phosphorus compounds
    • C07F9/28Phosphorus compounds with one or more P—C bonds
    • C07F9/38Phosphonic acids [RP(=O)(OH)2]; Thiophosphonic acids ; [RP(=X1)(X2H)2(X1, X2 are each independently O, S or Se)]
    • C07F9/44Amides thereof
    • C07F9/4461Amides thereof the amide moiety containing a substituent or a structure which is considered as characteristic
    • C07F9/448Amides thereof the amide moiety containing a substituent or a structure which is considered as characteristic of aralkylamines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/107General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
    • C07K1/1072General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups
    • C07K1/1077General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups by covalent attachment of residues other than amino acids or peptide residues, e.g. sugars, polyols, fatty acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/82Translation products from oncogenes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/02Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing at least one abnormal peptide link
    • C07K5/0215Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing at least one abnormal peptide link containing natural amino acids, forming a peptide bond via their side chain functional group, e.g. epsilon-Lys, gamma-Glu

Definitions

  • azide- or alkyne-containing amino acids can be incorporated using auxotrophic expression systems (9), which can be modified using Staudinger ligations and Cu-catalyzed azide-alkyne cycloaddition (CuAAC) (10,1 1 ). While both of these aspects have seen significant advancements in recent years, a general and modular accessibility of highly reactive and complex functional modules for a metal-free chemoselective modification reaction remains often challenging. This is due to the requirement of additional protecting group manipulations in the synthesis of reactive bioorthogonal building blocks, which can be problematic in light of the high reactivity and lability of the employed bioorthogonal functions. For example, the synthesis of a highly reactive cyclooctyne-containing fluorescent peptide carrying a Xe-cryptophane for molecular imaging, required a sophisticated yet low yielding use of orthogonal protecting groups (12).
  • Halogen unless defined otherwise: elements of the 7 th main group, preferably fluorine, chlorine, bromine and iodine, more preferably fluorine, chlorine and bromine and, in combination with Mg even more preferably bromine.
  • alkyl unless defined otherwise elsewhere: saturated straight-chain or branched hydrocarbon radicals having preferably (C C 8 )-, (CrC 6 )- or (d-C 4 )-carbon atoms. Examples: methyl, ethyl, propyl, 1 -methylethyl, butyl, etc.
  • Alkenyl unless defined otherwise elsewhere: unsaturated straight-chain or branched hydrocarbon radicals having a double bond.
  • Alkenyl is preferably (C 2 - C 8 )-, (C 2 -C 6 )- or (C 2 - C 4 )-alkenyl. Examples: ethenyl, 1-propenyl, 3-butenyl, etc.
  • Alkynyl unless defined otherwise elsewhere: unsaturated straight-chain or branched hydrocarbon radicals having a triple bond.
  • Alkynyl is preferably (C 2 - C 8 )-, (C 2 -C 6 )- or (C 2 -C )- alkynyl. Examples: ethynyl, 1-propynyl, etc.
  • Alkoxy (alkyl radical -0-), unless defined otherwise elsewhere: an alkyl radical which is attached via an oxygen atom (-0-) to the basic structure.
  • Alkoxy is preferably (C C 8 )-, (C C 6 )- or (CrC 4 )-alkoxy. Examples: methoxy, ethoxy, propoxy, 1 -methylethoxy, etc.
  • alkenoxy and alkynoxy are alkenyl radicals and alkynyl radicals, respectively, which are attached via -O- to the basic structure.
  • Alkenoxy is preferably (C 2 - C 8 )-, (C 2 -C 6 )- or (C 2 -C 4 )-alkenoxy.
  • Alkynoxy is preferably (C 3 -Ci 0 )- , (C 3 -C 6 )- or (C 3 -C 4 )-alkynoxy.
  • the number of carbon atoms refers to the alkyl radical in the alkylcarbonyl group.
  • Alkenylcarbonyl is preferably (C 2 - C 8 )-, (C 2 -C 6 )- or (C 2 -C 4 )-alkenylcarbonyl.
  • Alkynylcarbonyl is preferably (C 2 - C 8 )-, (C 2 -C 6 )- or (C 2 -C 4 )-alkynylcarbonyl.
  • alkoxycarbonyl is preferably (C C 8 )-, (C C 6 )- or (C C 4 )-alkoxycarbonyl.
  • the number of carbon atoms refers to the alkyl radical in the alkoxycarbonyl group.
  • Alkenoxycarbonyl is preferably (C 2 - C 8 )-, (C 2 -C 6 )- or (C 2 -C 4 )- alkenoxycarbonyl.
  • Alkynoxycarbonyl is preferably (C 3 - C 8 )-, (C 3 -C 6 )- or (C 3 -C 4 )- alkynoxycarbonyl.
  • Alkenylcarbonyloxy is preferably (C 2 - C 8 )-, (C 2 -C 6 )- or (C 2 - C 4 )-alkenylcarbonyloxy.
  • Alkynylcarbonyloxy is preferably (C 2 -C 8 )-, (C 2 -C 6 )- or (C 2 -C )- alkynylcarbonyloxy.
  • alkylthio unless defined otherwise elsewhere: an alkyl radical which is attached via -S- to the basic structure, alkylthio is preferably (CrC 8 )-, (C ⁇ Ce)- or (CrC 4 )-alkylthio.
  • alkenylthio and alkynylthio are: alkenyl radicals and alkynyl radicals, respectively, which are attached via -S- to the basic structure.
  • Alkenylthio is preferably (C 2 -C 8 )-, (C 2 -C 6 )- or (C 2 -C 4 )-alkenylthio.
  • Alkynylthio is preferably (C 3 - C 8 )-, (C 3 -C 6 )- or (C 3 -C 4 )-alkynylthio.
  • substituted refers to a very broad substitution pattern. As can be seen from the disclosure of this invention, especially position
  • Ri , and ⁇ allow the substitution with numerous organic (macro)molecules. It is submitted that the structure of these molecules is not relevant for the presently disclosed process and the resulting conjugates. Thus, it would represent an undue limitation to limit the principle of this new and innovative concept to only some molecules. Nevertheless, it is submitted that the term refers to organic substituents or salts thereof, respectively, which may again be substituted several times by further organic substituents or salts thereof, respectively. Examples for such complex substituents were produced and are presented in this application (see, e.g. Schemes 5, 6, 7, 1 1 , 13, 15, 19, 20, 21 , 22, 23, and 24).
  • the term substituted refers to groups which are substituted with one or more substitutents selected from nitro, cyano, CI, F, CI, Br, -NH-R, NR 2 , COOH, -COOR, -OC(0)R -NH 2 , -OH, -CONH 2 CONHR, CON(R) 2 , -S-R, -SH, -C(0)H, -C(0)R, (C C 20 )-alkyl, (C C 20 )- alkoxy, (C 2 -C 20 )-allyl, (hetero)cyclic rings of 3 to 8 ring-members wherein, if present, the heteroatom or atoms are independently selected from N, O and S, (hetero)aromatic systems with 5 to 12 ring atoms (e.g., phenyl, pyridyl, naphtyl etc.), wherein R again can represent any of these substituents and the substitution can be repeated several times,
  • Peptides containing ten or fewer amino acids may be referred to as oligopeptides, while those with more than ten amino acid residues are polypeptides.
  • the amino acids can form at least one circle or a branched or unbranched chain or mixtures thereof.
  • Proteins and antibodies are peptides and, thus, encompassed by the term, but may be named separately, due to their importance.
  • amino acid refers to an organic compound having a -CH(NH 3 )- COOH group.
  • amino acid refers to a natural occurring amino acid arginine, lysine, aspartic acid, glutamic acid, glutamine, asparagine, histidine, serine, threonine, tyrosine, cysteine, methionine, tryptophan, alanine, isoleucine, leicine, phenylalanine, valine, proline and glycine.
  • the term in its broader meaning also encompasses non-natural occurring amino acids.
  • Amino acids and peptides according to the invention can also be modified at functional groups.
  • Non limiting examples are saccharides, e.g., N-Acetylgalactosamine (GalNAc), or protecting groups, e.g., Fluorenylmethoxycarbonyl (Fmoc)-modifications or esters.
  • protein refers to peptides which comprise one or more long chains of amino acid residues. Proteins perform a vast array of functions in vivo and in vitro including catalysing metabolic reactions, DNA replication, responding to stimuli, and transporting molecules, catalysing reactions. Proteins are folded into a specific three-dimensional structure. The residues in a protein are often chemically modified, e.g., by post-translational modification, which alters the physical and chemical properties, folding, stability, activity, and ultimately, the function of the proteins. Sometimes proteins have non-peptide groups attached, which can be called prosthetic groups or cofactors. Proteins, including enzymes and coenzymes, can also work together to achieve a particular function, and they often associate to form stable protein complexes. All these forms are encompassed by the term "protein".
  • protein tags refers to peptide sequences which can be attached to proteins or other thiol-comprising compounds via the linker according to the present invention for various purposes.
  • Non limiting examples for protein tags are affinity tags, solubilization tags, chromatography tags epitope tags and reporter enzymes.
  • Affinity tags are appended to proteins and other thiol-comprising compounds via the linker according to the present invention so that they can be, e.g., purified using an affinity technique.
  • affinity techniques include for example chitin binding protein (CBP), maltose binding protein (MBP), and glutathione-S-transferase (GST) or the poly(His) tag.
  • Solubilization tags can be used to assist in the proper folding in proteins and keep them from precipitating. These include thioredoxin (TRX) and poly(NANP). Some affinity tags have a dual role as a solubilization agent, such as MBP, and GST.
  • Chromatography tags are used to alter chromatographic properties of the protein to afford different resolution across a particular separation technique. Often, these consist of polyanionic amino acids, such as FLAG-tag.
  • Epitope tags are short peptide sequences which are chosen because high-affinity antibodies can be reliably produced in many different species. These are usually derived from viral genes. Epitope tags include V5-tag, Myc-tag, HA-tag and NE-tag. These tags are particularly useful for western blotting, immunofluorescence and immunoprecipitation experiments, and antibody purification.
  • reporter enzymes refer to any known enzyme which allows an increase of a signal in a biochemical detection.
  • colorant forming enzymes such as alkaline phosphatase (AP), horseradish peroxidase (HRP) or glucose oxidase (GOX); fluorescent proteins, such as green fluorescence protein (GFP), redox sensitive GFP (RoGFP), Azurite or Emerald; luciferase, i.e. a class of oxidative enzymes that produce bioluminescence (e.g. firefly luciferase (EC 1.13.12.7)); chloramphenicol acetyl transferase (CAT); ⁇ -galactosidase; or ⁇ -glucuronidase.
  • AP alkaline phosphatase
  • HRP horseradish peroxidase
  • GOX glucose oxidase
  • fluorescent proteins such as green fluorescence protein (GFP), redox sensitive GFP (RoGFP), Azurite or Emerald
  • Non-limiting examples of protein tags are: AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE), Calmodulin-tag, a peptide bound by the protein calmodulin
  • KRRWKKNFIAVSAANRFKKISSSGAL polyglutamate tag
  • anion-exchange resin such as Mono-Q (EEEEEE)
  • E-tag a peptide recognized by an antibody
  • GAPVPYPDPLEPR FLAG-tag
  • FLAG-tag a peptide recognized by an antibody
  • HA-tag a peptide from hemagglutinin recognized by an antibody
  • YPYDVPDYA His-tag, 5-10 histidines bound by a nickel or cobalt chelate (HHHHHH), Myc- tag, a peptide derived from c-myc recognized by an antibody (EQKLISEEDL), NE-tag, a novel 18-amino-acid synthetic peptide (TKENPRSNQEESYDDNES) recognized by a monoclonal lgG1 antibody, which is useful in a wide spectrum of applications including Western blotting, ELISA, flow cytometry, immunocytochemistry, immunoprecipitation, and affinity purification of recombinant proteins, S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS), SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHWEGLAGELEQLRARLEHHPQGQREP), Softag 1 , for mammalian expression (SLAELLNAGLGGS), Softag
  • Halo-tag a mutated hydrolase that covalently attaches to the HaloLinkTM Resin (Promega)
  • Maltose binding protein-tag a protein which binds to amylose agarose, Nus-tag, Thioredoxin-tag, Fc-tag, derived from immunoglobulin Fc domain, allow dimerization and solubilization.
  • antibody is intended to refer to immunoglobulin molecules, preferably comprised of four polypeptide chains, two heavy (H) chains and two light (L) chains which are typically inter-connected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
  • the heavy chain constant region can comprise e.g. three domains CH 1 , CH2 and CH3.
  • Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
  • the light chain constant region is comprised of one domain (CL).
  • VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • FR framework regions
  • Each VH and VL is typically composed of three CDRs and up to four FRs arranged from amino-terminus to carboxy-terminus e.g. in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
  • CDRs Complementarity Determining Regions
  • Each variable domain typically has three CDR regions identified as CDR1 , CDR2 and CDR3.
  • Each complementarity determining region may comprise amino acid residues from a "complementarity determining region" as defined by Kabat (e.g.
  • a complementarity determining region can include amino acids from both a CDR region defined according to Kabat and a hypervariable loop.
  • intact antibodies can be assigned to different "classes". There are five major classes of intact antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these maybe further divided into “subclasses” (isotypes), e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 , and lgA2.
  • a preferred class of immunoglobulins for use in the present invention is IgG.
  • the heavy-chain constant domains that correspond to the different classes of antibodies are called [alpha], [delta], [epsilon], [gamma], and [mu], respectively.
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
  • antibodies are conventionally known antibodies and functional fragments thereof.
  • a “functional fragment” or "antigen-binding antibody fragment” of an antibody/immunoglobulin hereby is defined as a fragment of an antibody/immunoglobulin (e.g., a variable region of an IgG) that retains the antigen-binding region.
  • An "antigen-binding region" of an antibody typically is found in one or more hyper variable region(s) of an antibody, e.g., the CDR1 , -2, and/or -3 regions; however, the variable "framework" regions can also play an important role in antigen binding, such as by providing a scaffold for the CDRs.
  • the "antigen- binding region” comprises at least amino acid residues 4 to 103 of the variable light (VL) chain and 5 to 109 of the variable heavy (VH) chain, more preferably amino acid residues 3 to 107 of VL and 4 to 1 1 1 of VH, and particularly preferred are the complete VL and VH chains (amino acid positions 1 to 109 of VL and 1 to 1 13 of VH; numbering according to WO 97/08320).
  • “Functional fragments”, “antigen-binding antibody fragments”, or “antibody fragments” of the invention include but are not limited to Fab, Fab', Fab'-SH, F(ab') 2 , and Fv fragments; diabodies; single domain antibodies (DAbs), linear antibodies; single-chain antibody molecules (scFv); and multispecific, such as bi- and tri-specific, antibodies formed from antibody fragments.
  • An antibody other than a "multi-specific” or “multi-functional” antibody is understood to have each of its binding sites identical.
  • the F(ab') 2 or Fab may be engineered to minimize or completely remove the intermolecular disulfide interactions that occur between the CH1 and CL domains.
  • Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
  • the term includes native sequence Fc regions and variant Fc regions.
  • a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
  • the C-terminal lysine (Lys447) of the Fc region may or may not be present.
  • numbering of amino acid residues in the Fc region or constant region is according to the EL) numbering system, also called the EU index.
  • Variants of the antibodies or antigen-binding antibody fragments contemplated in the invention are molecules in which the binding activity of the antibody or antigen-binding antibody fragment is maintained.
  • Binding proteins contemplated in the invention are for example antibody mimetics, such as Affibodies, Adnectins, Anticalins, DARPins, Avimers, Nanobodies.
  • a "human” antibody or antigen-binding fragment thereof is hereby defined as one that is not chimeric (e.g., not “humanized”) and not from (either in whole or in part) a non-human species.
  • a human antibody or antigen-binding fragment thereof can be derived from a human or can be a synthetic human antibody.
  • a "synthetic human antibody” is defined herein as an antibody having a sequence derived, in whole or in part, in silico from synthetic sequences that are based on the analysis of known human antibody sequences. In silico design of a human antibody sequence or fragment thereof can be achieved, for example, by analyzing a database of human antibody or antibody fragment sequences and devising a polypeptide sequence utilizing the data obtained there from.
  • Another example of a human antibody or antigen-binding fragment thereof is one that is encoded by a nucleic acid isolated from a library of antibody sequences of human origin (e.g., such library being based on antibodies taken from a human natural source).
  • a “humanized antibody” or humanized antigen-binding fragment thereof is defined herein as one that is (i) derived from a non-human source (e.g., a transgenic mouse which bears a heterologous immune system), which antibody is based on a human germline sequence; (ii) where amino acids of the framework regions of a non-human antibody are partially exchanged to human amino acid sequences by genetic engineering or (iii) CDR-grafted, wherein the CDRs of the variable domain are from a non-human origin, while one or more frameworks of the variable domain are of human origin and the constant domain (if any) is of human origin.
  • a non-human source e.g., a transgenic mouse which bears a heterologous immune system
  • CDR-grafted wherein the CDRs of the variable domain are from a non-human origin, while one or more frameworks of the variable domain are of human origin and the constant domain (if any) is of human origin.
  • variable domains are derived from a non-human origin and some or all constant domains are derived from a human origin.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible mutations, e.g., naturally occurring mutations, that may be present in minor amounts. Thus, the term “monoclonal” indicates the character of the antibody as not being a mixture of discrete antibodies. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. In addition to their specificity, monoclonal antibody preparations are advantageous in that they are typically uncontaminated by other immunoglobulins. The term “monoclonal” is not to be construed as to require production of the antibody by any particular method. The term monoclonal antibody specifically includes chimeric, humanized and human antibodies.
  • an “isolated” antibody is one that has been identified and separated from a component of the cell that expressed it. Contaminant components of the cell are materials that would interfere with diagnostic or therapeutic uses of the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • an antibody binds specifically to, is “specific to/for” or “specifically recognizes” an antigen of interest, e.g. a tumor-associated polypeptide antigen target, is one that binds the antigen with sufficient affinity such that the antibody is useful as a therapeutic agent in targeting a cell or tissue expressing the antigen, and does not significantly cross- react with other proteins or does not significantly cross-react with proteins other than orthologs and variants (e.g. mutant forms, splice variants, or proteolytically truncated forms) of the aforementioned antigen target.
  • an antigen of interest e.g. a tumor-associated polypeptide antigen target
  • the term “specifically recognizes” or “binds specifically to” or is “specific to/for” a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by an antibody, or antigen-binding fragment thereof, having a monovalent K D for the antigen of less than about 10 "4 M, alternatively less than about 10 "5 M, alternatively less than about 10 "6 M, alternatively less than about 10 "7 M, alternatively less than about 10 "8 M, alternatively less than about 10 "9 M, alternatively less than about 10 "10 M, alternatively less than about 10 "11 M, alternatively less than about 10 "12 M, or less.
  • an antibody “binds specifically to,” is “specific to/for” or “specifically recognizes” an antigen if such antibody is able to discriminate between such antigen and one or more reference antigen(s).
  • “specific binding”, “binds specifically to”, is “specific to/for” or “specifically recognizes” is referring to the ability of the antibody to discriminate between the antigen of interest and an unrelated antigen, as determined, for example, in accordance with one of the following methods.
  • Such methods comprise, but are not limited to surface plasmon resonance (SPR), Western blots, ELISA-, RIA-, ECL-, IRMA-tests and peptide scans.
  • SPR surface plasmon resonance
  • Western blots ELISA-, RIA-, ECL-, IRMA-tests
  • peptide scans for example, a standard ELISA assay can be carried out.
  • the scoring may be carried out by standard color development (e.g. secondary antibody with horseradish peroxidase and tetramethyl benzidine with hydrogen peroxide).
  • the reaction in certain wells is scored by the optical density, for example, at 450 nm.
  • determination of binding specificity is performed by using not a single reference antigen, but a set of about three to five unrelated antigens, such as milk powder, BSA, transferrin or the like.
  • Binding affinity refers to the strength of the total sum of non-covalent interactions between a single binding site of a molecule and its binding partner. Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g. an antibody and an antigen).
  • the dissociation constant "K D " is commonly used to describe the affinity between a molecule (such as an antibody) and its binding partner (such as an antigen) i.e. how tightly a ligand binds to a particular protein.
  • Ligand-protein affinities are influenced by non-covalent intermolecular interactions between the two molecules.
  • the "K D " or "K D value" according to this invention is measured by using surface plasmon resonance assays using suitable devices including but not limited to Biacore instruments like Biacore T100, Biacore T200, Biacore 2000, Biacore 4000, a Biacore 3000 (GE Healthcare Biacore, Inc.), or a ProteOn XPR36 instrument (Bio-Rad Laboratories, Inc.).
  • Biacore instruments like Biacore T100, Biacore T200, Biacore 2000, Biacore 4000, a Biacore 3000 (GE Healthcare Biacore, Inc.), or a ProteOn XPR36 instrument (Bio-Rad Laboratories, Inc.).
  • nucleoside and “nucleoside moiety” as use herein reference a nucleic acid subunit including a sugar group and a heterocyclic base, as well as analogs of such sub- units, such as a modified or naturally occurring deoxyribonucleoside or ribonucleoside or any chemical modifications thereof.
  • Other groups e.g., protecting groups
  • nucleosides include, but are not limited to, 2'-, 3'- and 5'-position sugar modifications, 5- and 6-position pyrimidine modifications, 2-, 6- and 8-position purine modifications, modifications at exocyclic amines, substitution of 5- bromo-uracil, and the like.
  • Nucleosides can be suitably protected and derivatized to enable oligonucleotide synthesis by methods known in the field, such as solid phase automated synthesis using nucleoside phosphoramidite monomers, H-phosphonate coupling or phosphate triester coupling.
  • nucleotide or “nucleotide moiety” refers to a sub-unit of a nucleic acid which includes a phosphate group, a sugar group and a heterocyclic base, as well as analogs of such sub- units. Other groups (e.g., protecting groups) can be attached to any component(s) of a nucleotide.
  • nucleotide may refer to a modified or naturally occurring
  • nucleotides in some cases include purines and pyrimidines, which include thymidine, cytidine, guanosine, adenine and uridine.
  • the term "nucleotide” is intended to include those moieties that contain not only the known purine and pyrimidine bases, e.g. adenine (A), thymine (T), cytosine (C), guanine (G), or uracil (U), but also other heterocyclic bases that have been modified. Such modifications include
  • methylated purines or pyrimidines acylated purines or pyrimidines, alkylated riboses or other heterocycles.
  • modifications include, e.g., diaminopurine and its derivatives, inosine and its derivatives, alkylated purines or pyrimidines, acylated purines or pyrimidines thiolated purines or pyrimidines, and the like, or the addition of a protecting group such as acetyl, difluoroacetyl, trifluoroacetyl, isobutyryl, benzoyl, 9-fluorenylmethoxycarbonyl, phenoxyacetyl, dimethylformamidine, dibutylformamidine, dimethylacetamidine, ⁇ , ⁇ -diphenyl carbamate, or the like.
  • the purine or pyrimidine base may also be an analog of the foregoing; suitable analogs will be known to those skilled in the art and are described in the pertinent texts and literature. Common analogs include, but are not limited to, 1 -methyladenine, 2- methyladenine, N6-methyladenine, N6-isopentyladenine, 2-methylthio-N6-isopentyladenine, ⁇ , ⁇ -dimethyladenine, 8-bromoadenine, 2-thiocytosine, 3-methylcytosine, 5-methylcytosine, 5-ethylcytosine, 4-acetylcytosine, 1 -methylguanine, 2-methylguanine, 7-methylguanine, 2,2- dimethylguanine, 8-bromoguanine, 8-chloroguanine, 8-aminoguanine, 8-methylguanine, 8- thioguanine, 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-io
  • oligonucleotide refers to a polynucleotide formed from a plurality of linked nucleotide units as defined above.
  • the nucleotide units each include a nucleoside unit linked together via a phosphate linking group, or an analog thereof.
  • oligonucleotide also refers to a plurality of nucleotides that are linked together via linkages other than phosphate linkages such as phosphorothioate linkages or squaramide linkages.
  • the oligonucleotide may be naturally occurring or non-naturally occurring.
  • the oligonucleotides may include ribonucleotide monomers (i.e., may be oligoribonucleotides) and/or deoxyribonucleotide monomers.
  • n 2, 3, 4, 5 6, 7 or 8.
  • a OH group is replaced by an NH 2 group (such as glucosamine), desoxysaccharides, wherein at least one OH group is replaced by H (e.g. desoxiribose).
  • Preferred examples for monosaccharides are D-(+)-Glycerinaldehyd; D-(-)-Erythrose; D-(-)-Threose; D-(-)-Ribose; D-(-)-Arabinose; D-(+)- Xylose; D-(-)-Lyxose; D-(+)-Allose; D-(+)-Altrose; D-(+)-Glucose; D-(+)-Mannose; D-(-)- Gulose; D-(-)-ldose; D-(+)-Galactose; D-(+)-Talose; Dihydroxyaceton;
  • D-Erythrulose D-Ribulose; D-Xylulose; D-Psicose; D-Fructose; D-Sorbose; D-Tagatose.
  • monosaccharide also encompasses monosaccharides which one, two, three or four hydroxyl-g roups are substituted.
  • polysaccharides refers to molecules comprising at least 2 (two), preferably at least 5 (five), more preferably at least 10 (ten) monosaccharides which are connected via a glycosidic bond.
  • a carbohydrate as used herein encompasses a monosaccharide and a polysaccharide and derivatives thereof.
  • a polymer as used herein refers to macromolecules composed of many repeated organic subunits, however, which are no polysaccharides, oligonucleotides or peptides.
  • Examples for polymers are Polyethylenglycole (PEG), polyoxyethylene (PEO) or polyglycerol (e.g.
  • PGPR polyglycerol-polyricinoleate
  • fluorophore is well-known to the skilled person and refers to chemical compounds that re-emit light upon light excitation.
  • Non limiting examples are CY 5 , EDANS, Xanthene derivatives (e.g. fluorescein, Rhodamine, Oregon green, eosin, Texas red), Cyanine derivatives (e.g., indocarbocyanine, oxacarbocyanine, merocyanine), Squaraine derivatives (e.g., Seta, Se Tau, Square dyes), Naphthalene derivatives (e.g., dansyl or prodan derivatives), Coumarin derivatives, Oxadiazole derivatives, Anthracene derivatives (e.g., Anthraquinones such as DRAQ5, DRAQ7, CyTRAK Orange), Pyrene derivatives (e.g., cascade blue), Oxazine derivatives (e.g., Nile red, Nile blue, Cresyl violet), Acridine derivatives (
  • aliphatic or aromatic residue refers to an aliphatic substituent, e.g. an alkyl residue which, however, can be substituted by further aliphatic and/or aromatic substituents, e.g. an aliphatic residue can be a nucleic acid, a peptide, a protein, an enzyme, a co-enzyme, an antibody, a nucleotide, an oligonucleotide, a monosaccharide, a
  • polysaccharide, a polymer, a fluorophore, optionally substituted benzene, etc. as long as the direct link of such a molecule to the core structure (in case of e.g., to the respective oxygen of a compound of formula (III) or (V)) is aliphatic.
  • An aromatic residue is a substitute, which direct link to the core structure is part of an aromatic system, e.g., an optionally substituted phenyl or pyridyl or peptide, if the direct link of the peptide to the core structure is for example via a phenyl-residue.
  • antibody drug conjugate or abbreviated ADC is well known to a person skilled in the art, and, as used herein, refers to the linkage of an antibody or an antigen binding fragment thereof with a drug, such as a chemotherapeutic agent, a toxin, an immunotherapeutic agent, an imaging probe, and the like.
  • a “linker” is any chemical moiety that links an antibody or an antigen binding fragment thereof covalently to the drug.
  • linker drug conjugate refers to a molecule or chemical group comprising or consisting of a linker as defined herein before, and a drug.
  • linker drug conjugate in general refers to that part of an antibody drug conjugate which is not the antibody or an antigen binding fragment thereof. In general, in a linker drug conjugate the linker is covalently linked to the drug.
  • antibody fluorophore conjugates or abbreviated AFC, which refers to the linkage of an antibody or an antigen binding fragment thereof with a fluorophore, such as, for example, Cy5.
  • the fluorophore may be linked to the antibody or antigen-binding fragment thereof through a linker, for example a linker as described above in the context of an antibody drug conjugate.
  • the antibody fluorophore conjugate may comprise a "linker fluorophore conjugate".
  • linker fluorophore conjugate refers to a molecule or chemical group comprising or consisting of a linker as defined herein before, and a fluorophore.
  • linker fluorophore conjugate in general refers to that part of an antibody drug conjugate which is not the antibody or an antigen binding fragment thereof.
  • linker fluorophore conjugate the linker is covalently linked to the fluorophore.
  • the invention provides a new chemoselective reaction of Cys residues in (unprotected) peptides, proteins, such as enzymes and co-enzymes (e.g. coenzyme A), antibodies or other thiol-comprising compounds with alkene- or alkyne-phosphonamidates.
  • the peptides, proteins, antibodies or other thiol-comprising compounds are unprotected.
  • the alkene- or alkyne-phosphonamidates are electron deficient alkene- or alkyne-phosphonamidates. The resulting conjugates have not been described in the literature previously.
  • Scheme 1 describes the general strategy for a synthesis according to the present invention at the example of ethenyl or ethynyl phosphonites.
  • R1 represents an optionally substituted aliphatic or aromatic residue:
  • Scheme 2 shows the difference between a process known in the art (e.g., 15) and a process according to the present invention
  • Staudinger-induced thiol-addition the thiol addition may be also denoted as "Michael addition", as e.g. in Scheme 2B) for the modification of Cys residues according to the invention.
  • ethenyl and ethynyl (diethyl)phosphonite were used:
  • the invention refers to a method for bioconjugation of two complex molecules: a chemoselective reaction, which induces a second chemoselective reaction for the conjugation to proteins.
  • This concept is based on the unique reactivity of an azide-building block with an unprotected alkyne or alkene phosphonite via the Staudinger-phosphonite reaction (SPhR) resulting in the generation of a, preferably, electron-deficient double or triple bond (Scheme 1 and 2B).
  • SPhR Staudinger-phosphonite reaction
  • the resulting electrophilic system can subsequently be employed for the reaction with thiol-containing proteins and antibodies or further thiol-comprising compounds to deliver functional conjugates such as antibody or protein conjugates.
  • Two complex molecule e.g. peptide and proteins or peptide and antibody
  • Two complex molecule can be connected by straightforward step-wise chemoselective conjugations No need of final protecting group manipulations after installation of chemoselective handle (i.e., preferably electron-deficient, alkene or alkyne- phosphonamidate) or after the chemoselective conjugation
  • chemoselective handle i.e., preferably electron-deficient, alkene or alkyne- phosphonamidate
  • the process according to the present invention can be carried out to conjugate different compounds such as small molecules (e.g. optionally substituted alkyl, phenyl or heterocycles), proteins, antibodies, oligonucleotides or polysaccharides with tags, proteins oligonucleotides etc.
  • small molecules e.g. optionally substituted alkyl, phenyl or heterocycles
  • proteins e.g. optionally substituted alkyl, phenyl or heterocycles
  • proteins e.g. optionally substituted alkyl, phenyl or heterocycles
  • antibodies e.g. optionally substituted alkyl, phenyl or heterocycles
  • oligonucleotides or polysaccharides with tags e.g. optionally substituted alkyl, phenyl or heterocycles
  • the present invention refers in a first aspect to a process for the preparation of conjugates of formula (VII) comprising the steps of
  • X represents (R 3 R4)C when is a double bond
  • heteroaromatic system such as pyridyl; preferably CrC 8 -alkyl, C C 8 - alkyl substituted with (CrC 8 -alkoxy) n , phenyl or phenyl substituted with -N0 2 ;
  • Nitrogen-ring-atoms with biotin or any other peptide, protein such as an enzyme or co-enzyme (e.g. coenzyme A), antibody, protein tag, fluorophore, oligonucleotide, or polysaccharide and wherein # represents the position of O;
  • R 3 represents H or Ci-C B -alkyl
  • R4 represents H or d-C B -alkyl; and with an azide of formula (IV)
  • Ri and X are as defined above.
  • the invention also refers to a process comprising a step (a) prior to step (I) of the process described above.
  • a process comprises the steps of a) Reacting a compound of formula (I)
  • ⁇ " ' y represents a double or triple bond
  • X represents R 3 -C when 3 ⁇ 4 ⁇ is a triple bond
  • X represents (R 3 Ft ⁇ C when ⁇ is a double bond
  • R 3 represents H or Ci-C B -alkyl
  • R4 represents H or Ci-C B -alkyl
  • R 5 independently represents CrC 8 -alkyl
  • Hal represents a halogen selected from the group consisting of CI, Br, I, preferably CI; with an alpha unsaturated compound of formula (II) comprising a double or triple bond in alpha-position
  • X represents R 3 -C when is a triple bond; or X represents (R 3 R4)C when " ' ⁇ " is a double bond;
  • R 3 represents H or Ci-C B -alkyl
  • R4 represents H or Ci-C B -alkyl
  • R ! and X are as defined above;
  • this process represents a triple bond.
  • the P-atom of compounds of formula (III), preferably wherein represents a double bond can be protected by BH 3 prior to the Staudinger reaction (e.g. for purification purposes) and can easily be deprotected before the Staudinger reaction: b) reacting a compound of formula (III) to form a compound of formula (III)
  • V represents CrCe-alkyl, preferably methyl, ethyl or propyl, more preferably methyl; and RL R 2 and R 3 are as defined for compound (III) above.
  • compounds of formula (II*) can be used
  • V* wherein V represents CrC 8 -alkyl, preferably methyl, ethyl or propyl, more preferably methyl; • and Ri are as defined for compound (V); and compounds of formula (VII*)
  • V represents Ci-C B -alkyl, preferably methyl, ethyl or propyl, more preferably methyl; ⁇ , ⁇ --D and are as defined for compound (VII). All steps for the processes described herein for compounds of formula (V) and (VII) can be performed analogously for compounds of formula (V*) and (VII*).
  • the present invention also relates to a process for the preparation of alkene- phosphonamidates comprising the steps of:
  • V represents CrC 8 -alkyl, preferably methyl, ethyl or propyl, more preferably methyl;
  • Nitrogen-ring-atoms with biotin or any other peptide, protein such as an enzyme or co-enzyme (e.g. coenzyme A), antibody, protein tag, fluorophore, oligonucleotide, or polysaccharide and wherein # represents the position of O; 3 represents H or d-Ce-alkyl;
  • R4 represents H or d-C 8 -alkyl; and with an azide of formula (IV)
  • R 3 and R4 are as defined above;
  • One embodiment of the present invention also refers to compounds of formula (V*) and (VII*).
  • the compound (V) or (V*) obtained in step (I) has exactly the same structure as the compound (V) or (V*) used for reacting with the thiol-containing molecule of formula (VI) in step (II).
  • the ⁇ , R1 and/or X moieties of the compound (V) or (V*) may be modified before the compound (V) or (V*) is used for reacting with the thiol-containing molecule of formula (VI) in step (II).
  • step (I) Such modification may be carried out as long as the ⁇ , R1 and/or X moieties after modification are still covered by the definitions disclosed herein above.
  • the ⁇ moiety of a compound A of formula (V) obtained in step (I) may be modified to give the compound B of formula (V), which is then used for reacting with the thiol-containing molecule of formula (VI) in step (II):
  • TFA " is trifluoroacetate
  • Cy5 is the fluorescence dye Cy5
  • HATU is (1 - [Bis(dimethylamino)methylene]-1 H-1 ,2,3-triazolo[4,5-b]pyridinium 3-oxid hexafluorophosphate)
  • DIPEA is A/,A/-diisopropylethylamine and DMF is N,N- dimethylformamide.
  • R-i independently represents methyl, ethyl, propyl, butyl, phenyl, nitro-substituted phenyl, (C C2-alkoxy) n wherein n is 1 , 2, 3, 4, 5 or 6, more preferably 2-(2-methoxyethoxy)ethyl, phenyl, benzyl or nitro-substituted benzyl, methyl or ethyl, even more preferably methyl or ethyl.
  • Ri is the same.
  • Ri can even be modified after the thiol-addition (step (II), for example, the substituent Ri can comprise a triple bond as in
  • any desired organic compound-N 3 such as peptide-N 3 , proteinic, such as an enzyme-N 3 or co-enzyme-N 3 (e.g. coenzyme A-N 3 ), antibody-N 3 , protein tag- N 3 , fluorophore-N 3 , oligonucleotide-N 3 , or polysaccharide-N 3 e.g. Biotin-N 3 ) to form a triazole- bridged complex, for example
  • organic compound-N 3 such as peptide-N 3 , proteinic, such as an enzyme-N 3 or co-enzyme-N 3 (e.g. coenzyme A-N 3 ), antibody-N 3 , protein tag- N 3 , fluorophore-N 3 , oligonucleotide-N 3 , or polysaccharide-N 3 e.g. Biotin-N 3
  • Ri may represent , wherein
  • compound may represent a peptide, a protein, an enzyme, a co-enzyme (e.g. co-enzyme A), an antibody, a protein tag, a fluorophore, an oligonucleotide, a polysaccharide, or biotin; wherein # represents the position of O.
  • -i is an optionally substituted aliphatic or aromatic residue, such as phenyl; with (CrCa-alkoxy) n , wherein n is 1 , 2, 3, 4, 5 or 6 with F, with CI, with Br.with I, with -N0 2 , with -N(C C8-alkyl)H, with -NH 2 , with -N(C 1 -C 8 -alkyl) 2 , with C 3 -C 8 -cycloalky, with optionally substituted phenyl substituted CrCa-alkyl such as
  • alkoxy)n F, CI, I , Br, -N0 2 , -N(Ci-C 8 -alkyl)H,- NH 2 , -NKd-Ca-alkyl),, substituted phenyl; or 5- or 6-membered heteroaromatic system such as pyridyl; preferably d-Ca-alkyl, Ci-C 8 -alkyl substituted with (Ci-C 8 -alkoxy) n , phenyl or phenyl substituted with -N0 2 .
  • Optionally substituted in the "optionally substituted aliphatic or aromatic residue” refers to optional substitution of the aliphatic or aromatic residue independently with any possible residue.
  • R may represent phenyl optionally independently substituted with at least one of Ci-C B -alkyl, (C C 8 -alkoxy) n wherein n is 1 , 2, 3, 4, 5 or 6, F, CI, I, Br, -N0 2 , -N(C C8-alkyl)H, -NH 2 or - N(C C 8 -alkyl) 2 .
  • R-i may represent a 5- or 6-membered heteroaromatic system such as pyridyl.
  • R-i represents an aliphatic or aromatic residue which is optionally substituted with -S-S-(C C 8 -alkyl).
  • Ri represents , wherein R 10 and Rn independently represent hydrogen or
  • Ci-C 8 -alkyl and # represents the position of O.
  • R 10 and Rn independently represent hydrogen, methyl or ethyl.
  • R 10 and Rn independently represent hydrogen, methyl or ethyl; and # represents the position of O.
  • Rio and Rn are both hydrogen.
  • Ri 0 is hydrogen and R- ⁇ is Cr C 6 -alkyl.
  • Ri 0 is hydrogen and Rn is methyl or ethyl.
  • both Ri are the same.
  • Ri represents CrC 8 -alkyl substituted with phenyl, said phenyl being
  • z X C r C 8 -alkyl
  • wnerein z is O or NH
  • # represents the position of said phenyl.
  • Z is O. In some embodiments Z
  • the C C 8 -alkyl in the Z X (C r C B -alkyl) may be for examp
  • the Ci-Ca-alkyl may be, for example, methyl, ethyl, propyl or butyl; preferably methyl, ethyl or propyl; more preferably methyl or ethyl; most preferably methyl; wherein Z is O or NH, and wherein # represents the position of O.
  • R-i represents wnere j n
  • the Ci-Ca-alkyl may be, for example, methyl, ethyl, propyl or butyl; preferably methyl, ethyl or propyl; more preferably methyl or ethyl; most preferably methyl; wherein Z is O or NH, and wherein # represents the position of O.
  • R-i represents wnere j n
  • the Ci-Ca-alkyl may be, for example, methyl, ethyl, propyl or butyl; preferably methyl, ethyl or propyl; more preferably methyl or
  • the CrCa-alkyl may be, for example, methyl, ethyl, propyl or butyl; preferably methyl, ethyl or propyl; more preferably methyl or ethyl; most preferably methyl; wherein Z is O or NH, and wherein # represents the position of O.
  • both are the same.
  • R-i represents CrC 8 -alkyl substituted with phenyl, said phenyl being
  • Ri repres C C 8 -alkyl substituted with
  • embodiment i represents , wherein # represents the position of O.
  • both Ri are the same.
  • Ri represents an aliphatic or aromatic residue which is optionally substituted with hydroxy-(CrC 8 -alkoxy) n wherein n is 1 , 2, 3, 4, 5 or 6.
  • Ri is hydroxyethoxyethyl, more preferably -(CH2)2-0-(CH 2 )2-OH.
  • Ri represents an aliphatic or aromatic residue which is optionally substituted with C 2 -C 8 -alkynyl. In a preferred embodiment Ri is homopropargyl.
  • - ⁇ represents a double bond
  • X represents (R 3 ⁇ C
  • R 3 and R 4 independently represent H or CrC 8 -alkyl and represents a bond.
  • R 3 and R 4 each represent
  • X represents R 3 -C
  • R 3 represents H or or Ci-C B -alkyl, more preferably H
  • represents a double bond
  • represents an optionally substituted CrC 8 -alkyl such as
  • # represents the position of the -N 3 group of compounds of formula (IV), a radioactive or non-radioactive nuclide, biotin, a nucleotide, an oligonucleotide, a polymer, a carbohydrate, an amino acid, a peptide, an optionally substituted 5- or 6-membered heteroaromatic system, a protein tag, or a fluorophore such as CY 5 or EDANS.
  • represents a cyclic RGD peptide of structure (VIII) (c(RGDfK)
  • d-C 8 -alkyl independently selected from the group consisting of d-C 8 -alkyl, d-C 8 -alkoxy, halogen, -CN, -N0 2 , -NH 2 , -N(Ci-C 8 -alkyl), -N(d-C 8 -alkyl) 2 -COOH, -COO(d-C 8 - alkyl), -0-C(0)-(d-C 8 -alkyl), -C(0)N-(d-C 8 -alkyl), -N(H)-C(0)-(d-C 8 -alkyl) preferably optionally substituted with one substituent selected from the group consisting of d- C 8 -alkoxy, -COOH, -COO(Ci-C 8 -alkyl and N0 2 .
  • Ci-C 8 -alkyl optionally substituted with at least one substituent selected from the group consisting of C 3 -C 8 -cycloalkyl; heterocyclyl with 3 to 8 ring members wherein the heteroatom(s) are selected from N, O, S; Ci-C 8 -alkoxy; halogen; -CN; -N0 2 ; -NH 2 ; - N(d-C 8 -alkyl); -N(C C 8 -alkyl) 2 ; -COOH; -COO(d-C 8 -alkyl); -0-C(0)-(d-C 8 -alkyl); - CONH 2 ; -C(0)N(d-C 8 -alkyl) 2 ; -C(0)NH-(d-C 8 -alkyl); -N(H)-C(0)-(C C 8 -alkyl), preferably d-C 8 -alkoxy, -COOH, -COO(d-
  • heteroaromatic system a monosaccharide, a polysaccharide, a peptide, a nucleotide, an oligonucleotide, a polymer, an amino acid, a fluorophor, a protein tag (substituent 1 st generation), wherein a substituent 1 st generation may again optionally be substituted with C 3 -C 8 -cycloalkyl; heterocyclyl with 3 to 8 ring members wherein the heteroatom(s) are selected from N, O, S; Ci-C 8 -alkoxy; halogen; -CN; -N0 2 ; -NH 2 ; - N(d-C 8 -alkyl); -N(C C 8 -alkyl) 2 ; -COOH; -COO(d-C 8 -alkyl); -0-C(0)-(d-C 8 -alkyl); - CONH 2 ; -C(0)N(d-C 8
  • heteroaromatic system substituted again by at least one substituent selected from the same group and wherein such substitution may go until generation 3, 4, 5, 6, 7, 8, 9 or 10.
  • represents a cyclic RGD peptide of structure (VIII) (c(RGDfK)
  • d-C 8 -alkyl independently selected from the group consisting of d-C 8 -alkyl, Ci-C 8 -alkoxy, halogen, -CN, -N0 2 , -NH 2 , -N(C C 8 -alkyl), -N(d-C 8 -alkyl) 2 -COOH, -COO(d-C 8 - alkyl), -0-C(0)-(C C 8 -alkyl), -C(0)N-(d-C 8 -alkyl), -N(H)-C(0)-(C C 8 -alkyl) preferably optionally substituted with one substituent selected from the group consisting of d- C 8 -alkoxy, -COOH, -COO(d-C 8 -alkyl and N0 2 .
  • d-C 8 -alkyl optionally substituted with one, two, three, four or five substituents independently selected from the group consisting of phenyl which may be optionally substituted with one, two, three, four or five substituents independently selected from the group consisting of d-C 8 -alkyl, d-C 8 -alkoxy, halogen, -CN, -N0 2 , -NH 2 , -N(d- C 8 -alkyl), -N(C C 8 -alkyl) 2 -COOH, -COO(d-C 8 -alkyl), -0-C(0)-(C C 8 -alkyl), -C(0)N- (d-C 8 -alkyl), -N(H)-C(0)-(d-C 8 -alkyl), preferably optionally substituted with one substituent selected from the group consisting of Ci-C 8 -alkoxy, -COOH, -COO(d-C 8
  • represents an optionally substituted phenyl such as
  • TFA is trifluoroacetate
  • represents an optionally substituted Ci-C 8 -alkyl such as a linker, a drug, or a linker-drug conjugate.
  • represents an optionally substituted phenyl such as a linker, a drug, or a linker-drug conjugate.
  • a process according to the invention represents an antibody, preferably a IgG-antibody, such as Cetuximab or Trastuzumab; a peptide, such as GFP protein, eGFP-protein, a tripeptide, e.g., a peptide of formula (IX)
  • the present invention also relates to a process wherein a compound of formula (XX)
  • Ri and X are as defined herein. Accordingly, the present invention also relates to a process wherein a compound of formula (XX)
  • Vll*a wherein V, Ri and X are as defined herein.
  • the compound (XX) having the and the in the same molecule is a peptide, such as for example the BCL9 peptide.
  • the compound of formula (Vila) or (Vll*a) obtained by the process may be a cyclic peptide, such as for example a cyclic peptide derived from the BCL9 peptide.
  • One embodiment of the present invention also refers to compounds of formula (Vila) and (Vll*a).
  • the invention also refers to compounds of formula (V)
  • the invention also refers to compounds of formula (V*)
  • # represents the N-position; a radioactive or non-radioactive nuclide, biotin, a nucleotide, an oligonucleotide, a polymer, a carbohydrate, an amino acid, a peptide, an optionally substituted phenyl, an optionally substituted 5- or 6- membered heteroaromatic system, an optionally substituted Ci-Ca-alkyI, a protein tag or a fluorophore such as CY 5 .
  • a radioactive or non-radioactive nuclide biotin, a nucleotide, an oligonucleotide, a polymer, a carbohydrate, an amino acid, a peptide, an optionally substituted phenyl, an optionally substituted 5- or 6- membered heteroaromatic system, an optionally substituted Ci-Ca-alkyI, a protein tag or a fluorophore such as CY 5 .
  • TFA is trifluoroacetate
  • the compounds of formula (V) or (V*) ⁇ represents an optionally substituted Ci-C 8 -alkyl such as a linker, a drug, or a linker-drug conjugate.
  • the compounds of formula (V) or (V*) ⁇ represents an optionally substituted phenyl such as a linker, a drug, or a linker-drug conjugate.
  • the invention also refers to compounds of formula (VII)
  • represents a bond and X represents ( 3 R 4 )C;
  • represents a double bond and X represents R3-C;
  • R 3 represents H or Ci-C 8 -alkyl
  • R4 represents H or Ci-C B -alkyl
  • heteroaromatic system such as pyridyl; preferably CrC 8 -alkyl, C C 8 - alkyl substituted with (Ci-C 8 -alkoxy) n , phenyl or phenyl substituted with -N0 2 ;
  • the invention also refers to compounds of formula (VII * ) N H
  • Ci-C B -alkyl an optionally substituted Phenyl, an optionally substituted aromatic 5- or 6- membered heterocyclic system, an amino acid, a peptide, a protein, an antibody, a saccharide, a polysaccharide, a nucleotide, a oligonucleotide or a polymer;
  • N(Ci-C 8 -alkyl) 2 substituted phenyl; or 5- or 6-membered heteroaromatic system such as pyridyl; preferably Ci-Ca-alkyI, d-C 8 - alkyl substituted with (C 1 -C 8 -alkoxy) n , phenyl or phenyl substituted with -N0 2 ;
  • V represents d-Ce-alkyl, preferably methyl, ethyl or propyl, more
  • R 3 represents H or Ci-C B -alkyl
  • R4 represents H or Ci-C B -alkyl.
  • a radioactive or non-radioactive nuclide biotin, a nucleotide, an oligonucleotide, a polymer, a carbohydrate, an amino acid, a peptide, an optionally substituted phenyl, an optionally substituted 5- or 6-membered heteroaromatic system, an optionally substituted CrC 8 -alkyl, a protein tag or a fluorophore such as CY 5 or EDANS.
  • TFA is trifluoroacetate.
  • represents an optionally substituted Ci-C 8 -alkyl such as a linker, a drug, or a linker-drug conjugate.
  • the compounds of formula (VII) or (VII*) ⁇ represents an optionally substituted phenyl such as a linker, a drug, or a linker-drug conjugate.
  • the compounds of formula (VII) or (VII*) represents an antibody, preferably a IgG-antibody, more preferably a Cetuximab or a Trastuzumab; a peptide, preferably GFP protein or eGFP-protein or a tripeptide, more preferably a peptide of formula (IX) or d-Ce-alkyl.
  • Preferred conjugates of formula (VII) or formula (VII*) are conjugates wherein represents an antibody and
  • conjugates of formula (VII) are conjugates wherein represents a protein and
  • represents a protein tag or a fluorophore such as CY 5 or EDANS, an antibody or a protein.
  • conjugates of formula (VII) or formula (VII*) are conjugates wherein ⁇ --D represents an antibody and
  • the compound (Vila) is a cyclic peptide, such as for example a cyclic peptide derived from the BCL9 peptide.
  • the invention also refers to compounds of formula (Vll*a)
  • the compound (Vll*a) is a cyclic peptide, such as for example a cyclic peptide derived from the BCL9 peptide.
  • the protein on the left side is GFP-protein, preferably eGFP-protein;
  • Cetuximab A fluorescently labeled ASGP-R addressing Cy 5 conjugate of formula (X) which can be produced via the modular addition to vinyl phosphonamidates:
  • the reaction is carried out under inert gas such as argon.
  • inert in this situation refers to a gas which will not react with any of the educts or products of this reaction under the given reaction conditions.
  • the reaction time depends on the reaction volume and amount of substance. However, as a guideline, the reaction time should be in a range from 2 min to 4 h.
  • the amounts of compound of formula (I) and (II) should be in a range from 5:1 to 1 :5 such as 2:1 to 1 :2, e.g., around 1 :1. step (I)
  • the reaction of a compound of formula (III) with an azide of formula (IV) can be performed at room temperature, i.e. around 25 °C. However, the reaction can also be carried out at temperatures in a range from 0 °C to 50 °C.
  • the reaction time depends on the reaction volume and the amount of substance. However, as a guideline, the reaction should be carried out in a time frame from 1 h to 72 h.
  • the amounts of compound of formula (III) and (IV) should be in a range from 5:1 to 1 :5 such as 2:1 to 1 :2, e.g., around 1 :1.
  • Preferred solvents for step (I) described herein is carried out in a polar aprotic solvent system such as tetrahydrofurane (THF), dimethylformamide (DMF), acetonitrile (MeCN), acetone, dimethyl sulfoxide (DMSO), ethyl acetate (EtOAc), N-methylpyrrolidone or mixtures thereof, preferably THF, DMF, MeCN, THF/DMF, THF/MeCN; or a mixture of a polar unprotic solvent and a non-polar solvent such as hexane, toluene, benzene, 1 ,4-dioxane, chloroform, diethylether or dichloromethane (DCM), preferably THF/toluene.
  • a polar aprotic solvent system such as tetrahydrofurane (THF), dimethylformamide (DMF), acetonitrile (MeCN),
  • Step (I) may be also carried out in an aqueous medium, for example in water or in an aqueous buffer, such as for example phosphate-buffered saline (PBS), tris(hydroxymethyl)-aminomethane (TRIS) or bicarbonate.
  • PBS phosphate-buffered saline
  • TMS tris(hydroxymethyl)-aminomethane
  • bicarbonate phosphate-buffered saline
  • Phosphonamidate of formula (V) and a base (and additive where required) can be suspended in a respective solvent. Then a thiol of formula (VI) can be added, e.g., via a microliter syringe and the mixture is allowed to react at room temperature, i.e. around 25 °C. However, the reaction can also be carried out at temperatures in a range from 0 °C to 50 °C. The reaction time depends on the reaction volume and the amount of substance.
  • the reaction should be carried out in a time frame from 0,1 h (hours) to 10 h, e.g., in a time frame from 0,1 h to 3 h or even within a time frame between 0,1 h and 1 h.
  • step (II) described herein is carried out in the presence of a weak base.
  • Preferred weak bases are carbonates such as ammonium (NH 4 ) 2 C0 3 , Na 2 C0 3 , Rb 2 C0 3 , K 2 C0 3 , or Cs 2 C0 3 or correlating hydrogencarbonates thereof (e.g. NaHC0 3 etc.); and weak Nitrogen containing bases such as triethylamine Et 3 N (pK a 10,76 at 25 °C).
  • pK a 10,76 at 25 °C pK a 10,76 at 25 °C.
  • a base with a pK a value within the range of 7,5 to 1 1 ,5 is used.
  • the solvent (system) can be chosen from a wide range of solvents.
  • the solvent can be a polar aprotic solvent system such as tetrahydrofurane (THF), dimethylformamide (DMF), acetonitrile (MeCN), acetone, dimethyl sulfoxide (DMSO), ethyl acetate (EtOAc), N- methylpyrrolidone or mixtures thereof, preferably THF, DMF, DMSO; non-polar solvents such as hexane, toluene, benzene, 1 ,4-dioxane, chloroform, diethylether or dichloromethane (DCM), preferably DCM; polar protic solvents sue as water, ethanol, isopropanol, methanol, n-butanol, preferably erthanol; or mixtures thereof, e.g., DMF/water.
  • THF tetrahydrofurane
  • the solvent may be also an aqueous medium, such as for example water or an aqueous buffer, such as for example phosphate-buffered saline (PBS), tris(hydroxymethyl)-aminomethane (TRIS) or bicarbonate.
  • PBS phosphate-buffered saline
  • TMS tris(hydroxymethyl)-aminomethane
  • Ethyl A/-phenyl-P-ethynyl-phosphonamidate was prepared after "general procedure for the preparation of alkenyl or alkynyl phosphonamidates" on 5 mmol scale from phenyl azide (595 mg, 5 mmol).
  • the crude mixture was purified by silica gel column chromatography eluting with hexane/ethyl acetate. The product was obtained as colourless solid in a yield of 430 mg (2.1 mmol, 42 %).
  • Ethyl A/-benzyl-P-ethynyl-phosphonamidate was prepared after "general procedure for the preparation of alkenyl or alkynyl phosphonamidates" from benzyl azide (133 mg, 125 ⁇ _, 1 mmol).
  • the crude mixture was purified by silica gel column chromatography eluting with hexane/ethyl acetate. The product was obtained as colourless solid in a yield of 37 mg (0.17 mmol, 17 %).
  • the compound was synthesized according to the general procedure C from 1 .15 ml diethyl chlorophosphite (8 mmol).
  • the pure phosphonamidate was purified by flash column chromatography (EtOAc) and obtained as a white solid. (675 mg, 3.20 mmol, 40.0%)
  • the compound was synthesized according to the general procedure C from 288 ⁇ diethyl chlorophosphite (2 mmol).
  • the pure phosphonamidate was purified by flash column chromatography (CH 2 CI 2 /MeOH, 9:1 to 4:1 ) and obtained as a white solid. (173 mg,
  • Ethyl-A -benzyl-P-vinyl-phosphonamidate The compound was synthesized according to the general procedure C from 290 ⁇ diethyl chlorophosphite (2 mmol). The pure phosphonamidate was purified by flash column chromatography (EtOAc) and obtained as a colourless oil. (155 mg, 0.69 mmol, 34.3%)
  • the compound was synthesized according to the general procedure C from 120 ⁇ diethyl chlorophosphite (0.83 mmol).
  • the pure phosphonamidate was purified by flash column chromatography (2% MeOH in CH 2 CI 2 ) and obtained as a brown oil. (125 mg, 0.46 mmol,
  • the compound was synthesized according to the general procedure C from 290 ⁇ diethyl chlorophosphite (2 mmol).
  • the pure phosphonamidate was purified by flash column chromatography (EtOAc) and obtained as a colourless oil.
  • the compound was synthesized according to the general procedure C from 140 ⁇ diethyl chlorophosphite (1 mmol).
  • the pure phosphonamidate was purified by flash column chromatography (1.5% MeOH in CH 2 CI 2 ) and obtained as a colourless oil. (70 mg,
  • Ethyl A/-phenyl-P-ethynyl-phosphonamidate (10 mg, 0.05 mmol) and potassium carbonate (2.8 mg, 0.02 mmol) was added.
  • the mixture was suspended in a 1 to 1 mixture of DMF/H 2 0 (200 pL).
  • ethanethiol (3.1 mg, 3.6 pL, 0.05 mmol) was added via a microliter syringe and the mixture was stirred at room temperature for 3 hours. Afterwards the mixture was diluted with CH 2 CI 2 (5 mL) and H 2 0 (5 mL) was added.
  • Ethanethiol was chosen as aliphatic model substrate. All experiments were conducted for 3 hours at room temperature in 0.1 mmol scale using 400 ⁇ _ of the solvent. Conversions and diastereoselectivities were determined by 31 P-NMR and 1 H-NMR (Scheme 4).
  • Table 3 Screening of solvents for the base mediated hydrothiolation of electron-deficient alkynyl phosphonamidates.
  • reaction can be applied in aqueous solvent systems and quantitative conversions can be achieved at room temperature after 3 hours using mild carbonate bases. No side reactions were observed.
  • the conjugate could be isolated by semipreparative HPLC under basic conditions as a diastereomeric mixture in a yield of 61 %. Having reasonable quantities of this water soluble phosphonamidate-conjugate in hand, studies could be performed in order to determine the hydrolytic properties of the phosphorus-nitrogen bond. For these studies a 3 ⁇ solution of conjugate and the standard tetramethylphosphonium bromide (1 .2 ⁇ ) in aqeous buffer was prepared and the hydrolysis of the phosphonamidate was characterized by monitoring the decay of the conjugate against the standard by means of 31 P NMR over 24 hours. The results are shown in Figure 1 which shows the hydrolytic decay of the GSH-phosphonamidate conjuagte under acidic conditions.
  • the rate of the reaction was determined by HPLC. Glutathione was added to a solution of ethyl-A/-phenyl alkynyl phosphonamidate in aqueous buffer at slightly basic pH. The reaction was stopped after several time points by the addition of an acidic buffer and analyzed by HPLC-UV, referring to inosine as an internal standard.
  • Figure 2 refers to the consumption of ethyl-A/-phenyl alkynyl phosphonamidate in the reaction with glutathione at pH 8.5. HPLC UV traces were taken at different time points. Experiment was performed in triplicate.
  • the cyclic RGDfK-azido peptide was synthesized manually on a NovaSynTGT alcohol resin with a loading of 0.26 mmol/g.
  • First the resin was activated by stirring 480.7 mg resin in 2.5ml toluene and 480 ⁇ acetylchloride at 60°C for three hours.
  • Double coupling of Fmoc- Asp(OAII)-OH (123.56 mg, 0.3125 mmol, 2.5 eq) was performed in DCM using DIPEA (212.6 ⁇ , 1 .25 mmol, 10 eq.) as activating base each for one hour.
  • Fmoc-Lys(dde)-OH was used in the solid phase synthesis and was orthogonally deprotected on resin using 2% hydrazine in DMF three times for three minutes, followed by coupling of 4-azidobenzoic acid (81.65 mg, 0.5 mmol, 4 eq.) with HATU (190mg, 0.5 mmol, 4eq.) and DIPEA (1 mmol, 8 eq.) in DMF for two hours. Cleavage from the resin was performed using TFA/DCM (75:25;v:v) for 2.5 hours. Precipitation was carried out in cold and dry ether.
  • the crude product was purified by semi-preparative reverse phase C18 HPLC (0-5min 95/5, water (0.1 %TFA)/MeCN (0.1 %TFA); 5-60min 10/90, water (0.1 %TFA)/MeCN (0.1 %TFA)) and gave the product as a white powder (4.1 mg, 4.89 ⁇ , 53.5 % yield).
  • the product is stable towards high concentration (0.2 M, 100 eq.) of DTT and MesNa at physiological pH (PBS buffer; pH 7.4). At pH 9.0 MesNa is slowly adding to the formed double bond (10% addition product formed after four days). In contrast to that DTT is rapidly forming an addition product with (42% after 30 hours) and followed by degradation over time.
  • GFP C70M S147C (3.13 nmol, 1 eq) was rebuffered ⁇ ⁇ 10 mM Ammoniumbicarbonte pH 8.4 and c(RGDfK)-phosphonamidate alkyne (0.08 mg, 93.9 nmol, 30 eq.) was added.
  • the reaction mixture was shaken at 37°C and 800 rpm for three hours.
  • the mixture was spin filtrated using Amicon Spin filters with a 10 kDa MWCO. After spinfiltrating the sample ten times at 14000 rpm for 5 minutes and adding fresh 10mM Ammoniumbicarbonate buffer MALDI-TOF analysis was conducted and verified total conversion of GFP C70M S147C to the desired product.
  • Cetuximab a monoclonal lgG1 antibody against human epidermal growth factor.
  • the antibody was modified with a biotin phosphonamidate and analyzed by SDS-PAGE under non reducing conditions, followed by anti-biotin western blotting (Scheme 7).
  • the intact antibody was reduced by incubation with DTT in 50 mM borate containg PBS (pH 8.0) at 37 °C. Excess of DTT was removed after the reaction by size exclusion columns and the reduced antibody fragments were incubated with a biotin phosphonamidate (1 .1 equivalents per thiol) in 50 mM ammonium bicarbonate buffer (pH 8.5). EDTA (1 mM) was added to the reaction mixture to complex heavy metal ions that promote disulfide formation.
  • Cetuximab starting material 1 : 5 min, 2: 1 h, 3: 2h, 4: 20 h incubation with a biotin modified phosphonamidate. Reaction with (left) and without (right) prior reduction of the disulfides).
  • Diethyl vinylphosphonite was synthesized based on previously published protocols by alkylation of diethyl chlorophosphite with vinylmagnesium bromide and subsequent borane addition (13) (Scheme 8). The desired phosphonite was isolated in 37% yield.
  • Vinylphosphonites with different O-substituents were synthesized starting from phosphorous trichloride by substitution of two chlorides with the corresponding alcohols in the presence of pyridine. The formed mono chloro phosphite was reacted with the vinyl Grignard reagent and protected with borane. All these steps were performed in a one-pot strategy.
  • bis(diisopropylamino)vinylphosphine in the first step enabled tetrazole mediated addition of the alcohol in more polar solvents like acetonitrile in the second step. All phosphonites were treated with borane in situ and isolated by flash chromatography.
  • the compound was synthesized according to the general procedure A from PCI 3 (130 ⁇ , 1 .50 mmol).
  • the pure borane protected phosphonite was purified by flash column chromatography (CH 2 CI 2 /MeOH, 19:1 to 9:1 ) and obtained as a colourless oil. (34 mg, 0.1 1 mmol, 7.3%)
  • triphenylphosphine (2.90 mmol, 1.5 eq.) were dissolved in 10 ml of dry THF. The solution was cooled to 0 °C and 1 .33 ml of diethyl azodicarboxylate (40% solution in Toluene) (2.90 mmol, 1.5 eq.) were added dropwise and the reaction was allowed to warm to room temperature overnight. The crude product was dry packed on a silica column for purification, eluting with Hexan/EtOAc (7:3 to 3:2), yielding 505 mg of a yellow solid. (1 .68 mmon,
  • the Staudinger phosphonite reaction with vinyl phosphonites was first investigated with rather simple diethyl derivatives. Those were synthesized by alkylation of commercial available diethyl chlorophosphite and reacted with different aliphatic and aromatic azides in situ. The desired phosphonamidates were isolated by column chromatography, after Hydrolysis of the Phosphonimidates.
  • Varying the O-substituents of the Phosphonamidates allows the fine tuning of the reactivity in the thiol-addition as well as the installation of a third functionality to the system.
  • phosphonites were treated with DABCO to form the reactive P(lll) species and reacted with an azide in situ to form the phosphonimidate. Subsequent Hydrolysis by water addition formed the desired phosphonamidates in moderate yields.
  • the 2-nitro-benzyl group is widely known as a photolabile substituent and has been shown to release attached molecules upon UV-irradiation. 20 From our expertise in phosphonamidate chemistry, we knew that the P-A/-Bond of the phosphonamidate the very labile once the Phosphonamidate ester is cleaved. Therefore we wanted to synthesize 2-nitro-benzyl substituted Phosphonamidates that enable the controlled light mediated release of an amine from the thiol addition conjugates.
  • 2-nitro-benzyl substituted phosphonamidates could be synthesized, including a photo cleavable biotin as well as a Cy5-dye and a DABCYL quencher variant.
  • An additional alkyne at the 2-nitro-benzyl group enables the installation of a third functionality to the system wire copper catalyzed click chemistry, which can be cleaved of again by photo irradiation.
  • Scheme 14 Isolated Yields of the staudinger phosphonite reaction between two different alkyne modified 2-nitro-benzyl vinyl phosphonites and phenyl azide.
  • Trifluoroethyl further reduces 12 to thirty minutes while 2-nitro benzyl reacts to fifty percent in two hours (Figure 13: Consumption of various W-phenyl vinyl phosphonamidates in the reaction with glutathione at pH 8.5. HPLC UV traces were taken at different time points. Experiments were performed in triplicates).
  • the protein was incubated with 50 equivalents of the phosphonamidate at 37 °C. Even though MALDI/MS analysis of the reaction mixture after 16 hours showed still unreacted protein, we were very pleased to observe formation of the desired protein conjugate.
  • Scheme 21 Photocleavable alkyne labeling of eGFP with one addressable cysteine with subsequent biotin labeling via CuACC and western blot analysis.
  • the conjugation yield of the peptide to the protein could be estimated to 60%.
  • the final construct was successfully immobilized on streptavidin beads.
  • the constructs can be released by either boiling the beads in SDS buffer, which releases the intact protein peptide conjugate or irradiation by UV light. The latter method cleaves the phosphonamidate ester, leading to instability of the P-N-Bond and therefore release of the unconjugated protein. Further experiments will be conducted with phosphonamidates that form intact esters upon light irradiation to release the conjugated construct upon light irradiation. b) Antibody conjugation with vinyl phosphonamidates
  • Vinyl phosphonamidates were also applied to the modification of monoclonal antibodies. As we found out that 2-nitro-benzyl substituted vinyl phosphonamidates react faster in the thiol addition, we chose those phosphonamidate with a biotin modification. Scheme 23: Reduction of antibody disulfides and subsequent modification with a biotin vinyl phosphonamidate.
  • Cysteine selective modification was further confirmed by tryptic digest of the cetuximab phosphonamidate conjugates, followed by MS/MS analysis. To simplify the MS/MS spectra, the modification was conducted under previously described conditions with the structurally simpler phenyl-A/-phenyl alkynyl phosphonamidate. Modification of Cys 264 and Cys 146 of the heavy chain could be confirmed by MS/MS (HCD fragmentation) while no modification was detected without prior reduction of the disulfide bonds.
  • FIG. 15 shows the sequences mentioned throughout this description.
  • Generic building blocks as the amino-modified derivative N2 or the NHS-ester N1 shown in Scheme 25 can introduce an alkyne-phosphonamidate moiety into functional molecules via amide bond forming reactions.
  • the compound was synthesized according to the general procedure 1 from 2.00 g 4- aminobenzoic acid (14.58 mmol) and obtained as a yellowish solid. (2.00 g, 12.26 mmol, 84.1 %)
  • the compound was synthesized according to the general procedure 2 from 173 ⁇ diethyl chlorophosphite (1.20 mmol, 1.20 eq.), 2.40 ml ethynylmagnesium bromide solution (0.5 M in THF (tetrahydrofuran), 1 .20 mmol, 1.20 eq.) and 260 mg 4-azidobenzoic-acid-A/- hydroxysuccinimide ester (1 .00 mmol, 1.00 eq.).
  • the crude phosphonamidate was purified by flash column chromatography on silicagel (100% EtOAc) and obtained as a yellowish solid. (225 mg, 0.643 mmol, 64.3%)
  • the compound was synthesized according to the general procedure 2 from 181 ⁇ diethyl chlorophosphite (1 .26 mmol, 1.20 eq.), 2.52 ml ethynylmagnesium bromide solution (0.5 M in THF, 1 .26 mmol, 1.20 eq.) and 322 mg 2-(4-azidophenyl)ethyl amine hydrochloride (1 .05 mmol, 1 .00 eq.).
  • the crude phosphonamidate was purified by preparative RP-HPLC (Method C described above) and obtained as brown oil. (209 mg, 0.57 mmol, 54.5%)
  • the reaction was carried out in DMF. 265 ⁇ of a 100 mM solution of Ethyl-A/-(4-(2,5-dioxo-1 - pyrrolidinyl)oxy-carbonyl-phenyl)-P-ethynyl phosphonamidate (0.0265 mmol, 1.00 eq.) and 1 .06 ml of a 50 mM solution of 5-((2-Aminoethyl)aminonaphthalene-1 -sulfonate (0.0530 mmol, 2.00 eq.) together with 795 ⁇ DMF was premixed and 530 ⁇ of a solution of 200 mM DIPEA (0.1060 mmol, 4.00 eq.) was added.
  • Cy5-COOH was synthesized according to a procedure, previously published by our lab (28). A 5-ml- round bottom flask was charged with 33.2 mg Cy5-COOH (0.0628 mmol, 1 .00 eq.), 35.8 mg HATU ((1 -[Bis(dimethylamino)methylene]-1 H-1 ,2,3-triazolo[4,5- b]pyridinium 3-oxid hexafluorophosphate), 0.0942 mmol, 1.5 eq.) and 200 ⁇ DMF.
  • the deep blue solution was cooled to 0 °C and 32 ⁇ DIPEA (A/,A/-diisopropylethylamine, 0.1884 mmol, 3.0 eq.) were added. After 5 minutes a solution of 23 mg Ethyl-A/-(4-(2-aminoethyl)phenyl)-P- ethynyl phosphonamidate TFA salt (0.0628 mmol, 1 .00 eq.) in 300 ⁇ DMF were added drop- wise. The solution was allowed to warm to room-temperature and stirred for 2 hours.
  • DIPEA A/,A/-diisopropylethylamine, 0.1884 mmol, 3.0 eq.
  • Figure 16 shows: A: Trastuzumab modification with three different Cys-reactive bitotin derivatives. Disulfide reduction was carried out with 1000 eq. DTT in 50 mM borate containing PBS for 30 miniutes at 37°C. Excess DTT was removed by size exclusion chromatography. Labelling was conducted with 35 eq. biotin derivative with a final DMSO content of 1 % in a Buffer containing 50 mM NH 4 HC0 3 and 1 mM EDTA, pH 8.5 for the amidate and PBS containing 1 mM EDTA, pH 7.4 for the other two compounds.
  • B Western blot analysis. Lane 1 and 5: untreated antibody. Lane 2-4: reactions with prior DTT treatment. Lane 6-8: Control reactions without prior DTT treatment.
  • Phosphonamidate-linked ADCs were generated from the very efficient antimitotic toxin MMAF and the FDA approved Her2-adressing antiproliferative antibody trastuzumab (Figure 17).
  • ADCs with a cathepsin B cleavage side were prepared between the antibody and the toxin.
  • Amidate-VC- PAB-MMAF constructs were synthesized based on a previously described procedure, as depicted in Scheme 27.
  • Scheme 27 Synthetic route for the contruction of phosphonamidate linked, cathepis B cleavable monomethyl auristatin F (MMAF) conjugates.
  • VC Valine-citrullin dipeptide
  • PAB p-aminobenzyl
  • PNP p-nitrophenyl carbonate.
  • Figure 17 shows: Trastuzumab modification with phosphonamidate modified, cathepsin cleavable MMAF (Amidate-VC-PAB-MMAF).
  • A Reaction scheme reduction and alkylation of interchain disulfides.
  • B SDS-PAGE analysis of the reaction.
  • C Deconvolutet MS spectra of the antibody fragments after deglaycosylation with PNGase F and reduction with DTT.
  • LC Light chain
  • HC Heavy chain
  • mod Amidate-VC-PAB-MMAF.
  • An average loading of 4.6 drug molecules per antibody was determined by ESI-MS after deglycosylation and reduction. We approximated the drug-to-antibody ratio (DAR) with the mass signal intensities of the heavy- and light-chain species bearing different degrees of modification.
  • DAR drug-to-antibody ratio
  • the obtained Phosphonamidate-ADC conjugates were evaluated in a previously established Her2 based proliferation assay with two different Her2-overexpressing cell lines BT474 and SKBR3 (30).
  • the Her2-non overexpressing cell line MDAMB468 was used as a control to proof Her2 selectivity.
  • Phosphonamidate-linked conjugates were compared to a maleimide- linked cathepsin B-cleavable trastumzumab MMAF conjugate.
  • Figure 18 shows: Increased antiproliferative potency of MMAF linked trastuzumab on two different Her2 overexpressing cell lines (BT474 and SKBR3) and one control (MDAMB468). Plots depict the number of proliferating cells after 4 days of antibody treatment in dependency of the antibody concentration. Trastuzumab alone (pink), trastuzumab- phosphonamidate-MMAF (blue) and trastuzumab-maleimide-MMAF (green).
  • the compound was synthesized according to the general procedure from 230 ⁇ diethyl chlorophosphite (0.925 mmol, 5.0 eq.), 1.85 ml ethynylmagnesium bromide solution (0.5 M in THF, 0.925 mmol, 5.0 eq.) and 97 mg A -(4-azidobenzoyl)-/--valine-/_-citrulline-4- aminobenzyl alcohol (0.185 mmol, 1.0 eq.).
  • the crude phosphonamidate was purified by preperative HPLC (method C described above under "Procedures for the introduction of the alkyne-phosphonamidate moiety by generic building blocks via an amide bond') and obtained as a white solid after lyophilisation. (60 mg, 0.098 mmol, 52.9 %).
  • a 5-ml round-bottom flask was charged with 31 mg A/-(4-(0-Ethyl-P-ethynyl- phosphonamidato-A/-benzoyl)-/--valine-/--citrulline-4-aminobenzyl alcohol (0.050 mmol, 1 .00 eq.) and 31 mg Bis(4-nitrophenyl) carbonate (0.101 mmol, 2.00 eq.).
  • the solids were dissolved in 140 ⁇ of DMF ( ⁇ , ⁇ -dimethylformamide) and 17.4 ⁇ DIPEA ⁇ N,N- diisopropylethylamine, 0.101 mmol, 2.00 eq.) were added.
  • a 15-mL falcon-tube was charged with 14.35 mg A/-(4-(0-Ethyl-P-ethynyl-phosphonamidato- A/-benzoyl)-/--valine-/--citrulline-4-aminobenzyl-4-nitrophenyl carbonate (0.0184 mmol, 1.00 eq.), 0.50 mg 1 -Hydroxybenzotriazol (0.0037 mmol, 0.20 eq.) and 13.15 mg MMAF (monomethylauristatin F, 0.0184 mmol, 1.00 eq.).
  • the solids were dissolved in 250 ml dry DMF and 25 ml pyridine and heated to 60 °C over-night.
  • Figure 19 shows the UPLC-UV purity of phosphonamidate-Val-Cit-Pab-MMAF.
  • MDAMB468 cells For MDAMB468 cells, a reduced amount of 2*10 3 cells were seeded in each well of a
  • the Her2-non overexpressing cell line MDAMB468 was used as a control to proof Her2 selectivity. Sufficient membrane staining after cell fixation was observed the two Her2- expressing cell lines, while the Her2-non expressing cell lines did not show increased fluorescence.
  • Figure 20 Depicted are immunostainings of fixed cells over expressing the cell surface receptorHer2 (BT474 and SKBR3) or exhibiting low Her2 expression levels (MDAMB468).
  • the AFC Trastuzumab-Amidate-Cy5 shows clear localization to the plasma membrane for Her2+ cell lines and no staining of Her2- cells.
  • the merged images show the DAPI signal in blue and the Tras- phosphonamidate-Cy5 signal in red. Scale bar represents 10 ⁇ .
  • Trastuzumab-Cy5 conjugates were synthesized according to the general procedure, described above under "Staudinger-induced thiol addition with alkynyl-phosphonites for the generation of Antibody Drug Conjugates (ADCs) with the following slight modifications: the amidate equivalents were raised to 130, and the DMSO (dimethylsulfoxide) content was raised to 5% (more precisely, from 2% to 5%) to solubilize the Cy5.
  • ADCs Antibody Drug Conjugates
  • BT474, SKBR3 and MDAMB468 were seeded on sterile cover slips and incubated ON at 37 °C, 5 % C02 for cell attachment.
  • Cells were washed three times with 1x PBS prior to fixation for 10 min in 1x PBS/4% PFA (formaldehyde). Fixation was stopped by the addition of an equal volume 1 x PBST (PBS + 0.05 % Tween20) followed by two more washes with PBST.
  • AFCs were added to a final concentration of 5 ⁇ g/mL and incubated for 1 h at RT. Unbound AFC was removed by three washes with PBS.
  • Images were acquired on a Leica SP5 confocal microscopy system equipped with a 63x1 .40 Oil immersion objective. Laserlines 405 nm and 594 nm were used in combination with standard DAPI and Cy5 filter settings. Image processing was carried out with ImageJ 1 .5.1 h software extended by the Fiji processing package.
  • Figure 21 shows: A: Structure of the phosphonamidate linked FRET conjugate.
  • B Structure of the maleimide linked FRET conjugate
  • C Principle of the fluorescence-quencher based readout. Conjugates were incubated at room temperature at a concentration of 10 ⁇ . Measurements were performed at least in triplicates in a 96-well plate.
  • D Fluorescence increase was monitored over time. HCI samples were neutralized before the measurements. Lysate was freshly prepared from HeLa-cells, lysed in PBS. Serum originated from human blood.
  • E Comparison of a phosphonamidate- and a maleimide-linked dye-quencher pair during exposure to 1000 eq. glutathion in PBS.
  • the phosphonamidate adducts show a high stability in PBS, HeLA cell lysate and human serum, whereas only strong acidic conditions (1 N HCI) lead to phosphonamidate bond cleavage.
  • the FRET-conjugates were also exposed to a high excess of glutathione. After 2 days of incubation with 1000 eq. of glutathione at physiological pH, 15% of the maleimide linkage was cleaved, while 99% of the phosphonamidate adducts were still intact (Figure 21 C).
  • Figure 22 shows: Transfer of the antibody modification to serum proteins.
  • A Tratuzumab- biotin conjugates were incubated at a concentration of 3 ⁇ with 500 ⁇ BSA in PBS at 37°C.
  • B Biotin transfer to albumin was monitored by western blot analysis.
  • Lane 1 Untreated maleimide conjugate.
  • Lane 2-5 Anlaysis of the BSA exposed maleimide adduct after 0, 1 , 2 and 5 days.
  • Lane 6 Untreated amidate conjugate.
  • Lane 6-10 Analysis of the BSA exposed amidate adduct after 0, 1 , 2 and 5 days.
  • DABCYI-Cys peptide was synthesized by standard Fmoc-based chemistry in a linear synthesis by manual coupling. 0.1 mmol of Rink amide resin (subst: 0.4 mmol/g) was added to a reaction vessel and synthesis was performed with five-fold amino acid excess. Fmoc deblocking was achieved by resin treatment with 20% piperidine in DMF twice for 5 minutes. Coupling was achieved by addition of HOBt/HBTU/DIPEA (5 eq./5 eq./10 eq) in DMF for 45 min. After the final Cys coupling, 5 eq. of the DABCYL acid was coupled with 5 eq. HATU and 10 eq.
  • a 1.5-ml Eppendorf tube was charged with 263 ⁇ of a solution of DABCYI-Cys peptide (20 mM) in 50 mM NH 4 HC0 3 at a pH of 8.5. 158 ⁇ 50 mM NH 4 HC0 3 at a pH of 8.5 and 105 ⁇ of a solution of EDANS amidate (100 mM) in DMF was added to give a final concentration of 20 mM peptide and 10 mM amidate in 20% DMF/Buffer. The tube was shaken at 800 rpm at room temperature for 3 h.
  • Stabilities studies were conducted in 96-well plate (Corning 3615, black with clear, flat bottom) at least in triplicates. 5 ⁇ of a 200 ⁇ Stock solution of the Dabcyl-EDANS adducts and 95 ⁇ of the respective test solutions were added to each well.
  • HeLa cell lysate was generated from approximately 1*10 7 cells, lysed in 400 ⁇ PBS by sonification. Cells were grown on a 75 cm 2 cell culture plate, washed twice with PBS and harvested with a cell scraper. Human serum was purchased from Sigma Aldrich. Glutathione was dissolved at a concentration of 10 mM in PBS and the pH was adjusted to 7.4. 1 N HCI studies were conducted at 200 ⁇ , neutralized to pH 7 and diluted to 10 ⁇ before fluorescence measurements.
  • Trstuzumab-Biotin conjugates were incubated at a consentration of 3 ⁇ in PBS with a final concentration of 0.5 mM BSA at 37 °C. Samples were drawn after 0, 1 , 2 and 5 days, deep frozen in liquid Nitrogen and finally subjected to SDS/Page and westernblot analysis.
  • Figure 23 shows: Determination of the second order rate constant of the thiol addition.
  • A Reaction of the EDANS phosphonamidate with glutathione.
  • B Fluorescence HPLC trace after 30 min reaction time.
  • C Monitoring of the phosphonamidate decrease over time.
  • Glutathione addition to the EDANS-phosphonamidate was conducted at a final concentration of 0.1 mM amidate, 0.1 mM glutathione and 0.02 mM EDANS as an internal standard in 50 mM NH 4 HC0 3 -buffer containing 1 mM EDTA at pH 8.5 with 1 % DMF.
  • 2.5 ⁇ of a 20 mM stock solution of EDANS-phosphonamidate in DMF was premixed with 488 ⁇ buffer and 5 ⁇ of a 2 mM stock solution of EDANS in a 1 :1 mixture of DMF and buffer.
  • the reaction was started by the addition of 5 ⁇ of a 10 mM solution of glutathione in buffer.
  • 10 ⁇ samples were drawn at 0, 15, 30, 60, 120, 240 and 480 minutes and acidified with 190 ⁇ 10 mM NaOAc- Buffer (pH 5.0) and subjected to fluorescence HPLC analysis.
  • the compound was synthesized according to the above "General procedure for the synthesis of O-substituted alkynyl phosphonamidates from bis(diisopropylamino)chlorophosphine" from 267 mg bis(diisopropylamino)chlorophosphine (1 .00 mmol, 1.00 eq.), 2.20 ml ethynylmagnesium bromide solution (0.5 M in THF, 1.10 mmol, 1.10 eq.), 1.06 g 2-(2- Hydroxyethoxy)ethan-1 -ol (10.00 mmol, 10.00 eq.), 5.56 ml 1 H-tetrazole solution (0.45 M in MeCN, 2.50 mmol) and purified by flash column chromatography on silicagel (5% MeOH in CH 2 CI 2 ). The compound was obtained as a yellowish oil. (1 12 mg, 0.421 mmol, 42.1 %).
  • the compound was synthesized according to the the above "General procedure for the synthesis of O-substituted alkynyl phosphonamidates from bis(diisopropylamino)chlorophosphine" from 267 mg bis(diisopropylamino)chlorophosphine (1 .00 mmol, 1 .00 eq.), 2.20 ml ethynylmagnesium bromide solution (0.5 M in THF, 1.10 mmol, 1 .10 eq.), 189 ⁇ 3-Butyn-1 -ol (2.50 mmol, 2.50 eq.), 5.56 ml 1 H-tetrazole solution (0.45 M in MeCN, 2.50 mmol) and purified by flash column chromatography on silicagel (10% EtOAC in n-hexane).
  • Staudinger phosphonite reaction with phosphonite E1 and E2 The highly stable nature of electron rich phosphonites was further exploited by performing the Staudinger phosphonite reaction with alkyne-phosphonites in aqueous solvents. As depicted in Figure 24, formation of the desired product from alkyne phosphonite E1 was observed in a pure aqueous system.
  • Figure 24 shows: Reaction of an azido modified peptide with the water soluble phosphonite E1 in Tris buffer.
  • A Reaction scheme.
  • B HPLC-trace; orange: starting material; blue: reaction after 2h.
  • Peptide E9 was synthesized by standard Fmoc-based chemistry in a linear synthesis by manual coupling. 0.1 mmol of Rink amide resin (subst: 0.4 mmol/g) was added to a reaction vessel and synthesis was performed with five-fold amino acid excess. Fmoc de-blocking was achieved by resin treatment with 20% piperidine in DMF twice for 5 minutes. Coupling was achieved by addition of HOBt/HBTU/DIPEA (5 eq./5 eq./10 eq) in DMF for 45 min. After the final Gly coupling, 5 eq. of the 4-azido benzoic acid was coupled with 5 eq. HATU and 10 eq. DIPEA in DMF for 45 min.
  • the peptide was cleaved of the resin by addition of TFA/TIS/H 2 0 (95/2.5/2.5, w,w,w) within 3 h. Subsequently, the peptide was precipitated by the addition of ice-cold diethyl ether. The precipitate was collected by centrifugation, dried and purified by preperative HPLC (method C described above under "Procedures for the introduction of the alkyne-phosphonamidate moiety by generic building blocks via an amide bond"). ESI-MS for C37H50NnO13 + [M+H] + calcd: 856.36, found 856.36.
  • cleavable disulfides can be used to liberate a specific payload under reducing conditions.
  • this approach has been applied to the specific release of a cytotoxic payload from an Antibody Drug Conjugate (ADC) within a cellular environment (31 ).
  • ADC Antibody Drug Conjugate
  • disulfides that carry a leaving group in the beta position undergo cyclisation to a thiirane after disulfide cleavage and liberate a given payload (32).
  • the compound was synthesized according to the above "General procedure 1 for the synthesis of 2-hydoxyethyl disulfides” from 2.00 ml Ethanethiol (27.74 mmol, 1.00 eq.), 1 .96 ml 2-mercaptoethanol (27.74 mmol, 1.00 eq.), 41 mg sodium iodide (0.28 mmol, 0.01 eq.) and 3.14 ml hydrogen peroxide solution (aqueous, 30%) (27.74 mmol, 1.00 eq.).
  • the disulfide was isolated by column chromatographie on silica (20% EtOAc in hexane) as colourless oil. Yield: 2.15 g (15.53 mmol, 56.0%).
  • the compound was synthesized according to the the above "General procedure 1 for the synthesis of 2-hydoxyethyl disulfides” from 2.00 ml isopropylthiol (21 .53 mmol, 1.00 eq.), 1 .52 ml 2-mercaptoethanol (21.53 mmol, 1.00 eq.), 32 mg sodium iodide (0.21 mmol, 0.01 eq.) and 2.44 ml hydrogen peroxide solution (aqueous, 30%) (21 .53 mmol, 1.00 eq.).
  • the disulfide was isolated by column chromatographie on silica (10% EtOAc in hexane) as colourless oil.
  • the compound was synthesized according to the above "General procedure 2 for the synthesis of O-substituted alkynyl phosphonites from bis(diisopropylamino)chlorophosphine" from 1 16 mg bis(diisopropylamino)chlorophosphine (0.44 mmol, 1.00 eq.), 0.96 ml ethynylmagnesium bromide solution (0.5 M in THF, 0.48 mmol, 1.10 eq.), 150 mg 2- Hydroxyethyl ethyldisulfide (1.10 mmol, 2.50 eq.), 2.42 ml 1 /-/-tetrazole solution (0.45 M in MeCN, 1 .10 mmol, 2.50 eq.) and purified by flash column chromatography on silicagel (10% to 20% EtOAc in hexane). The compound was obtained as yellowish oil. (1 12 mg, 0.34 mmol, 77
  • the compound was synthesized according to the above "General procedure 2 for the synthesis of O-substituted alkynyl phosphonites from bis(diisopropylamino)chlorophosphine" from 213 mg bis(diisopropylamino)chlorophosphine (0.80 mmol, 1.00 eq.), 1.76 ml ethynylmagnesium bromide solution (0.5 M in THF, 0.88 mmol, 1.10 eq.), 370 mg 2- Hydroxyethyl isopropyldisulfide (2.00 mmol, 2.50 eq.), 4.44 ml 1 H-tetrazole solution (0.45 M in MeCN, 2.00 mmol, 2.50 eq.) and purified by flash column chromatography on silicagel (10% EtOAc in hexane).
  • the compound was synthesized according to the above "General procedure 2 for the synthesis of O-substituted alkynyl phosphonites from bis(diisopropylamino)chlorophosphine" from 167 mg bis(diisopropylamino)chlorophosphine (0.63 mmol, 1.00 eq.), 1.38 ml ethynylmagnesium bromide solution (0.5 M in THF, 0.69 mmol, 1.10 eq.), 260 mg 2- Hydroxyethyl tert-butyldisulfide (1.57 mmol, 2.50 eq.), 3.48 ml 1 /-/-tetrazole solution (0.45 M in MeCN, 1 .57 mmol, 2.50 eq.) and purified by flash column chromatography on silicagel (10% EtOAc in hexane). The compound was obtained as yellowish oil. (190 mg, 0.49 mmol,
  • the compound was synthesized according to the above "General procedure 2 for the synthesis of O-substituted alkynyl phosphonites from bis(diisopropylamino)chlorophosphine" from 267 mg bis(diisopropylamino)chlorophosphine (1 .00 mmol, 1 .00 eq.), 2.20 ml ethynylmagnesium bromide solution (0.5 M in THF, 1 .10 mmol, 1 .10 eq.), 415 mg 2-(3- Hydroxypropyl) isopropyl disulfide (2.50 mmol, 2.50 eq.), 5.55 ml 1 A7-tetrazole solution (0.45 M in MeCN, 2.50 mmol, 2.50 eq.) and purified by flash column chromatography on silicagel (0-10% EtOAc in hexane). The compound was obtained as a diastereomeric mixture as yellowish oil.
  • the compound was synthesized according to the above "General procedure 2 for the synthesis of O-substituted alkynyl phosphonites from bis(diisopropylamino)chlorophosphine" from 267 mg bis(diisopropylamino)chlorophosphine (1 .00 mmol, 1 .00 eq.), 2.20 ml ethynylmagnesium bromide solution (0.5 M in THF, 1 .10 mmol, 1 .10 eq.), 415 mg 2-(3- Hydroxypropyl) isopropyl disulfide (2.50 mmol, 2.50 eq.), 5.55 ml 1 H-tetrazole solution (0.45 M in MeCN, 2.50 mmol, 2.50 eq.) and purified by flash column chromatography on silicagel (30% EtOAc in hexane).
  • the compound was synthesized according to the above "General procedure 2 for the synthesis of O-substituted alkynyl phosphonites from bis(diisopropylamino)chlorophosphine" from 98 mg bis(diisopropylamino)chlorophosphine (0.37 mmol, 1 .00 eq.), 0.80 ml ethynylmagnesium bromide solution (0.5 M in THF, 0.4 mmol, 1 .10 eq.), 195 mg 1 -(4- (hydroxymethyl)phenyl)-2-phenyldiazene (0.93 mmol, 2.50 eq.), 2.00 ml 1 A7-tetrazole solution (0.45 M in MeCN, 0.93 mmol, 2.50 eq.) and purified by flash column chromatography on silicagel (0-10% EtOAc in hexane). The compound was obtained as orange solid. (82 mg, 0.171
  • the compound was synthesized according to the above "General procedure 3 for the synthesis of O-substituted alkynyl phosphonamidates from alkynyl phosphonites and azides" from 147 mg Di-(2-isopropyl disulfido)ethyl) ethynylphosphonite (0.41 1 mmol, 1.00 eq.) and 106 mg 4-azidobenzoic-acid-A/-hydroxysuccinimide ester (0.41 1 mmol, 1.00 eq.) and purified by flash column chromatography on silicagel (60% EtOAc in hexane). The compound was obtained as colourless oil. (80 mg, 0.175 mmol, 42.6%).
  • the compound was synthesized according to the the above "General procedure 3 for the synthesis of O-substituted alkynyl phosphonamidates from alkynyl phosphonites and azides" from 50 mg Di-(2- iert-butyl disulfido)ethyl) ethynylphosphonite (0.129 mmol, 1.00 eq.) and 33 mg 4-azidobenzoic-acid-A/-hydroxysuccinimide ester (0.129 mmol, 1.00 eq.) and purified by flash column chromatography on silicagel (70% EtOAc in hexane). The compound was obtained as colourless solid. (29 mg, 0.0638 mmol, 47.4%).
  • the compound was synthesized according to the above "General procedure 3 for the synthesis of O-substituted alkynyl phosphonamidates from alkynyl phosphonites and azides" from 61 mg Di-((2-isopropyl disulfido)-3-propyl) ethynylphosphonite (0.158 mmol, 1.00 eq.) and 40 mg 4-azidobenzoic-acid-A/-hydroxysuccinimide ester (0.158 mmol, 1.00 eq.) and purified by flash column chromatography on silicagel (70% EtOAc in hexane). The compound was obtained as mixture of diastereomers as colourless oil. (32 mg, 0.068 mmol, 43.0%).
  • the compound was synthesized according to the above "General procedure 3 for the synthesis of O-substituted alkynyl phosphonamidates from alkynyl phosphonites and azides" from 103 mg Di-(4-acetoxy benzyl) ethynylphosphonite (0.267 mmol, 1.00 eq.) and 69 mg 4- azidobenzoic-acid-A/-hydroxysuccinimide ester (0.267 mmol, 1.00 eq.) and purified by flash column chromatography on silicagel (70% EtOAc in hexane). The compound was obtained as colourless oil. (36 mg, 0.077 mmol, 28.7%).
  • the compound was synthesized according to the above "General procedure 3 for the synthesis of O-substituted alkynyl phosphonamidates from alkynyl phosphonites and azides" from 71 mg Di (4-(diazophenyl)-benzyl) ethynylphosphonite (0.148 mmol, 1.00 eq.) and 39 mg 4-azidobenzoic-acid-A/-hydroxysuccinimide ester (0.148 mmol, 1.00 eq.) and purified by flash column chromatography on silicagel (50% EtOAc in hexane). The compound was obtained as orange solid. (58 mg, 0.1 12 mmol, 75.8%).
  • the compound was synthesized according to the above "General procedure 4 for the amide bond formation between phosphonamidate-NHS esters and EDANS" from 10 mg 2-iert-butyl- disulfido-ethyl-A/-(4-benzoic-acid-A/-hydroxysuccinimide ester)-P-ethynyl phosphonamidate (0.021 mmol, 1 .00 eq.), 7 mg 5-((2-Aminoethyl)aminonaphthalene-1 -sulfonate sodium salt (0.025 mmol, 1 .20 eq.) and 15 ⁇ DIPEA (0.084 mmol, 4.0 eq.) and purified by semi- preperative HPLC (method E described above under "Procedures for the introduction of the alkyne-phosphonamidate moiety by generic building blocks via an amide bond"). The compound was obtained as white solid. (8 mg, 0.013 mmol, 62,3%).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Oncology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Analytical Chemistry (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Low-Molecular Organic Synthesis Reactions Using Catalysts (AREA)
PCT/EP2017/071937 2016-09-01 2017-09-01 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates Ceased WO2018041985A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
EP17772314.5A EP3506949A1 (en) 2016-09-01 2017-09-01 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates
CN202311230447.3A CN117903297A (zh) 2016-09-01 2017-09-01 化学选择性的巯基与烯基或炔基磷酰胺的偶联
JP2019512835A JP7217225B2 (ja) 2016-09-01 2017-09-01 アルケンホスホンアミデートまたはアルキンホスホンアミデートとの化学選択的チオールコンジュゲーション
CA3032251A CA3032251C (en) 2016-09-01 2017-09-01 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates
US16/328,199 US11161873B2 (en) 2016-09-01 2017-09-01 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates
CN201780053946.6A CN109689112B (zh) 2016-09-01 2017-09-01 化学选择性的巯基与烯基或炔基磷酰胺的偶联
AU2017320913A AU2017320913B2 (en) 2016-09-01 2017-09-01 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates
US17/460,791 US11746124B2 (en) 2016-09-01 2021-08-30 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates
JP2023007868A JP2023055766A (ja) 2016-09-01 2023-01-23 アルケンホスホンアミデートまたはアルキンホスホンアミデートとの化学選択的チオールコンジュゲーション
US18/349,727 US12171837B2 (en) 2016-09-01 2023-07-10 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates
US18/960,256 US20250090672A1 (en) 2016-09-01 2024-11-26 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP16001917.0 2016-09-01
EP16001917 2016-09-01

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/328,199 A-371-Of-International US11161873B2 (en) 2016-09-01 2017-09-01 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates
US17/460,791 Division US11746124B2 (en) 2016-09-01 2021-08-30 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates

Publications (1)

Publication Number Publication Date
WO2018041985A1 true WO2018041985A1 (en) 2018-03-08

Family

ID=56888890

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2017/071937 Ceased WO2018041985A1 (en) 2016-09-01 2017-09-01 Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates

Country Status (6)

Country Link
US (4) US11161873B2 (https=)
EP (1) EP3506949A1 (https=)
JP (2) JP7217225B2 (https=)
CN (2) CN117903297A (https=)
AU (1) AU2017320913B2 (https=)
WO (1) WO2018041985A1 (https=)

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109666044A (zh) * 2018-07-04 2019-04-23 浙江大学 基于[2.2]对环芳烷骨架的有机磷化合物及其中间体和制备方法与用途
WO2019170710A3 (en) * 2018-03-07 2019-10-24 Forschungsverbund Berlin E.V. Chemoselective thiol-conjugation with alkene or alkyne-phosphonothiolates and -phosphonates
WO2021263087A3 (en) * 2020-06-26 2022-02-10 Yale University Compositions and methods for selective detection and inhibition of bacterial pathogens
WO2022180242A2 (en) 2021-02-26 2022-09-01 Forschungsverbund Berlin E.V. Cellular uptake of large biomolecules enabled by cell-surface-reactive cell-penetrating peptide additives
WO2022223783A1 (en) 2021-04-23 2022-10-27 Forschungsverbund Berlin E.V. Thiol-conjugation with unsaturated phosphorus(v) compounds
WO2023083919A1 (en) 2021-11-09 2023-05-19 Tubulis Gmbh Conjugates comprising a phosphorus (v) and a camptothecin moiety
WO2023083900A1 (en) 2021-11-09 2023-05-19 Tubulis Gmbh Conjugates comprising a phosphorus (v) and a drug moiety
WO2023105087A1 (en) 2021-12-10 2023-06-15 Tubulis Gmbh Novel flt3 antibodies and antibody-drug-conjugates based thereon, therapeutic methods and uses thereof in combination with tyrosine kinase inhibitors
EP4065112A4 (en) * 2019-11-22 2023-12-27 The Regents of the University of California Taspase1 inhibitors and uses thereof
WO2024083953A1 (en) 2022-10-18 2024-04-25 Tubulis Gmbh Novel anti-tpbg antibody and antibody-drug-conjugates based thereon, therapeutic methods and uses thereof
WO2024083925A2 (en) 2022-10-18 2024-04-25 Tubulis Gmbh Novel anti-napi2b antibodies and antibody-drug-conjugates based thereon, therapeutic methods and uses thereof
WO2024083926A1 (en) 2022-10-18 2024-04-25 Tubulis Gmbh Novel antibody drug conjugates with novel napi2b antibodies, therapeutic methods and uses thereof
WO2024133845A1 (en) 2022-12-22 2024-06-27 Tubulis Gmbh Conjugates comprising a phosphorus(v) moiety and a drug
WO2025046090A1 (en) 2023-09-01 2025-03-06 Tubulis Gmbh Methods of preparing phosphonamidate compounds
WO2025146313A1 (en) 2024-01-04 2025-07-10 Deutsches Krebsforschungszentrum Phosphinites as reductive disulfide rebridging agents
WO2025184211A1 (en) 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibody drug conjugates

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN119451970A (zh) 2022-06-27 2025-02-14 埃维克斯塔生物公司 用于治疗癌症的n-取代的吲哚衍生物及其偶联物
CN119391070A (zh) * 2024-11-28 2025-02-07 宁波卡倍亿新材料科技有限公司 一种新能源汽车耐高温阻燃电缆料及其制备方法

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2535174A (en) 1949-04-07 1950-12-26 Us Rubber Co Mercaptoethanephosphonates
DE2024250A1 (de) * 1970-05-19 1971-12-02 Farbwerke Hoechst AG, vorm. Meister Lucius & Brüning, 6000 Frankfurt Antimikrobielle grenzflächenaktive Mittel
WO1997008320A1 (en) 1995-08-18 1997-03-06 Morphosys Gesellschaft Für Proteinoptimierung Mbh Protein/(poly)peptide libraries
US20100120719A1 (en) * 2008-11-13 2010-05-13 Taigen Biotechnology Co., Ltd. Lyophilization formulation
WO2015169784A1 (de) 2014-05-09 2015-11-12 Bayer Pharma Aktiengesellschaft Verfahren zur gezielten konjugation von peptiden und proteinen mittels paarweiser c2-verbrückung von cystein-aminosäuren

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102058547A (zh) * 2009-11-12 2011-05-18 太景生物科技股份有限公司 冻干制剂
US10036010B2 (en) * 2012-11-09 2018-07-31 Innate Pharma Recognition tags for TGase-mediated conjugation
EP2935608A1 (en) * 2013-10-14 2015-10-28 SynAffix B.V. Modified glycoprotein, protein-conjugate and process for the preparation thereof

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2535174A (en) 1949-04-07 1950-12-26 Us Rubber Co Mercaptoethanephosphonates
DE2024250A1 (de) * 1970-05-19 1971-12-02 Farbwerke Hoechst AG, vorm. Meister Lucius & Brüning, 6000 Frankfurt Antimikrobielle grenzflächenaktive Mittel
WO1997008320A1 (en) 1995-08-18 1997-03-06 Morphosys Gesellschaft Für Proteinoptimierung Mbh Protein/(poly)peptide libraries
US20100120719A1 (en) * 2008-11-13 2010-05-13 Taigen Biotechnology Co., Ltd. Lyophilization formulation
WO2015169784A1 (de) 2014-05-09 2015-11-12 Bayer Pharma Aktiengesellschaft Verfahren zur gezielten konjugation von peptiden und proteinen mittels paarweiser c2-verbrückung von cystein-aminosäuren

Non-Patent Citations (43)

* Cited by examiner, † Cited by third party
Title
A. J. PEREZ; F. WESCHE; H. ADIHOU; H. B. BODE, CHEMISTRY- A EUROPEAN JOURNAL, vol. 22, 2016, pages 639 - 645
A. SATYAM, BIOORG. MED. CHEM. LETT., vol. 18, 2008, pages 3196 - 3199
A. STENGL; D. HORL; H. LEONHARDT; J. HELMA, SLAS DISCOVERY, vol. 22, 2017, pages 309 - 315
AGARD, N. J.; PRESCHER, J. A.; BERTOZZI, C. R., J. AM. CHEM. SOC., vol. 126, no. 46, 2004, pages 15046
ARTNER, L. M.; MERKEL, L.; BOHLKE, N.; BECEREN-BRAUN, F.; WEISE, C.; DERNEDDE, J.; BUDISA, N.; HACKENBERGER, C. P. R., CHEM. COMMUN., vol. 48, no. 4, 2012, pages 522
BARLTROP, J. A.; PLANT, P. J.; SCHOFIELD, P., CHEM. COMMUN. (LONDON, 1966, pages 822
CHALKER, J. M.; BERNARDES, G. J. L.; LIN, Y. A.; DAVIS, B. G., CHEM. - AN ASIAN J., vol. 4, no. 5, 2009, pages 630
CHRISTOPHER R. BEHRENS ET AL: "Antibody-Drug Conjugates (ADCs) Derived from Interchain Cysteine Cross-Linking Demonstrate Improved Homogeneity and Other Pharmacological Properties over Conventional Heterogeneous ADCs", MOLECULAR PHARMACEUTICS, vol. 12, no. 11, 2 November 2015 (2015-11-02), US, pages 3986 - 3998, XP055367351, ISSN: 1543-8384, DOI: 10.1021/acs.molpharmaceut.5b00432 *
DORONINA, S. O.; TOKI, B. E.; TORGOV, M. Y.; MENDELSOHN, B. A; CERVENY, C. G.; CHACE, D. F.; DEBLANC, R. L.; GEARING, R. P.; BOVEE, NAT. BIOTECH., vol. 21, no. 7, 2003, pages 778
ERIK S. ZIMMERMAN ET AL: "Production of Site-Specific Antibody-Drug Conjugates Using Optimized Non-Natural Amino Acids in a Cell-Free Expression System", BIOCONJUGATE CHEMISTRY, vol. 25, no. 2, 17 January 2014 (2014-01-17), pages 351 - 361, XP055107336, ISSN: 1043-1802, DOI: 10.1021/bc400490z *
FENG GAO ET AL: "Synthesis of a Phosphonate-Linked Aminoglycoside-Coenzyme A Bisubstrate and Use in Mechanistic Studies of an Enzyme Involved in Aminoglycoside Resistance", CHEMISTRY - A EUROPEAN JOURNAL, vol. 15, no. 9, 16 February 2009 (2009-02-16), pages 2064 - 2070, XP055092919, ISSN: 0947-6539, DOI: 10.1002/chem.200802172 *
G.-M. FANG; J.-X. WANG; L. LIU, ANGEW. CHEM., INT. ED., vol. 51, 2012, pages 10347 - 10350
GUNNOO, S. B.; MADDER, A., CHEMBIOCHEM., vol. 17, 2016, pages 529 - 553
H. D. HERCE; D. SCHUMACHER; A. F. L. SCHNEIDER; A. K. LUDWIG; F. A. MANN; M. FILLIES; M.-A. KASPER; S. REINKE; E. KRAUSE; H. LEONH, NAT CHEM, 2017
HACKENBERGER, C. P. R.; SCHWARZER, D., ANGEW. CHEMIE -INT., vol. 47, no. 52, 2008, pages 10030
HOESL, M. G.; BUDISA, N., ANGEW. CHEMIE -INT. ED., vol. 50, no. 13, 2011, pages 2896
J. I. DEGRAW; J. S. ENGSTROM, JOURNAL OF LABELLED COMPOUNDS, vol. 11, 1975, pages 233 - 239
KHOREV, O.; STOKMAIER, D.; SCHWARDT, O.; CUTTING, B.; ERNST, B., BIOORGANIC MED. CHEM., vol. 16, no. 9, 2008, pages 5216
L. R. STABEN; S. G. KOENIG; S. M. LEHAR; R. VANDLEN; D. ZHANG; J. CHUH; S.-F. YU; C. NG; J. GUO; Y. LIU, NAT CHEM, vol. 8, 2016, pages 1112 - 1119
L. W. C. MILES; L. N. OWEN, JOURNAL OF THE CHEMICAL SOCIETY (RESUMED, 1952, pages 817 - 826
LANG, K.; CHIN, J. W., ACS CHEM. BIOL., vol. 9, no. 1, 2014, pages 16
M. M. DCONA; D. MITRA; R. W. GOEHE; D. A. GEWIRTZ; D. A. LEBMAN; M. C. T. HARTMAN, CHEM. COMMUN. (CAMBRIDGE, U. K., vol. 48, 2012, pages 4755 - 4757
M. ROBERT J. VALLÉE ET AL: "Alkyne Phosphonites for Sequential Azide-Azide Couplings", ANGEWANDTE CHEMIE INTERNATIONAL EDITION, vol. 52, no. 36, 16 July 2013 (2013-07-16), pages 9504 - 9508, XP055433587, ISSN: 1433-7851, DOI: 10.1002/anie.201302462 *
NIKIC, I.; PLASS, T.; SCHRAIDT, O.; SZYMASKI, J.; BRIGGS, J. A. G.; SCHULTZ, C.; LEMKE, E. A., ANGEW. CHEMIE - INT. ED., vol. 53, no. 8, 2014, pages 2245
ORTIAL, S.; MONTCHAMP, J. L., ORG. LETT., vol. 13, no. 12, 2011, pages 3134
P. FATAS; E. LONGO; F. RASTRELLI; M. CRISMA; C. TONIOLO; A. I. JIMENEZ; C. CATIVIELA; A. MORETTO, CHEMISTRY- A EUROPEAN JOURNAL, vol. 17, 2011, pages 12606 - 12611
PARK, C.; LEE, K.; KIM, C., ANGEW. CHEMIE - INT. ED., vol. 48, no. 7, 2009, pages 1275
PATTERSON, D. M.; NAZAROVA, L. A.; PRESCHER, J. A., ACS CHEM. BIOL., vol. 9, no. 3, 2014, pages 592
PFAFF, M.; TANGEMANN, K.; MULLER, B.; GURRATH, M.; MULLER, G.; KESSLER, H.; TIMPL, R.; ENGEL, J., J. BIOL. CHEM., vol. 269, no. 32, 1994, pages 20233
PIERRA ROUVIÈRE CLAIRE ET AL: "Synthesis of potent and broad genotypically active NS5B HCV non-nucleoside inhibitors binding to the thumb domain allosteric site 2 of the viral polymerase", BIOORGANIC & MEDICINAL CHEMISTRY LETTERS, PERGAMON, AMSTERDAM, NL, vol. 26, no. 18, 22 January 2016 (2016-01-22), pages 4536 - 4541, XP029695099, ISSN: 0960-894X, DOI: 10.1016/J.BMCL.2016.01.042 *
PUDOVIK, A. N.; BATYEVA, E. S.; OFITSEROV, E. N.: "On the reaction of dialkyl arylphosphoramidites with chloroacetone", ZHURNAL OBSHCHEI KHIMII, vol. 46, no. 2, 1976, pages 227 - 229, XP009502261 *
S. O. DORONINA; B. E. TOKI; M. Y. TORGOV; B. A. MENDELSOHN; C. G. CERVENY; D. F. CHACE; R. L. DEBLANC; R. P. GEARING; T. D. BOVEE;, NAT BIOTECH, vol. 21, 2003, pages 778 - 784
SHIRO KOBAYASHI ET AL: "Hydrogen-Transfer Alternating Copolymerization of P-Ethenyl-N-n-propylphosphonamidic Acid Ethyl Ester with Cyclic Phosphonites Involving Oxidation-Reduction Process", POLYMER JOURNAL, 15 September 1991 (1991-09-15), pages 1099 - 1104, XP055433603, Retrieved from the Internet <URL:https://www.nature.com/articles/pj1991131.pdf> [retrieved on 20171208] *
SLETTEN, E. M.; BERTOZZI, C. R., ANGEW. CHEMIE - INT. ED., vol. 48, no. 38, 2009, pages 6974
SPICER, C. D.; DAVIS, B. G., NAT. COMMUN., vol. 5, 2014, pages 4740
T. H. PILLOW; J. D. SADOWSKY; D. ZHANG; S.-F. YU; G. DEL ROSARIO; K. XU; J. HE; S. BHAKTA; R. OHRI; K. R. KOZAK, CHEMICAL SCIENCE, vol. 8, 2017, pages 366 - 370
T. K. CLAUS; S. TELITEL; A. WELLE; M. BASTMEYER; A. P. VOGT; G. DELAITTRE; C. BARNER-KOWOLLIK, CHEM. COMMUN. (CAMBRIDGE, U. K., vol. 53, 2017, pages 1599 - 1602
VALLEE, M. R. J.; ARTNER, L. M.; DERNEDDE, J.; HACKENBERGER, C. P. R., ANGEW. CHEMIE - INT. ED., vol. 52, no. 36, 2013, pages 9504
VALLEE, M. R. J.; MAJKUT, P.; KRAUSE, D.; GERRITS, M.; HACKENBERGER, C. P. R., CHEMISTRY, vol. 21, no. 3, 2015, pages 970
VALLEE, M. R. J.; MAJKUT, P.; WILKENING, I.; WEISE, C.; MULLER, G.; HACKENBERGER, C. P. R., ORG. LETT., vol. 13, no. 20, 2011, pages 5440
VAN KASTEREN, S. I.; KRAMER, H. B.; JENSEN, H. H.; CAMPBELL, S. J.; KIRKPATRICK, J.; OLDHAM, N. J.; ANTHONY, D. C.; DAVIS, B. G., NATURE, vol. 446, no. 7139, 2007, pages 1105
WITTE, C.; MARTOS, V.; ROSE, H. M.; REINKE, S.; KLIPPEL, S.; SCHRODER, L.; HACKENBERGER, C. P. R., ANGEW. CHEMIE -INT. ED., vol. 54, no. 9, 2015, pages 2806
Y. CHEN; A. S. KAMLET; J. B. STEINMAN; D. R. LIU, NAT CHEM, vol. 3, 2011, pages 146 - 153

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019170710A3 (en) * 2018-03-07 2019-10-24 Forschungsverbund Berlin E.V. Chemoselective thiol-conjugation with alkene or alkyne-phosphonothiolates and -phosphonates
US12453779B2 (en) 2018-03-07 2025-10-28 Forschungsverbund Berlin E.V. Chemoselective thiol-conjugation with alkene or alkyne-phosphonothiolates and -phosphonates
AU2019232602B2 (en) * 2018-03-07 2025-03-27 Forschungsverbund Berlin E.V. Chemoselective thiol-conjugation with alkene or alkyne-phosphonothiolates and -phosphonates
CN109666044B (zh) * 2018-07-04 2021-03-05 浙江大学 基于[2.2]对环芳烷骨架的有机磷化合物及其中间体和制备方法与用途
CN109666044A (zh) * 2018-07-04 2019-04-23 浙江大学 基于[2.2]对环芳烷骨架的有机磷化合物及其中间体和制备方法与用途
EP4065112A4 (en) * 2019-11-22 2023-12-27 The Regents of the University of California Taspase1 inhibitors and uses thereof
WO2021263087A3 (en) * 2020-06-26 2022-02-10 Yale University Compositions and methods for selective detection and inhibition of bacterial pathogens
WO2022180242A2 (en) 2021-02-26 2022-09-01 Forschungsverbund Berlin E.V. Cellular uptake of large biomolecules enabled by cell-surface-reactive cell-penetrating peptide additives
WO2022223783A1 (en) 2021-04-23 2022-10-27 Forschungsverbund Berlin E.V. Thiol-conjugation with unsaturated phosphorus(v) compounds
WO2023083900A1 (en) 2021-11-09 2023-05-19 Tubulis Gmbh Conjugates comprising a phosphorus (v) and a drug moiety
WO2023083919A1 (en) 2021-11-09 2023-05-19 Tubulis Gmbh Conjugates comprising a phosphorus (v) and a camptothecin moiety
WO2023105087A1 (en) 2021-12-10 2023-06-15 Tubulis Gmbh Novel flt3 antibodies and antibody-drug-conjugates based thereon, therapeutic methods and uses thereof in combination with tyrosine kinase inhibitors
WO2024083953A1 (en) 2022-10-18 2024-04-25 Tubulis Gmbh Novel anti-tpbg antibody and antibody-drug-conjugates based thereon, therapeutic methods and uses thereof
WO2024083925A2 (en) 2022-10-18 2024-04-25 Tubulis Gmbh Novel anti-napi2b antibodies and antibody-drug-conjugates based thereon, therapeutic methods and uses thereof
WO2024083926A1 (en) 2022-10-18 2024-04-25 Tubulis Gmbh Novel antibody drug conjugates with novel napi2b antibodies, therapeutic methods and uses thereof
WO2024133845A1 (en) 2022-12-22 2024-06-27 Tubulis Gmbh Conjugates comprising a phosphorus(v) moiety and a drug
WO2025046090A1 (en) 2023-09-01 2025-03-06 Tubulis Gmbh Methods of preparing phosphonamidate compounds
WO2025146313A1 (en) 2024-01-04 2025-07-10 Deutsches Krebsforschungszentrum Phosphinites as reductive disulfide rebridging agents
WO2025184211A1 (en) 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibody drug conjugates
US12521446B2 (en) 2024-02-27 2026-01-13 Bristol-Myers Squibb Company Anti-CEACAM5 antibody drug conjugates

Also Published As

Publication number Publication date
US11746124B2 (en) 2023-09-05
AU2017320913B2 (en) 2024-08-15
US20230348529A1 (en) 2023-11-02
CN109689112A (zh) 2019-04-26
US20220106356A1 (en) 2022-04-07
US12171837B2 (en) 2024-12-24
AU2017320913A1 (en) 2019-02-07
US20190330264A1 (en) 2019-10-31
CN117903297A (zh) 2024-04-19
CA3032251A1 (en) 2018-03-08
CN109689112B (zh) 2023-10-13
JP2023055766A (ja) 2023-04-18
US11161873B2 (en) 2021-11-02
EP3506949A1 (en) 2019-07-10
JP7217225B2 (ja) 2023-02-02
US20250090672A1 (en) 2025-03-20
JP2019532041A (ja) 2019-11-07

Similar Documents

Publication Publication Date Title
US12171837B2 (en) Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates
AU2019232602B2 (en) Chemoselective thiol-conjugation with alkene or alkyne-phosphonothiolates and -phosphonates
ES2910699T3 (es) Inmunoglobulinas conjugadas con lisina C-terminal
US20240350655A1 (en) Thiol-conjugation with unsaturated phosphorus(v) compounds
EP3166645B1 (en) Site selective conjugation of an oligonucleotide conjugate to a metal binding protein
US20200040392A1 (en) Method for labeling of aldehyde containing target molecules
Dirin et al. Fragment-based solid-phase assembly of oligonucleotide conjugates with peptide and polyethylene glycol ligands
CA3032251C (en) Chemoselective thiol-conjugation with alkene or alkyne-phosphonamidates
RU2825582C2 (ru) Хемоселективная тиол-конъюгация с алкен- или алкин-фосфонотиолатами и -фосфонатами
RU2825582C9 (ru) Хемоселективная тиол-конъюгация с алкен- или алкин-фосфонотиолатами и -фосфонатами
Kasper Chemoselective synthesis of functional drug conjugates Dissertation zur Erlangung des akademischen Grades doctor rerum naturalium (Dr. rer. nat.) im Fach: Chemie Spezialisierung: Organische und Bioorganische Chemie eingereicht an der

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17772314

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3032251

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2017320913

Country of ref document: AU

Date of ref document: 20170901

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019512835

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017772314

Country of ref document: EP

Effective date: 20190401