WO2018031531A1 - Bactéries modifiées pour imagerie non invasive et applications thérapeutiques - Google Patents

Bactéries modifiées pour imagerie non invasive et applications thérapeutiques Download PDF

Info

Publication number
WO2018031531A1
WO2018031531A1 PCT/US2017/045869 US2017045869W WO2018031531A1 WO 2018031531 A1 WO2018031531 A1 WO 2018031531A1 US 2017045869 W US2017045869 W US 2017045869W WO 2018031531 A1 WO2018031531 A1 WO 2018031531A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
engineered bacterium
amino acid
subject
reactive functional
Prior art date
Application number
PCT/US2017/045869
Other languages
English (en)
Other versions
WO2018031531A4 (fr
Inventor
Noemie-Manuelle Dorval Courchesne
Neel Satish JOSHI
Chaochen LU
Original Assignee
President And Fellows Of Harvard College
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by President And Fellows Of Harvard College filed Critical President And Fellows Of Harvard College
Publication of WO2018031531A1 publication Critical patent/WO2018031531A1/fr
Publication of WO2018031531A4 publication Critical patent/WO2018031531A4/fr

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66—Microorganisms or materials therefrom
    • A61K35/74—Bacteria
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00—Preparations for testing in vivo
    • A61K49/001—Preparation for luminescence or biological staining
    • A61K49/0013—Luminescence
    • A61K49/0017—Fluorescence in vivo
    • A61K49/0019—Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules
    • A61K49/0021—Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules the fluorescent group being a small organic molecule
    • A61K49/0032—Methine dyes, e.g. cyanine dyes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00—Preparations for testing in vivo
    • A61K49/001—Preparation for luminescence or biological staining
    • A61K49/0013—Luminescence
    • A61K49/0017—Fluorescence in vivo
    • A61K49/005—Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
    • A61K49/0052—Small organic molecules
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/67—General methods for enhancing the expression
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/93—Ligases (6)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/02—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving viable microorganisms
    • C12Q1/04—Determining presence or kind of microorganism; Use of selective media for testing antibiotics or bacteriocides; Compositions containing a chemical indicator therefor
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the technology described herein relates to engineered bacteria comprising proteins that are capable of being labeled in vivo and methods for using the bacteria for diagnostic and therapeutic purposes.
  • Embodiments of the present disclosure are directed to engineered or genetically altered microbes, such as Escherichia coli, that produce proteins comprising a nonstandard amino acid.
  • the nonstandard amino acid can be labeled with a detectable substance before or after administration to the subject which allows for monitoring of the microbe over a prolonged period of time.
  • the present invention provides an engineered bacterium comprising an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and a heterologous nucleic acid comprising a labeling codon, wherein the heterologous nucleic acid comprises a heterologous gene encoding a protein selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein; wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with a nonstandard amino acid; and wherein the orthogonal tRNA incorporates the nonstandard amino acid at the residue corresponding to the labeling codon during translation.
  • the heterologous nucleic acid further encodes a polypeptide linker sequence.
  • the polypeptide linker sequence is flexible.
  • the heterologous nucleic acid further encodes a polypeptide tag.
  • the labeling codon is located at a nucleic acid position within the heterologous gene encoding the protein. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide linker sequence. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide tag.
  • the heterologous nucleic acid comprises 2, 3, 4, 5, 6, 7, or 8 labeling codons.
  • the present invention provides an engineered bacterium comprising an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and a heterologous nucleic acid encoding a protein, wherein the protein comprises a nonstandard amino acid, and wherein the protein is selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein; wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with the nonstandard amino acid; and wherein the orthogonal tRNA incorporates the nonstandard amino acid into the protein during translation.
  • the protein further comprises a polypeptide linker.
  • the polypeptide linker is flexible.
  • the protein further comprises a polypeptide tag.
  • the polypeptide tag is selected from the group consisting of a poly-histidine tag, a myc tag, a FLAG tag, a hemagglutinin (HA) tag, and a V5 tag.
  • the protein comprises 2, 3, 4, 5, 6, 7, or 8 nonstandard amino acids.
  • the bacterial extracellular matrix protein is a fiber protein, a flagellar protein, or a pilin protein.
  • the protein is selected from the group consisting of InaV, Trat, and CsgA. In some embodiments, the protein is CsgA. In some embodiments, the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA. In some embodiments, the protein is InaV and the
  • nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV.
  • the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type Trat.
  • the labeling codon is TAG.
  • the orthogonal tRNA comprises an anticodon loop that specifically recognizes the codon UAG.
  • the nonstandard amino acid comprises a bioorthogonal reactive functional group.
  • the bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a tetrazine moiety, or a norbornene moiety.
  • the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF), azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), p- bromophenylalanine (p-BrF), /?-iodophenylalanine (p-IF), /?-ethynylphenylalanine (p-EtF), /?ara-acetylphenylalanine (p-AcF), azidonorleucine (Anl), irans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa), and propargylglycine (Pra).
  • the nonstandard amino acid is selected from the group consisting of
  • the engineered bacterium is non-pathogenic. In some embodiments, the engineered bacterium is of the species Escherichia coli. In some embodiments, the engineered bacterium is of an Escherichia coli strain selected from the group consisting of C321, C321.AA and C321.AA.exp. In some embodiments, the engineered bacterium is of the Escherichia coli Nissle 1917 strain. [0021] In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a TAG codon. In some embodiments, the engineered bacterium comprises a genome that has not been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium further comprises a prfA gene deletion.
  • the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase. In some embodiments, the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase. In some
  • the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl tRNA synthetase gene.
  • the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina mazei, Methanosarcina barkeri,
  • Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii aminoacyl tRNA synthetase gene was produced by the chromosome.
  • the orthogonal translation system is located in the bacterial genome. In some embodiments, the orthogonal translation system is located in a plasmid. In some embodiments, the plasmid is pEVOL-pAzF.
  • the expression of the heterologous nucleic acid is under the control of a constitutive promoter. In some embodiments, the expression of the heterologous nucleic acid is under the control of an inducible promoter. In some embodiments, the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline. In some embodiments, the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the heterologous gene encoding the orthogonal tRNA is under the control of a constitutive promoter.
  • the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the heterologous gene encoding the orthogonal tRNA is under the control of an inducible promoter.
  • the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline.
  • the present invention provides a bio film comprising an engineered bacterium described herein.
  • the present invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising an engineered bacterium described herein and a pharmaceutically-acceptable excipient.
  • the composition is formulated for oral administration to a subject.
  • the composition is formulated for rectal administration to a subject.
  • the pharmaceutical composition is formulated as a pill, a capsule, a lozenge, or a suppository.
  • the subject is a mammalian subject. In some embodiments, the mammalian subject is a human subject.
  • the present invention provides a method for labeling of an engineered bacterium in a subject in vivo, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group; and (b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid of the protein, thereby labeling the engineered bacterium in the subject in vivo.
  • step (a) is performed concurrently with step (b).
  • step (a) is performed before step (b).
  • the present invention provides a method for detecting the distribution of an engineered bacterium in a subject in vivo, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first
  • step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
  • the present invention provides a method for diagnosing a gastrointestinal disease in a subject, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group; (b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid; and (c) detecting the distribution of the detectable compound in the gastrointestinal tract of the subject, thereby diagnosing a gastrointestinal disease in the subject.
  • step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
  • the present invention provides a method for detecting the distribution of a bio film produced by an engineered bacterium in a subject, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid to a subject, and wherein the nonstandard amino acid comprises a first bioorthogonal reactive functional group; (b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second
  • step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
  • the present invention provides a method for delivering a drug to a subject in need thereof, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group; (b) administering to the subject a drug comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the drug to the nonstandard amino acid, thereby delivering the drug to the subject in need thereof.
  • step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
  • the drug is delivered to the gastrointestinal tract of the subject. In some embodiments, the drug is delivered to the mouth, esophagus, stomach, large intestine, small intestine, rectum, colon, or anal canal of the subject. In some embodiments, the drug is delivered to the heart, lung, hair, or skin of the subject.
  • the engineered bacterium comprises an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and a heterologous nucleic acid encoding the protein having the at least one nonstandard amino acid; wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with the nonstandard amino acid; and wherein the orthogonal tRNA incorporates the nonstandard amino acid into the protein during translation.
  • the methods further comprise administering a nonstandard amino acid to the subject.
  • the nonstandard amino acid is administered to the subject prior to administering the detectable compound or the drug to the subject.
  • the first bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a tetrazine moiety, and a norbornene moiety.
  • the second bioorthogonal reactive functional group is selected from the group consisting of a hydrazine moiety, a hydroxylamine moiety, an alkyne moiety, an azide moiety, a tetrazine moiety, and a norbornene moiety.
  • the first bioorthogonal reactive functional group is a ketone moiety
  • the second bioorthogonal reactive functional group is either a hydrazine moiety or a hydroxylamine moiety.
  • the first bioorthogonal reactive functional group is an azide moiety
  • the second bioorthogonal reactive functional group is an alkyne moiety.
  • the first bioorthogonal reactive functional group is an alkyne moiety
  • the second bioorthogonal reactive functional group is an azide moiety.
  • the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group via a click chemistry reaction.
  • the reaction between the first bioorthogonal reactive functional group and the second bioorthogonal reactive functional group requires a catalytic agent. In some embodiments, the reaction between the first bioorthogonal reactive functional group and the second bioorthogonal reactive functional group does not require a catalytic agent. In some embodiments, the methods further comprise administering a catalytic agent to the subject. In some embodiments, the catalytic agent is copper or nickel.
  • the detectable compound comprises a fluorescent moiety, a radioactive moiety, a colorimetric dye, a fluorescent dye, a luminescent dye, a magnetic resonance imaging (MRI) contrast agent, a CT contrast agent, a PET contrast agent, or an ultrasound contrast agent.
  • the protein further comprises a polypeptide linker.
  • the polypeptide linker is flexible.
  • the protein further comprises a polypeptide tag.
  • the polypeptide tag is selected from the group consisting of a poly-histidine tag, a myc tag, a FLAG tag, a hemagglutinin (HA) tag, and a V5 tag.
  • the protein is selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein.
  • the bacterial extracellular matrix protein is a curli fiber protein, a flagellar protein, or a pilin protein.
  • the protein is selected from the group consisting of InaV, Trat, and CsgA. In some embodiments, the protein is CsgA. In some embodiments, the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA. In some embodiments, the protein is InaV and the
  • nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV.
  • the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type Trat.
  • the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF), azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), p- bromophenylalanine (p-BrF), /?-iodophenylalanine (p-IF), /?-ethynylphenylalanine (p-EtF), /?ara-acetylphenylalanine (p-AcF), azidonorleucine (Anl), trans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa), and propargylglycine (Pra).
  • the nonstandard amino acid is selected from the group consisting of /?
  • the detectable compound is DBCO-Cy5.
  • the engineered bacterium is non-pathogenic. In some embodiments, the engineered bacterium is of the species Escherichia coli. In some embodiments, the engineered bacterium is of an Escherichia coli strain selected from the group consisting of C321, C321.AA and C321.AA.exp. In some embodiments, the engineered bacterium is of the Escherichia coli Nissle 1917 strain.
  • the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a TAG codon. In some embodiments, the engineered bacterium comprises a genome that has not been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium further comprises a prfA gene deletion.
  • the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase. In some embodiments, the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase. In some
  • the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl tRNA synthetase gene.
  • the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina mazei, Methanosarcina barkeri,
  • Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii aminoacyl tRNA synthetase gene was produced by the chromosome.
  • the orthogonal translation system is located in the bacterial genome. In some embodiments, the orthogonal translation system is located in a plasmid. In some embodiments, the plasmid is pEVOL-pAzF.
  • the expression of the heterologous nucleic acid is under the control of a constitutive promoter. In some embodiments, the expression of the heterologous nucleic acid is under the control of an inducible promoter. In some embodiments, the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline. In some embodiments, the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the orthogonal tRNA is under the control of a constitutive promoter.
  • the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the orthogonal tRNA is under the control of an inducible promoter.
  • the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline.
  • the methods further comprise administering to the subject an inducer that regulates the inducible promoter.
  • the inducer is administered to the subject prior to administering the detectable compound or the drug to the subject.
  • the inducer is comprised in a pharmaceutical composition.
  • the engineered bacterium is administered to the subject orally or rectally. In some embodiments, the engineered bacterium is comprised in a
  • the detectable compound or the drug is administered to the subject orally, subcutaneously, intravenously, rectally, or transdermally.
  • the detectable compound or the drug is comprised in a pharmaceutical composition.
  • the detectable compound or the drug further comprises a drug delivery vehicle selected from the group consisting of a nanocarrier, a nanoparticle, a liposome, a dendrimer, a carbon nanotube, a micelle, and a protein.
  • FIG. 1A is a schematic showing plasmid maps indicating exemplary locations of a labeling codon (UAG) in mRNA transcribed from the open reading frames of the modified genes encoding the maltose-binding protein (MBP) (position 67), CsgA (position 89), the ice nucleation protein (InaV) (position 174), or the TraT protein (position 200).
  • MBP maltose-binding protein
  • CsgA position 89
  • InaV ice nucleation protein
  • TraT protein position 200
  • FIG. IB is a schematic showing plasmid maps indicating exemplary locations of a labeling codon (UAG) in mRNA transcribed from open reading of the genes encoding the maltose-binding protein (MBP), CsgA, the ice nucleation protein (InaV), or the TraT protein appended to a flexible linker and affinity tags.
  • Affinity tags i.e., a myc tag and a poly-his tag
  • FIG. 2A depicts the structure of two nonstandard amino acids, p-acetylphenylalanine and p-azidophenylalanine.
  • FIGs. 2B and 2C are two schematics showing exemplary recombinant bacteria engineered for bioorthogonal reactions that may be used to attach a detectable moiety or drug to a protein comprising a nonstandard amino acid.
  • FIG. 3 shows an SDS-PAGE gel stained with Coomassie Blue showing the Ni NTA affinity purification of maltose-binding protein (MBP) expressed in E. coli Nissle that has not been recoded to remove TAG codons.
  • MBP maltose-binding protein
  • FIG. 4A depicts the structure of DBCO-Cy5.
  • FIGs. 4B and 4C show an SDS-PAGE gel stained with Coomassie Blue (FIG. 4B), and the corresponding fluorescence detection image (FIG. 4C) of eluates from a Ni NTA affinity purification of maltose-binding protein (MBP) comprising the nonstandard amino acid /?-AzF, that were reacted with DBCO-Cy5.
  • MBP maltose-binding protein
  • coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express MBP without a nonstandard amino acid, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express MBP without a nonstandard amino acid expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • Concentrated 500 mM eluates of purified MBP were incubated with DBCO-Cy5 at increasing molar ratios ranging from 1: 10 to 10: 1 MBP:DBCO-Cy5.
  • FIG. 5 shows an SDS-PAGE gel stained with Coomassie Blue showing the Ni NTA affinity purification of CsgA expressed in E. coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • FIGs. 6A and 6B show an SDS-PAGE gel stained with Coomassie Blue (FIG. 6A), and the corresponding fluorescence detection image (FIG. 6B), of eluates from a Ni NTA affinity purification of CsgA comprising the nonstandard amino acid AzF, that were reacted with DBCO-Cy5.
  • CsgA was expressed in E.
  • coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • Concentrated 500 mM eluates of purified CsgA protein were incubated with DBCO-Cy5.
  • FIG. 7 shows fluorescence detection imaging of cell pellets from E. coli Nissle cells under three different transformation conditions: cells transformed with a single plasmid to express MBP without a nonstandard amino acid, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express MBP without a nonstandard amino acid expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS”).
  • DBCO-Cy5 After exposure to DBCO-Cy5, cell pellets were washed three times with phosphate buffer. MBP is soluble and was washed away from the cell pellets, and low specific binding of DBCO-Cy5 to other proteins was observed.
  • FIG. 8 shows Congo Red dye-monitoring of the expression of CsgA comprising p- AzF at different concentrations of arabinose to induce the expression of the orthogonal translation system that incorporates /?-AzF into the expressed protein.
  • Congo Red dye binding to curli fiber was determined using spectrophotometry at OD490/OD600, a measure of bound Congo Red dye over cell density. Increased Congo Red binding signifies increased curli fiber (CsgA) production.
  • Optimal expression of CsgA comprising p-AzP was observed at 0.05% arabinose induction. E. coli Nissle having a deletion in the endogenous curli operons were used.
  • FIG. 9 shows scanning electron microscopy images of curli (CsgA) expression in E. coli Nissle expressing either MBP or CsgA as indicated.
  • the protein of interest (MBP or CsgA) was expressed in E.
  • coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • FIGs. 10A and 10B show bacterial growth curves of E. coli Nissle cells either:
  • FIG. 10A shows growth curves in the absence of an inducer for the orthogonal translation system (arabinose).
  • FIG. 10B shows growth curves in the presence of 1 mM /?-AzF.
  • FIGs. 11A and 11B shows bacterial growth curves of E. coli Nissle cells either:
  • FIG. 11A shows growth curves in the presence of 0.05% arabinose, the inducer for the orthogonal translation system and the MBP protein.
  • FIG. 11B shows growth curves in the presence of in the presence of 0.05% arabinose and 1 mM /?-AzF.
  • FIG. 12 shows an SDS-PAGE gel stained with Coomassie Blue
  • FIG. 13 shows a fluorescence detection image of an SDS-PAGE gel of purified CsgA comprising p-AzF that was reacted with DBCO-Cy5.
  • Cells were grown in media containing varying concentrations of the nonstandard amino acid (p-AzF; labeled "NSAA").
  • NSAA nonstandard amino acid
  • coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild- type CsgA (as part of the synthetic curli operon), where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • FIGs. 14A and 14B shows an SDS-PAGE gel stained with Coomassie Blue (FIG. 14A), and a Western Blot (FIG. 14B) using anti-His antibody to detect the expression of TraT surface protein having a poly-His tag in cell lysates from Escherichia coli Nissle.
  • FIGs. 15A, 15B, 15C, and 15D show the expression of wild-type and mutant TraT in lysates from cells lacking or having an orthogonal translation system (OTS) in the presence or absence of the NSAA pAzF.
  • FIG. 15A and 15B each show a Western Blot using anti-His antibody (FIG. 15A) or anti-myc antibody (FIG.
  • FIG. 15C is a bar graph quantitatively depicting the percentage of TraT protein detected with anti-His antibody corresponding to the approximately 37 kDa full length TraT protein in each of the lanes of the Western Blot shown in FIG. 15A.
  • FIG. 15D is a bar graph quantitatively depicting the intensity (in absolute intensity units) of the approximately 37 kDa full length TraT protein in each of the lanes of the Western Blot shown in FIG. 15A.
  • FIG. 16 shows an SDS-PAGE of either wild-type TraT, mutant TraT comprising pAzF, wild-type CsgA or mutant TraT comprising pAzF, labelled with DBCO-Cy5.
  • FIGs. 17A, 17B and 17C show the optimization of labeling of mutant TraT comprising pAzF with DBCO-Cy5.
  • FIG. 17A shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT”) or untransformed PBP8 cells ("sham”), grown in the presence of 5 mM pAzF.
  • FIG. 17B shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT”) or untransformed PBP8 cells (“sham”), grown in the presence of 5 mM pAzF.
  • FIG. 17C shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT”) or untransformed PBP8 cells (“sham”), grown in the presence of 5 mM pAzF.
  • FIGs. 18A, 18B, 18C, and 18D show the optimization of labeling of mutant TraT comprising pAzF or mutant CsgA comprising pAzF with DBCO-Cy5.
  • FIG. 18A shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and either mutant CsgA comprising pAzF ("CsgA") or untransformed PBP8 cells ("sham”), grown in the presence of 5 mM pAzF. Cells were incubated with increasing concentrations (200 ⁇ - 400 ⁇ ) of DBCO-Cy5 for labelling.
  • FIG. 18B shows the fluorescence intensity of the E.
  • FIG. 18C shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant CsgA comprising pAzF ("CsgA”) or untransformed PBP8 cells (“sham”), grown in the presence of 5 mM pAzF. Cells were incubated with 200 ⁇ DBCO-Cy5 at 37°C for 1-4 hours.
  • FIG. 18D shows the fluorescence intensity of the E.
  • coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT”) or untransformed PBP8 cells (“sham”), grown in the presence of 5 mM pAzF. Cells were incubated with 200 ⁇ DBCO- Cy5 at 37°C for 1-4 hours. N 5 for all experiments.
  • FIG. 19 depicts flow cytometry data for E. coli PBP8 cells alone (“Control cells”), cells transformed to express wild-type CsgA ("Wild-type fibers”), cells transformed to wild- type CsgA and the orthogonal translation system (OTS) ("Wild-type fibers with OTS”), cells transformed to express mutant CsgA comprising pAzF and the OTS in the absence of the expression inducer arabinose (“Mutant fibers with OTS, no induction”), or cells transformed to express mutant CsgA comprising pAzF and the OTS in the presence of the expression inducer arabinose (“Mutant fibers with OTS”). Cells were labelled with 300 ⁇ DBCO-Cy5 for 2 hours at 37°C.
  • FIG. 20 depicts flow cytometry data for untransformed E. coli PBP8 cells (“sham”), cells transformed to express wild-type TraT (“wt TraT”), cells transformed to wild-type TraT and the orthogonal translation system (OTS) ("wt TraT + OTS + NSAA”), cells transformed to express mutant TraT comprising pAzF and the OTS grown in the absence of the expression inducer arabinose (“mut TraT + OTS + NSAA (non induction)”), or cells transformed to express mutant TraT comprising pAzF and the OTS grown in the presence of the expression inducer arabinose (“mut TraT + OTS + NSAA”).
  • Cells were labelled with 300 ⁇ DBCO-Cy5 for 2 hours at 37°C.
  • FIGS. 21A, 21B, 21C, and 21D show confocal microscopy images of E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS, or mutant TraT comprising pAzF and the OTS. Cells were labeled with Cy5-DBCO and Hoechst dye.
  • FIG. 21A shows a confocal microscopy image of cells expressing mutant CsgA comprising pAzF labelled with Cy5-DBCO and Hoechst dye.
  • FIG. 21B shows a confocal microscopy image of single cells expressing mutant CsgA comprising pAzF labelled with Cy5-DBCO and Hoechst dye.
  • FIG. 21A, 21B, 21C, and 21D show confocal microscopy images of E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS, or mutant TraT comprising pAzF and the
  • FIG. 21C shows confocal microscopy images of cells expressing mutant TraT comprising pAzF labelled with Cy5-DBCO and Hoechst dye.
  • FIG. 21D shows a confocal microscopy image of single cells expressing mutant TraT comprising pAzF labelled with Cy5-DBCO and Hoechst dye.
  • FIG. 22 show fluorescence detection images of Cy5-DBCO labelled bacteria in mice administered either no bacteria (control), or either 1 x 10 6 or 1 x 10 9 PBP8 cells expressing mutant CsgA comprising pAzF and the OTS labeled in vitro with Cy5-DBCO. Cy5 fluorescence detected in vivo using a IVIS Lumina II system (PERKIN ELMER).
  • FIG. 23 shows fluorescence detection images of Cy5-DBCO in mice administered either 5 ⁇ , 50 ⁇ , 100 ⁇ , or 200 ⁇ of Cy5-DBCO. Cy5 fluorescence detected in vivo using a IVIS Lumina II system (PERKIN ELMER).
  • FIG. 24 shows fluorescence detection images of mice administered either Cy5-DBCO alone or mice administered E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS and labeled with Cy5-DBCO at -1 hour (prior to
  • FIG. 25 is a line graph depicting the normalized radiant efficiency analysis of the fluorescence detected in the mice depicted in FIG. 24. Normalized total radiant efficiency of subtracted imaged detected according to the following equation:
  • FIGs. 26A and 26B show the detection of mutant CsgA comprising pAzF in cells lysates from two bacterial colonies isolated from fecal samples of mice administered E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS.
  • FIG. 26A shows a fluorescence image of an SDS-PAGE gel stained with Cy5-DBCO of either His-tag purified or unpurified cell lysates from bacterial cultures derived from two separate bacterial colonies that were either grown in the absence of pAzF ("Mut w/o NSAA"), presence of pAzF ("Mut with NSAA").
  • FIG. 26B shows a Coomassie Blue stain of the SDS- PAGE gel shown in FIG. 26A.
  • FIGs. 27A and 27B show fluorescence detection images of Cy5-DBCO-labelled bacteria in the gastrointestinal tracts of mice administered either untransformed PBP8 cells ("control") or PBP8 cells transformed to express mutant CsgA comprising pAzF and the OTS, and Cy5-DBCO.
  • FIG. 27C are bar graphs depicting the normalized radiant efficiency analysis of the fluorescence detected in FIGs. 27A and 27B.
  • FIG. 28 shows ex vivo fluorescence detection imaging of the gastrointestinal tract of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("(+) NSAA, inducer Mutant EcN”) or untreated mice ("control”), 24 hours after treatment with Cy5-DBCO.
  • FIG. 29 shows ex vivo fluorescence detection imaging of the gastrointestinal tract of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("(+) NSAA, inducer Mutant EcN”) or untreated mice ("control”), 36 hours after treatment with Cy5-DBCO.
  • FIG. 30A shows fluorescence detection images of the cecum of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("Mutant”) or untreated mice (“(-)”), 36 hours after treatment with Cy5-DBCO.
  • FIGs. 30B and 30C depict fluorescence detection images of extracted supernatants and pellets, respectively, derived from the cecum of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics (“Mutant”) or untreated mice (“(-)”), 36 hours after treatment with Cy5-DBCO.
  • FIGs. 31A and 31B are images of SDS-PAGE gels from soluble fraction
  • FIG. 31A shows the Coomassie Blue-stained SDS-PAGE gel of the soluble fractions (supernatant) before (“Supl”) and after ("Sup2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength.
  • 31B the left panel, shows the Coomassie Blue-stained SDS-PAGE gel with the pellet fractions before (“Pell”) and after ("Pel2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength.
  • FIGs. 32A and 32B are images of SDS-PAGE gels from soluble fraction
  • FIG. 32A shows the Coomassie Blue-stained SDS-PAGE gel of the soluble fractions (supernatant) before (“Supl”) and after (“Sup2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength. Samples are at a 1:20 dilution of the samples run in the SDS-PAGE gels of FIGs.
  • FIG. 32B the left panel, shows the Coomassie Blue-stained SDS- PAGE gel with the pellet fractions before (“Pell”) and after ("Pel2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength.
  • the disclosure includes engineered bacteria, pharmaceutical compositions thereof, methods of labeling an engineered bacterial cell, and methods of using engineered bacteria for the diagnosis and treatment of a disease or disorder.
  • the engineered bacterium has been genetically modified to comprise an orthogonal translation system.
  • the orthogonal translation system allows the engineered bacterium to incorporate one or more nonstandard amino acids into a protein encoded by a nucleic acid having a labeling codon, and being expressed by the bacterium.
  • the orthogonal translational system can be designed to particularly target specific codons (i.e., labeling codons) present in a gene encoding a protein of interest in order to incorporate one or more nonstandard amino acids into the protein during translation.
  • Proteins having a nonstandard amino acid bearing a bioorthogonal reactive functional group can be reacted with detectable moiety which allow for the tracking, labeling and/or visualization of the protein.
  • bacterial cells comprising proteins having a nonstandard amino acid bearing a bioorthogonal reactive functional group can also be labeled with a detectable moiety, after being administered to a subject, which allows for the tracking, labeling and/or visualization of the bacterium in the subject.
  • the genetic modification of a bacterium to include an orthogonal translation system allows for the incorporation of nonstandard amino acids into any protein expressed by the bacterium, a concept known as genetic code expansion (see, e.g., Young et al. (2010) J. Mol. Biol. 395: 361-374).
  • Genetic code expansion includes the genetic modification of a microorganism to express an orthogonal aminoacyl tRNA synthetase/tRNA (aaRS/tRNA) pair that is specific for a particular nonstandard amino acid and that does not function with standard amino acids, endogenous tRNAs or endogenous aminoacyl tRNA synthetases.
  • genetic code expansion requires the use of both an orthogonal aminoacyl aaRS/tRNA pair, as well as a labeling codon that can be decoded by the tRNA of the aaRS/tRNA pair, providing a mechanism for incorporating a nonstandard amino acid into any protein of interest.
  • the amber stop codon TAG UAG on mRNA
  • Multiple aaRS/tRNA pairs have been developed thus far, allowing for the incorporation of over 100 nonstandard amino acids into proteins (see, e.g., Liu et al. (2010) Annu. Rev. Biochem. 79: 413-444).
  • nonstandard amino acids having a variety of different chemical structures (e.g., bioorthogonal reactive functional groups, metal chelation moieties, photo-crosslinking side chains, photo-caged side chains, post-translational modifications, redox reactive agents, and infrared, NMR and fluorescent probes) have also been developed (see, e.g., Wang, et al. (2006) Annu. Rev. Biomol. Struct. 35: 225-249).
  • bacteria can be genetically modified to be able to express a protein having a nonstandard amino acid and can be used for in vivo diagnostic and therapeutic methods which allow for the prolonged monitoring of the bacteria, as well as for the use of the bacteria in multiple therapeutic and diagnostic methods.
  • the engineered bacteria described herein are capable of expressing a protein of interest having at least one non-standard amino acid comprises a bioorthogonal reactive functional group.
  • the engineered bacteria can be safely administered to a subject, allowed to colonize and/or engraft in the subject, and subsequently be triggered (e.g., with an inducer) to express a protein having a nonstandard amino acid bearing a bioorthogonal reactive functional group.
  • proteins can then be reacted with a variety of molecular entities (e.g., detectable probes and/or drugs) for a multitude of clinical applications in a non- invasive manner.
  • molecular entities e.g., detectable probes and/or drugs
  • multiple nonstandard amino acids having distinct bioorthogonal reactive functional groups have been developed and may be used in the present invention (see, e.g., Lang and Chin (2014) Chem. Rev.
  • the engineered bacteria described herein are labeled by reacting the bioorthogonal reactive functional group of the nonstandard amino acid with a bioorthogonal reactive functional group of a detectable moiety, such as a dye or MRI contrast agent.
  • a detectable moiety such as a dye or MRI contrast agent.
  • the engineered bacteria described herein can be administered to a subject, modified to comprise a detectable moiety and/or drug and be used for variety of diagnostic and/or therapeutic methods to, for example, image tissues and organs of a subject.
  • engineered bacterium or “engineered bacterial cell” refers to a bacterial cell that has been genetically modified from their native state.
  • an engineered bacterial cell may have nucleotide insertions, nucleotide deletions, nucleotide rearrangements, and nucleotide modifications introduced into their DNA. These genetic modifications may be present in the chromosome of the bacteria or bacterial cell, or on a plasmid in the bacteria or bacterial cell.
  • Engineered bacterial cells of the disclosure may comprise exogenous nucleotide sequences on plasmids.
  • recombinant bacterial cells may comprise exogenous nucleotide sequences stably incorporated into their
  • the engineered bacterium is non-pathogenic. In some embodiments, the engineered bacterium is pathogenic.
  • Probiotic refers to a live, non-pathogenic microorganisms, e.g., bacteria, which can confer health benefits to a host organism.
  • the host organism is a mammal.
  • the host organism is a human.
  • Some species, strains, and/or subtypes of non-pathogenic bacteria are currently recognized as probiotic bacteria.
  • probiotic bacteria include, but are not limited to, Bifidobacteria, Escherichia coli, Lactobacillus, and Saccharomyces, e.g., Bifidobacterium bifidum,
  • Lactobacillus bulgaricus Lactobacillus paracasei, and Lactobacillus plantarum.
  • the probiotic may be a variant or a mutant strain of bacterium.
  • Non-pathogenic bacteria may be genetically engineered to enhance or improve desired biological properties, e.g.,
  • Non-pathogenic bacteria may be genetically engineered to provide probiotic properties.
  • Probiotic bacteria may be genetically engineered to enhance or improve probiotic properties.
  • the term “gene” refers to a nucleic acid fragment that encodes a protein or fragment thereof, optionally including regulatory sequences preceding (5' non- coding sequences) and following (3' non-coding sequences) the coding sequence. In one embodiment, a “gene” does not include regulatory sequences preceding and following the coding sequence.
  • heterologous gene refers to a nucleotide sequence that is not normally found in a given cell in nature.
  • a heterologous sequence encompasses a nucleic acid sequence that is exogenously introduced into a given cell.
  • Heterologous gene includes a native gene, or fragment thereof, that has been introduced into the host cell in a form that is different from the corresponding native gene.
  • a heterologous gene may include a native gene, or fragment thereof, introduced into a non-native host cell.
  • a heterologous gene may be foreign or native to the recipient cell; a nucleic acid sequence that is naturally found in a given cell but expresses an unnatural amount of the nucleic acid and/or the polypeptide which it encodes; and/or two or more nucleic acid sequences that are not found in the same relationship to each other in nature.
  • the term “endogenous gene” refers to a native gene in its natural location in the genome of an organism.
  • transgene refers to a gene that has been introduced into the host organism, e.g., host bacterial cell's genome.
  • a "labeling codon”, as used herein in reference to DNA, refers to an assembly of three or more nucleotides in a deoxyribonucleic acid molecule which are transcribed to three or more nucleosides of a ribonucleic acid molecule that are specifically recognized and/or decoded by an orthogonal tRNA, but are not recognized and/or decoded by an endogenous tRNA.
  • RNA e.g., mRNA
  • a "promoter” as used herein refers to a nucleotide sequence that is capable of controlling the expression of a coding sequence or gene. Promoters are generally located 5' of the sequence that they regulate. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from promoters found in nature, and/or comprise synthetic nucleotide segments. Those skilled in the art will readily ascertain that different promoters may regulate expression of a coding sequence or gene in response to a particular stimulus, e.g., in a cell-specific or tissue- specific manner, in response to different environmental or physiological conditions, or in response to specific compounds.
  • Prokaryotic promoters are typically classified into two classes: inducible and constitutive.
  • Constant promoter refers to a promoter that is capable of facilitating continuous transcription of a coding sequence or gene under its control and/or to which it is operably linked.
  • Constitutive promoters and variants are well known in the art and include, but are not limited to, a constitutive Escherichia coli ⁇ promoter, a constitutive Escherichia coli ⁇ 32 promoter, a consti ⁇ tuti ⁇ ve Escherichia coli ⁇ 70 promoter, a constitutive Bacillus subtilis ⁇ promoter, a constitutive Bacillus subtilis ⁇ promoter, and a bacteriophage T7 promoter.
  • an “inducible promoter” refers to a promoter that initiates increased levels of transcription of the coding sequence or gene under its control in response to a stimulus or an exogenous environmental condition.
  • a “directly inducible promoter” refers to a regulatory region, wherein the regulatory region is operably linked to a gene encoding a protein or polypeptide, where, in the presence of an inducer of said regulatory region, the protein or polypeptide is expressed.
  • an “indirectly inducible promoter” refers to a regulatory system comprising two or more regulatory regions, for example, a first regulatory region that is operably linked to a first gene encoding a first protein, polypeptide, or factor, e.g., a transcriptional regulator, which is capable of regulating a second regulatory region that is operably linked to a second gene, the second regulatory region may be activated or repressed, thereby activating or repressing expression of the second gene.
  • bioorthogonal reactive functional group refers to a chemical moiety that mediates a chemical reaction with another chemical moiety, whereby the chemical reaction can occur inside of a living system with minimal interference of native biochemical processes.
  • a “bioorthogonal reaction”, as used herein, is a reaction between two bioorthogonal reactive functional groups typically proceed under physiological conditions that results in a covalent bond that is stable under physiological conditions.
  • click chemistry reaction refers to a chemical reaction occurring between a pair of terminal reactive moieties that rapidly and selectively react (“click") with each other to form a targeting or effector moiety conjugated binding polypeptide.
  • Click chemistry reactions can be categorized into two separate groups: copper (Cu(I))-catalyzed and copper-free.
  • Cu(I)-catalyzed azide-alkyne click chemistry reaction relies on the presence of Cu(I) ions whereas the copper-free reactions proceed without metal catalysis (e.g. , the Staudinger Ligation or the azide-phosphine reaction).
  • a “nonstandard amino acid”, as used herein refers to any amino acid, other than the standard amino acids that are the building blocks of polypeptides of most organisms, including alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine.
  • the nonstandard amino acid comprises a bioorthogonal reactive functional group.
  • nonstandard biorthogonal functional amino acid refers to any nonstandard amino acid which comprises a bioorthogonal reactive functional group.
  • the term "expression” refers to the transcription and stable accumulation of sense (mRNA) or anti-sense RNA derived from a nucleic acid, and/or to translation of an mRNA into a polypeptide
  • mRNA sense
  • anti-sense RNA derived from a nucleic acid
  • gene modification refers to any genetic change.
  • Exemplary genetic modifications include those that increase, decrease, or abolish the expression of a gene, including, for example, modifications of native chromosomal or extrachromosomal genetic material.
  • Exemplary genetic modifications also include the introduction of at least one plasmid, modification, mutation, base deletion, base addition, and/or codon modification of chromosomal or extrachromosomal genetic sequence(s), gene over-expression, gene amplification, gene suppression, promoter modification or substitution, gene addition (either single or multi-copy), antisense expression or suppression, or any other change to the genetic elements of a host cell, whether the change produces a change in phenotype or not.
  • Genetic modification can include the introduction of a plasmid, e.g.
  • a plasmid comprising at least one amino acid catabolism enzyme operably linked to a promoter into a bacterial cell.
  • Genetic modification can also involve a targeted replacement in the chromosome, e.g. , to replace a native gene promoter with an inducible promoter, regulated promoter, strong promoter, or constitutive promoter.
  • Genetic modification can also involve gene amplification, e.g. , introduction of at least one additional copy of a native gene into the chromosome of the cell.
  • chromosomal genetic modification can involve a genetic mutation.
  • a "pharmaceutical composition,” as used herein, refers to a composition comprising an active ingredient (e.g., a bacterial cell, an inducer, a drug, or a detectable compound) with other components such as a physiologically suitable carrier and/or excipient.
  • an active ingredient e.g., a bacterial cell, an inducer, a drug, or a detectable compound
  • other components such as a physiologically suitable carrier and/or excipient.
  • the term "pharmaceutically acceptable” or “pharmacologically acceptable” refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable or “pharmacologically acceptable” refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • animal e.g. , human
  • compositions should meet sterility, pyrogenicity, general safety and purity standards as required by the FDA Office of Biological Standards.
  • the term "pharmaceutically acceptable excipient” means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, manufacturing aid (e.g. , lubricant, talc magnesium, calcium or zinc stearate, or steric acid), or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
  • manufacturing aid e.g. , lubricant, talc magnesium, calcium or zinc stearate, or steric acid
  • solvent encapsulating material involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
  • Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
  • materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as ethyl
  • wetting agents coloring agents, release agents, coating agents, disintegrating agents, binders, sweetening agents, flavoring agents, perfuming agents, protease inhibitors, plasticizers, emulsifiers, stabilizing agents, viscosity increasing agents, film forming agents, solubilizing agents, surfactants,
  • preservative and antioxidants can also be present in the formulation.
  • excipient can also be present in the formulation.
  • carrier can also be present in the formulation.
  • pharmaceutically acceptable excipient can also be present in the formulation.
  • heterologous when referring to a heterologous translation system, or to a heterologous component of the translation system (e.g. , a heterologous amino acyl synthetase), refers to the ability of an aminoacyl synthetase and/or tRNA to function independently of the aminoacyl synthetases and tRNAs endogenous to the host bacterium.
  • orthogonal aminoacyl tRNA synthetase refers to an enzyme that does not specifically aminoacylate endogenous tRNAs of the host bacterium, but specifically aminoacylates its cognate orthogonal tRNA.
  • orthogonal tRNA refers to a tRNA that is not a substrate for the endogenous aminoacyl tRNA synthetases of a host bacterium, but specifically interacts with an orthogonal aminoacyl tRNA synthetase.
  • the orthogonal tRNA directs the translation incorporation of a nonstandard amino acid of an orthogonal aminoacyl tRNA synthetase in response to a specific codon (e.g. , the UAG codon, also known as the amber stop codon).
  • a "plasmid” or “vector” includes a nucleic acid construct designed for delivery to a host cell or transfer between different host cell.
  • An "expression plasmid” or “expression vector” can be a plasmid that has the ability to incorporate and express heterologous nucleic acid fragments in a cell.
  • An expression plasmid may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms.
  • the nucleic acid incorporated into the plasmid can be operatively linked to an expression control sequence when the expression control sequence controls and regulates the transcription and translation of that
  • a biofilm refers to a mass of microorganisms which can adhere or is adhering to a surface.
  • a biofilm comprises a matrix of extracellular polymeric substances, including, but not limited to extracellular DNA, proteins, glycopeptides, and polysaccharides.
  • the nature of a biofilm, such as its structure and composition, can depend on the particular species of bacteria present in the biofilm. Bacteria present in a biofilm are commonly genetically or phenotypically different than corresponding bacteria not in a biofilm, such as isolated bacteria or bacteria in a colony.
  • Conditions suitable for the production of a biofilm can include, but are not limited to, conditions under which the microbial cell is capable of logarithmic growth and/or polypeptide synthesis. Conditions may vary depending upon the species and strain of microbial cell selected. Conditions for the culture of microbial cells are well known in the art. Biofilm production can also be induced and/or enhanced by methods well known in the art, e.g. contacting cells with subinhibitory concentrations of beta- lactam or aminoglycoside antibiotics, exposing cells to fluid flow, contacting cells with exogenous poly-N-acetylglucosamine (PNAG), or contacting cells with quorum sensing signal molecules. In some embodiments, conditions suitable for the production of a biofilm can also include conditions which increase the expression and secretion of CsgA, e.g. by exogenously expressing CsgD.
  • PNAG poly-N-acetylglucosamine
  • protein and “polypeptide” refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function.
  • modified amino acids e.g., phosphorylated, glycated, glycosylated, etc.
  • amino acid analogs regardless of its size or function.
  • Protein and polypeptide are often used in reference to relatively large polypeptides, whereas the term “peptide” is often used in reference to small polypeptides, but usage of these terms in the art overlaps.
  • protein and
  • polypeptide are used interchangeably herein when referring to a gene product and fragments thereof.
  • exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.
  • a "nucleic acid” or “nucleic acid sequence” may be any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof.
  • the nucleic acid can be either single- stranded or double-stranded.
  • a single- stranded nucleic acid can be one nucleic acid strand of a denatured double- stranded DNA. Alternatively, it can be a single- stranded nucleic acid not derived from any double- stranded DNA.
  • the nucleic acid can be DNA.
  • the nucleic acid can be RNA.
  • Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA. Other suitable nucleic acid molecules are RNA, including mRNA.
  • non-pathogenic refers to bacteria that are not capable of causing disease or harmful responses in a host.
  • non-pathogenic bacteria are commensal bacteria. Examples of non-pathogenic bacteria include, but are not limited to Bacillus, Bacteroides, Bifidobacterium, Brevibacteria,
  • Lactobacillus Lactococcus, Saccharomyces, and Staphylococcus, e.g., Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium butyri m. Enterococcus faecium, Lactobacillus acidophilus,
  • Naturally pathogenic bacteria may be genetically engineered to provide reduce or eliminate pathogenicity.
  • a heterologous gene encoding an amino acid catabolism enzyme should be understood to mean “at least one heterologous gene encoding at least one amino acid catabolism enzyme.”
  • a heterologous gene encoding an amino acid importer should be understood to mean “at least one heterologous gene encoding at least one amino acid importer.”
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
  • the engineered bacterium has been genetically modified to comprise an orthogonal translation system.
  • the orthogonal translation system is composed of a heterologous gene encoding an orthogonal aminoacyl synthetase and a heterologous gene encoding an orthogonal tRNA.
  • the orthogonal translation system allows the engineered bacterium to incorporate one or more nonstandard amino acids into a protein expressed by the bacterium.
  • the orthogonal translation system is located in the bacterial genome. In some embodiments, the orthogonal translation system is located in a plasmid. In some embodiments, the orthogonal translation system is located in plasmid pEVOL-pAzF (described, e.g., in Chin et al. (2002) J. Am. Chem. Soc. 124(31): 9026-7; Rovner et al. (2015) Nature 518(7537): 89-93, which are incorporated herein by reference). In some embodiments, the heterologous gene encoding a component of the orthogonal translation system is located in the bacterial genome. In some embodiments, the
  • heterologous gene encoding a component of the orthogonal translation system is located in a plasmid.
  • the heterologous gene encoding an orthogonal aminoacyl synthetase is located in the bacterial genome.
  • the heterologous gene encoding an orthogonal aminoacyl synthetase is located in a plasmid.
  • the heterologous gene encoding an orthogonal tRNA is located in the bacterial genome.
  • the heterologous gene encoding an orthogonal tRNA is located in a plasmid.
  • the orthogonal translation system includes a tRNA that decodes or recognizes a specific codon (i.e., a labeling codon) that is not decoded and/or recognized by any endogenous tRNA, and as aminoacyl tRNA synthetase that preferentially aminoacylates a cognate tRNA with a specific nonstandard amino acid.
  • a specific codon i.e., a labeling codon
  • aminoacyl tRNA synthetase that preferentially aminoacylates a cognate tRNA with a specific nonstandard amino acid.
  • the orthogonal translation system will comprise an aminoacyl tRNA synthetase that does not preferentially aminoacylate endogenous L. lactis tRNAs.
  • the orthogonal translation system will further comprise an orthogonal tRNA that is minimally, or not at all, aminoacylated by an endogenous L. lactis aminoacyl tRNA synthetase.
  • the orthogonal translation system is from, or is derived from, an Archea translational system. In some embodiments, the orthogonal translation system is from, or is derived from, an bacterial translation system. In some embodiments, the orthogonal translations system is an engineered translation system. In some embodiments, the orthogonal translation system is a naturally-occurring translation system. In some embodiments, the orthogonal translations system is from, or is derived from, a
  • the orthogonal translation system is from, or is derived from, a Methanosarcina mazei, Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii translation system.
  • the orthogonal aminoacyl synthetase is from, or is derived from, an Archea aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is from, or is derived from, an bacterial aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is an engineered aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is a naturally-occurring aminoacyl synthetase.
  • the orthogonal aminoacyl synthetase is from, or is derived from, a Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is from, or is derived from, a Methanosarcina mazei, Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii aminoacyl synthetase.
  • the orthogonal tRNA is from, or is derived from, an
  • the orthogonal tRNA is from, or is derived from, a bacterial tRNA. In some embodiments, the orthogonal tRNA is an engineered tRNA. In some embodiments, the orthogonal tRNA is a naturally-occurring tRNA. In some
  • the orthogonal tRNA is from, or is derived from, a Methanosarcina
  • the orthogonal tRNA is from, or is derived from, a Methanosarcina mazei, Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii tRNA.
  • Orthogonal translation systems, orthogonal aminoacyl synthetases and/or an orthogonal tRNAs for use in the present invention may be selected based on their ability to incorporate a specific nonstandard amino acid and/or based on their ability to recognize a specific labeling codon.
  • the orthogonal aminoacyl synthetase and the orthogonal tRNA are from, or are derived from, the same organism.
  • the orthogonal aminoacyl synthetase and the orthogonal tRNA are from, or are derived from, different organisms.
  • the orthogonal aminoacyl synthetase and/or orthogonal tRNA is from, or is derived from, an organism selected from the group consisting of
  • Methanosarcina mazei, Methanosarcina acetovorans, Methanosarcina barken,
  • Methanosarcina frisia Methanosarcina thermophila
  • Methanosarcina vacolata Methanosarcina vacolata
  • thermoautotrophicum Haloferax volcanii, Archaeo globus fulgidus, Pyrococcus furiosus, Pyrococcus horikoshii, Aeuropyrum pernix, Methanococcus maripaludis, Methanopyrus kandleri, Methanosarcina mazei, Pyrobaculum aerophilum, Pyrococcus abyssi, Sulfolobus solfataricus, Sulfolobus tokodaii, Thermoplasma acidophilum, and Thermoplasma volcanium.
  • orthogonal translation systems and methods for producing orthogonal translation systems, are known in the art and can be used as described herein (see, e.g., PCT Publication Numbers WO 2005/007624; WO 2002/086075; WO 2002/085923; WO 2004/094593; WO 2005/019415; WO 2005/007870; WO 2006/110182; and WO 2007/103490; which are all incorporated by reference herein in their entireties).
  • the engineered bacterium comprises more than one orthogonal translation system, thus allowing for the incorporation of more than one type of nonstandard amino acid into a protein of interest.
  • each of the orthogonal translation systems may recognize the same and/or different labeling codons.
  • one or more than one labeling codon(s) may be used as described herein. Thus, multiple same or different nonstandard amino acid may be incorporated into a protein of interest by using different labeling codons.
  • the engineered bacterium described herein comprises a heterologous nucleic acid comprising a labeling codon.
  • a labeling codon that is not recognized by the endogenous translation machinery of a bacterial cell results in a blockade of the translation of the polypeptide being produced.
  • the aminoacyl tRNA synthetase/tRNA pair of the system recognizes the labeling codon and loads an amino acid (e.g. , a nonstandard amino acid) in response to the labeling codon, thereby suppressing the blockade of translation.
  • Labeling codons for use in the present invention expand the genetic codon framework of the bacterium.
  • the labeling codon is a three base codon.
  • the labeling codon is a nonsense codon.
  • the labeling codon is a stop codon (e.g. , an amber codon (TAG), an ochre codon (TAA), or an opal codon (TGA)).
  • the labeling codon is an unnatural codon.
  • the labeling codon is an extended codon (e.g., a codon comprising four or more bases).
  • the labeling codon comprises four bases (e.g. , CTAG, AGGA, TAGA, CCCT).
  • the labeling codon comprises five bases (e.g. , AGGAC, CCCCT, CCCTC, CTAGA, CTACT, TAGGC).
  • the labeling codon comprises six bases.
  • the labeling codon comprises seven or more bases.
  • the labeling codon is a three base codon that is not used by the bacterium' s translational machinery. In some embodiments, the labeling codon is a three base codon that is rarely used by the bacterium' s translational machinery. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce the abundance of the labeling codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to remove the labeling codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce the abundance of the labeling codon TAG. In some embodiments, the engineered bacterium comprises a genome that has been recoded to remove the labeling codon TAG.
  • the engineered bacterium comprises more than one orthogonal translation system such that more labeling codons may be used as described herein.
  • more labeling codons may be used as described herein.
  • multiple same or different nonstandard amino acid may be incorporated into a polypeptide of interest by using different labeling codons.
  • the engineered bacterium described herein comprises a heterologous nucleic acid comprising a labeling codon.
  • the heterologous nucleic acid is located in the bacterial genome.
  • the heterologous gene is located in a plasmid.
  • the expression of the heterologous nucleic acid is under the control of a constitutive promoter (e.g. , a constitutive promoter disclosed herein).
  • the heterologous nucleic acid is under the control of an inducible promoter (e.g. , an inducible promoter disclosed herein).
  • the heterologous nucleic acid comprises one labeling codon.
  • the heterologous nucleic acid comprises more than one labeling codon. In some embodiments, the heterologous nucleic acid comprises one, two, three, four, five, six, seven, eight or more labeling codons. Labeling codons may be introduced into the heterologous nucleic acid using methods known in the art, including, e.g., site-directed mutagenesis).
  • the heterologous nucleic acid comprises a labeling codon and a heterologous gene encoding a protein.
  • the heterologous nucleic acid further encodes a polypeptide linker sequence.
  • the polypeptide linker sequence is flexible.
  • the heterologous nucleic acid further encodes a polypeptide tag.
  • the labeling codon is located at a nucleic acid position corresponding to the open reading frame of the protein. In some embodiments, the labeling codon is not located at a nucleic acid position corresponding to the open reading frame of the protein.
  • the labeling codon is located at a nucleic acid position corresponding to the open reading frame of the polypeptide linker sequence. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous gene encoding the protein. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide linker sequence. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide tag.
  • the engineered bacterium described herein comprises a protein having a nonstandard amino acid.
  • the protein comprises one nonstandard amino acid.
  • the non standard amino acid does not interfere with the structural fold, function, enzymatic activity and/or location of the protein.
  • the non standard amino acid interferes with the structural fold, function, enzymatic activity and/or location of the protein.
  • the protein comprises more than one nonstandard amino acid. In some embodiments where the protein comprises multiple nonstandard amino acids, one or more of the nonstandard amino acids does not interfere with the structural fold, function, enzymatic activity and/or location of the protein.
  • the protein comprises multiple nonstandard amino acids
  • one or more of the nonstandard amino acids interfere with the structural fold, function, enzymatic activity and/or location of the protein.
  • the protein comprises two, three, four five, six, seven, eight, or more nonstandard amino acids. Multiple nonstandard amino acids are know in the art and can be used as described herein (see, e.g., Lang and Chin (2014) Chem. Rev. 114: 4764-806, which is incorporated herein by reference in its entirety).
  • the nonstandard amino acid comprises a bioorthogonal reactive functional group.
  • the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF), azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), p- bromophenylalanine (p-BrF), /?-iodophenylalanine (p-lF), /?-ethynylphenylalanine (p-EtF), /?ara-acetylphenylalanine (p-AcF), azidonorleucine (Anl), trans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa),
  • the non-standard amino acid comprises a bioorthogonal reactive functional group.
  • the detectable moiety comprises a bioorthogonal reactive functional group.
  • Multiple bioorthogonal reactive functional groups are known in the art and can be used in the methods described herein (see, e.g. , Lang and Chin (2014)).
  • the bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkene moiety, an alkyne moiety, a tetrazine moiety, and a norbornene moiety.
  • the detectable moiety comprises a bioorthogonal reactive functional group.
  • multiple bioorthogonal reactive functional groups are known in the art and can be used in the methods described herein (see, e.g. , Lang and Chin (2014)).
  • the bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkene moiety, an alkyne
  • bioorthogonal reactive functional group is able to participate in a click chemistry reaction with a second bioorthogonal reactive functional group (e.g. , a bioorthogonal reactive functional group present on a drug or detectable compound).
  • a second bioorthogonal reactive functional group e.g. , a bioorthogonal reactive functional group present on a drug or detectable compound.
  • Multiple click chemistry reactions are known in the art (see, e.g., Lang and Chin (2014)).
  • any protein can be expressed in the engineered bacterium described herein to incorporate a nonstandard amino acid.
  • the protein is a secreted protein.
  • the protein is a non-secreted protein.
  • the protein is a membrane protein.
  • the protein is a cytosolic protein.
  • the protein is a nuclear protein.
  • the protein is an enzyme.
  • the protein is an extracellular matrix protein.
  • the protein is a bio film protein.
  • the protein is a fiber protein (e.g., a curli fiber protein).
  • the protein is a pilin protein.
  • the protein is CsgA.
  • CsgA is the major structural subunit of curli.
  • the sequences of CsgA and its homologs are known in a number of species, e.g., E. coli (NCBI Gene ID NO: 949055; NCBI Ref Seq: NP_415560).
  • E. coli NCBI Gene ID NO: 949055; NCBI Ref Seq: NP_415560.
  • the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA.
  • the protein is Trat.
  • TraT is an outer membrane lipoprotein encoded by the tra operon.
  • the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type TraT.
  • the protein is InaV. In some embodiments, the protein is InaV and the nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV.
  • the protein is maltose binding protein (MBP).
  • MBP maltose binding protein
  • the protein is MBP and the nonstandard amino acid is located at an amino acid residue corresponding to residue 67 of wild-type MBP.
  • the protein expressed by the engineered bacterium described herein comprises a polypeptide tag.
  • the protein comprises more than one polypeptide tag.
  • the protein comprises two, three, four, or more polypeptide tags. Multiple polypeptide tags are known in the art and can be used as described herein. Exemplary polypeptide tags for use in the methods described herein include, but are not limited to, the polypeptide tags shown in Table 1.
  • the polypeptide tag is at the N-terminus of the protein.
  • the polypeptide tag is at the C-terminus of the protein.
  • the polypeptide tag is located between two domains of the protein.
  • V5 G PIPNPLLGLDST (SEQ ID NO: 1 1 )
  • the protein expressed by the engineered bacterium described herein comprises a polypeptide linker.
  • the polypeptide linker is one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, twenty-five, thirty, thirty- five, forty, forty-five, fifty, or more amino acids in length.
  • the polypeptide linker is twelve, twenty-four, thirty-six, forty-eight, sixty, seventy-two, eighty- four, or ninety-six amino acids in length.
  • the polypeptide linker is N- terminus of the protein.
  • the polypeptide linker is C-terminus of the protein. In some embodiments, the polypeptide linker is located between a domain of the protein and a polypeptide tag. In some embodiments, the polypeptide linker is located between two domains of the protein. In some embodiments, the polypeptide linker is flexible. In some embodiments, the polypeptide linker is rigid. In some embodiment, the polypeptide linker comprises a nonstandard amino acid.
  • Plasmids for use as described herein can include, but are not limited to, pEVOL (see Young et al.
  • the promoter is a constitutive promoter. In some embodiments, the promoter is an inducible promoter.
  • An “inducible promoter” may be one that is characterized by initiating or enhancing transcriptional activity when in the presence of, influenced by, or contacted by an inducer or inducing agent than when not in the presence of, under the influence of, or in contact with the inducer or inducing agent.
  • An “inducer” or “inducing agent” may be endogenous, or a normally exogenous compound or protein that is
  • the inducer or inducing agent e.g., a chemical, a compound or a protein
  • the inducer or inducing agent can itself be the result of transcription or expression of a nucleic acid sequence (e.g., an inducer can be a transcriptional repressor protein), which itself may be under the control or an inducible promoter.
  • Non-limiting examples of inducible promoters include but are not limited to, the lac operon promoter, a nitrogen- sensitive promoter, an IPTG-inducible promoter, a salt-inducible promoter, tetracycline-inducible promoter, the lambda phage pL promoter, steroid-responsive promoters, rapamycin responsive promoters and the like.
  • Inducible promoters for use in prokaryotic systems are well known in the art, see, e.g. the ⁇ -lactamase and lactose promoter systems (Chang et al. (1978) Nature 275: 615, which is incorporated herein by reference; Goeddel et al.
  • An inducible promoter useful in the methods and systems as disclosed herein can be induced by one or more physiological conditions, such as changes in pH, temperature, radiation, osmotic pressure, saline gradients, cell surface binding, and the concentration of one or more extrinsic or intrinsic inducing agents.
  • the extrinsic inducer or inducing agent may comprise amino acids and amino acid analogs, saccharides and polysaccharides, nucleic acids, protein transcriptional activators and repressors, cytokines, toxins, petroleum-based compounds, metal containing compounds, salts, ions, enzyme substrate analogs, hormones, and combinations thereof.
  • the inducible promoter is activated or repressed in response to a change of an environmental condition, such as the change in concentration of a chemical, metal, temperature, radiation, nutrient or change in pH.
  • an inducible promoter useful in the methods and systems as disclosed herein can be a phage inducible promoter, nutrient inducible promoter, temperature inducible promoter, radiation inducible promoter, metal inducible promoter, hormone inducible promoter, steroid inducible promoter, and/or hybrids and combinations thereof.
  • Appropriate environmental inducers can include, but are not limited to, exposure to heat (i.e., thermal pulses or constant heat exposure), various steroidal compounds, divalent cations (including Cu 2+ , Ca 2+ , and Zn 2+ ), galactose, arabinose, anhydrotetracycline (ATc), tetracycline, IPTG (isopropyl-P-D thiogalactoside), as well as other naturally occurring and synthetic inducing agents and gratuitous inducers.
  • heat i.e., thermal pulses or constant heat exposure
  • various steroidal compounds including Cu 2+ , Ca 2+ , and Zn 2+
  • galactose including Cu 2+ , Ca 2+ , and Zn 2+
  • galactose arabinose
  • tetracycline tetracycline
  • IPTG isopropyl-P-D thiogalactoside
  • Inducible promoters useful in the methods and systems as disclosed herein also include those that are repressed by "transcriptional repressors” that are subject to inactivation by the action of environmental, external agents, or the product of another gene. Such inducible promoters may also be termed “repressible promoters” where it is required to distinguish between other types of promoters in a given module or component of the biological switch converters described herein. Preferred repressors for use in the present invention are sensitive to inactivation by physiologically benign agent.
  • a lac repressor protein is used to control the expression of a promoter sequence that has been engineered to contain a lacO operator sequence
  • treatment of the host cell with IPTG will cause the dissociation of the lac repressor from the engineered promoter containing a lacO operator sequence and allow transcription to occur.
  • tet repressor is used to control the expression of a promoter sequence that has been engineered to contain a tetO operator sequence
  • treatment of the host cell with tetracycline, or the tetracycline analog anhydrotetracycline (ATc) will cause the dissociation of the tet repressor from the engineered promoter and allow transcription of the sequence downstream of the engineered promoter to occur.
  • Bacteria for use in the methods and compositions described herein can be of any species.
  • the bacteria are of a species and/or strain which is amenable to culture and genetic manipulation.
  • the bacterium is a gram-positive bacterium.
  • the bacterium is a gram-negative bacterium.
  • the bacterium is a probiotic.
  • the bacterium is Generally Recognized as Safe (GRAS) by a regulatory authority.
  • the bacterium is pathogenic.
  • the bacterium is non-pathogenic.
  • the bacterium is an attenuated pathogenic bacterium.
  • the parental strain of the bacterium used herein is of a strain optimized for protein expression.
  • Non- limiting examples of bacterial species and strains suitable for use in the present technologies include Escherichia coli, E. coli BL21, E. coli Tuner, E. coli Rosetta, E. coli JMlOl, and derivatives of any of the foregoing.
  • the bacterium is of the E. coli Nissle 1917 strain.
  • Other non-pathogenic bacterial strains known to those of skill in the art such as MG1655, K12-derived strains, and the like, may also be used.
  • the parental strains of the bacterium described herein is optimized for use with an orthogonal translation system.
  • the bacterium is genetically modified (e.g., recoded) to reduce or eliminate a codon that is specifically recognized by the orthogonal translation system. Any codon may be reduced or eliminated from the genome of a bacterium described herein using methods known in the art.
  • the bacterium is genetically modified (e.g., recoded) to reduce or eliminate the TGA codon (see, e.g., Lajoie et al. (2013) Science 342(6156):357-60.
  • the bacterium is genetically modified (e.g., recoded) to reduce the codon TGA in the bacterial genome. In some embodiments, the bacterium is genetically modified (e.g., recoded) to eliminate the codon TGA in the bacterial genome. In some embodiments, the bacterium for use in the present invention comprise a deletion in the gene encoding peptide chain release factor 1 or a homo log thereof. In some embodiments, the bacterium for use in the present invention comprise a deletion of the prfA gene (see, e.g., Lajoie et al. (2013)). In some embodiments, the bacterium is of the Escherichia coli strain C321 (Addgene bacterial strain #48999).
  • the bacterium is of the Escherichia coli strain C321.AA (Addgene bacterial strain #48998). In some embodiments, the bacterium is of the Escherichia coli strain C321.AA.exp (Addgene bacterial strain #49018). [00157] In some embodiments, the bacterium for use in the present invention comprise a deletion of the endogenous gene encoding the protein in which a nonstandard amino acid is being incorporated. In some embodiments, the bacterium comprises a deletion in the csgA gene. In some embodiment, the bacterium comprises a deletion of a curli operon. In some embodiments, the bacterium comprises a deletion of one or more endogenous Csg genes.
  • the bacterium comprises a deletion of csgA. In some embodiments, the bacterium comprises a deletion of csgB. In some embodiments, the bacterium comprises a deletion of csgC. In some embodiments, the bacterium comprises a deletion of csgD. In some embodiments, the bacterium comprises a deletion of csgE. In some embodiments, the bacterium comprises a deletion of csgF. In some embodiments, the bacterium comprises a deletion of csgG. In some embodiments, the bacterium comprises a deletion of the csgBAC operon. In some embodiments, the bacterium comprises a deletion of the csgDEFG operon.
  • the bacterium comprises a deletion of the csgBAC and csgDEFG operons. In some embodiments, the bacterium comprises a deletion in the inaV gene. In some embodiments, the bacterium comprises a deletion in the traT gene. In some embodiments, the bacterium comprise a deletion in the malE gene.
  • biofilms comprising the engineered bacterium described herein are also provided.
  • the bio film comprises an engineered bacterium described herein and a protein comprising a nonstandard amino acid expressed by an engineered bacterium described herein.
  • the bio film comprises a protein comprising a nonstandard amino acid expressed by an engineered bacterium described herein.
  • the bio film comprises a bacterium ⁇ e.g., an engineered bacterial cell described herein).
  • the bio film does not comprise a bacterium ⁇ e.g., an engineered bacterial cell described herein).
  • the bio film comprises a curli fiber composed of bacterial extracellular matrix protein having a nonstandard amino acid. In some embodiments, the biofilm comprises curli fiber comprising CsgA protein having a nonstandard amino acid. In some embodiments, the nonstandard amino acid has been reacted with a detectable compound or drug as described herein.
  • compositions comprising the engineered bacterium described herein may be used to diagnose, treat, manage, ameliorate, and/or prevent a disease or disorder, as described herein
  • Pharmaceutical compositions comprising one or more engineered bacteria, alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers are provided.
  • the pharmaceutical composition comprises one species, strain, or subtype of bacteria that are engineered to comprise the genetic modifications described herein, e.g. , to express at least one orthogonal translation system and at least one protein comprising a nonstandard amino acid.
  • the pharmaceutical composition comprises two or more species, strains, and/or subtypes of bacteria that are each engineered to comprise the genetic modifications described herein, e.g. , to express at least one orthogonal translation system and at least one protein comprising a nonstandard amino acid.
  • compositions described herein may be formulated in a conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into
  • compositions for pharmaceutical use are known in the art (see, e.g., "Remington's Pharmaceutical Sciences,” Mack Publishing Co., Easton, PA).
  • the pharmaceutical compositions are subjected to tableting, lyophilizing, direct compression, conventional mixing, dissolving, granulating, levigating, emulsifying, encapsulating, entrapping, or spray drying to form tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated.
  • Appropriate formulation depends on the route of
  • the engineered bacteria described herein may be formulated into pharmaceutical compositions in any suitable dosage form (e.g. , liquids, capsules, sachet, hard capsules, soft capsules, tablets, enteric coated tablets, suspension powders, granules, or matrix sustained release formations for oral administration) and for any suitable type of administration (e.g. , oral, topical, injectable, immediate-release, pulsatile-release, delayed-release, or sustained release).
  • suitable dosage amounts for the engineered bacteria may range from about 10 5 to 10 12 bacteria, e.g. , approximately 10 5 bacteria, approximately 10 6 bacteria, approximately 10 7 bacteria, approximately 10 8 bacteria, approximately 10 9 bacteria, approximately 10 10 bacteria,
  • the composition may be administered once or more daily, weekly, or monthly.
  • the engineered bacterium may be formulated into pharmaceutical compositions comprising one or more pharmaceutically acceptable carriers, thickeners, diluents, buffers, buffering agents, surface active agents, neutral or cationic lipids, lipid complexes, nanoparticles, liposomes, penetration enhancers, carrier compounds, and other
  • any one of the detectable compound, inducer, and/or nonstandard amino acid may also be formulated into pharmaceutical compositions comprising one or more pharmaceutically acceptable carriers, thickeners, diluents, buffers, buffering agents, surface active agents, neutral or cationic lipids, lipid complexes, nanoparticles, liposomes, penetration enhancers, carrier compounds, and other pharmaceutically acceptable carriers or agents.
  • the pharmaceutical composition may include, but is not limited to, the addition of calcium bicarbonate, sodium bicarbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20.
  • the engineered bacterium may be administered and formulated as neutral or salt forms.
  • Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
  • the engineered bacterium disclosed herein may be administered topically and formulated in the form of an ointment, cream, transdermal patch, lotion, gel, shampoo, spray, aerosol, solution, emulsion, or other form well-known to one of skill in the art. See, e.g.,
  • viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity greater than water are employed.
  • suitable formulations include, but are not limited to, solutions, suspensions, emulsions, creams, ointments, powders, liniments, salves, etc., which may be sterilized or mixed with auxiliary agents (e.g., preservatives, stabilizers, wetting agents, buffers, or salts) for influencing various properties, e.g. , osmotic pressure.
  • Suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g. , a gaseous propellant, such as freon) or in a squeeze bottle.
  • a pressurized volatile e.g. , a gaseous propellant, such as freon
  • Moisturizers or humectants can also be added to pharmaceutical compositions and dosage forms. Examples of such additional ingredients are well known in the art.
  • compositions disclosed herein may be administered orally and formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, etc.
  • Pharmacological compositions for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores.
  • Suitable excipients include, but are not limited to, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol;
  • cellulose compositions such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium
  • carbomethylcellulose and/or physiologically acceptable polymers such as
  • PVP polyvinylpyrrolidone
  • PEG polyethylene glycol
  • Disintegrating agents may also be added, such as cross-linked polyvinylpyrrolidone, agar, alginic acid or a salt thereof such as sodium alginate.
  • Tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g. , pregelatinised maize starch,
  • polyvinylpyrrolidone hydroxypropyl methylcellulose, carboxymethylcellulose, polyethylene glycol, sucrose, glucose, sorbitol, starch, gum, kaolin, and tragacanth
  • fillers e.g. , lactose, microcrystalline cellulose, or calcium hydrogen phosphate
  • lubricants e.g.
  • the tablets may be coated by methods well known in the art.
  • a coating shell may be present, and common membranes include, but are not limited to, polylactide, polyglycolic acid, polyanhydride, other biodegradable polymers, alginate- polylysine-alginate (APA), alginate-polymethylene-co-guanidine-alginate (A-PMCG-A), hydro ymethylacry late- methyl methacrylate (HEMA-MMA), multilayered HEMA-MMA- MAA, polyacrylonitrilevinylchloride (PAN-PVC), acrylonitrile/sodium methallylsulfonate (AN-69), polyethylene glycol/poly pentamethylcyclopentasiloxane/polydimethylsiloxane (PEG/PD5/PDMS), poly N,N- dimethyl acrylamide (PDMAAm), siliceous encapsulates, cellulose sulphate/sodium alginate/polymethylene-co-guanidine (CS/A/PMCG),
  • polymethacrylates polyamino acids, and enteric coating polymers.
  • the pharmaceutical compositions may be enterically coated for release into the gut or a particular region of the gut, for example, the large intestine.
  • the typical pH profile from the stomach to the colon is about 1-4 (stomach), 5.5-6 (duodenum), 7.3-8.0 (ileum), and 5.5-6.5 (colon).
  • the pH profile may be modified.
  • the coating is degraded in specific pH environments in order to specify the site of release. In some embodiments, at least two coatings are used. In some
  • the outside coating and the inside coating are degraded at different pH levels.
  • Liquid preparations for oral administration may take the form of solutions, syrups, suspensions, or a dry product for constitution with water or other suitable vehicle before use.
  • Such liquid preparations may be prepared by conventional means with pharmaceutically acceptable agents such as suspending agents (e.g. , sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid).
  • the preparations may also contain buffer salts, flavoring, coloring, and sweetening agents as appropriate.
  • Preparations for oral administration may be suitably formulated for slow release, controlled release, or sustained release of the engineered bacterium described herein.
  • the pharmaceutical composition is formulated for intraintestinal administration, intrajejunal administration, intraduodenal administration, intraileal administration, gastric shunt administration, or intracolic administration, via nanoparticles, nanocapsules, microcapsules, or microtablets, which are enterically coated or uncoated.
  • the pharmaceutical compositions may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g. , conventional suppository bases such as cocoa butter or other glycerides.
  • the compositions may be suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain suspending, stabilizing and/or dispersing agents.
  • compositions described herein may be administered intranasally, formulated in an aerosol form, spray, mist, or in the form of drops, and conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebuliser, with the use of a suitable propellant (e.g. , dichlorodifluoromethane,
  • Pressurized aerosol dosage units may be determined by providing a valve to deliver a metered amount.
  • Capsules and cartridges e.g. , of gelatin
  • suitable powder base such as lactose or starch.
  • the pharmaceutical compositions may be administered and formulated as depot preparations. Such long acting formulations may be administered by implantation or by injection, including intravenous injection, subcutaneous injection, local injection, direct injection, or infusion.
  • compositions may be formulated with suitable polymeric or hydrophobic materials (e.g. , as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives (e.g., as a sparingly soluble salt).
  • suitable polymeric or hydrophobic materials e.g. , as an emulsion in an acceptable oil
  • ion exchange resins e.g., as an emulsion in an acceptable oil
  • sparingly soluble derivatives e.g., as a sparingly soluble salt
  • Single dosage forms may be in a liquid or a solid form.
  • Single dosage forms may be administered directly to a patient without modification or may be diluted or reconstituted prior to administration.
  • a single dosage form may be administered in bolus form, e.g. , single injection, single oral dose, including an oral dose that comprises multiple tablets, capsule, pills, lozenge, etc.
  • bolus form e.g. , single injection, single oral dose, including an oral dose that comprises multiple tablets, capsule, pills, lozenge, etc.
  • a single dosage form may be administered over a period of time, e.g. , by infusion.
  • Single dosage forms of the pharmaceutical composition may be prepared by portioning the pharmaceutical composition into smaller aliquots, single dose containers, single dose liquid forms, or single dose solid forms, such as tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated.
  • a single dose in a solid form may be reconstituted by adding liquid, typically sterile water or saline solution, prior to administration to a patient.
  • the composition can be delivered in a controlled release or sustained release system.
  • a pump may be used to achieve controlled or sustained release.
  • polymeric materials can be used to achieve controlled or sustained release of the therapies of the present disclosure (see e.g. , U.S. Patent No. 5,989,463).
  • polymers used in sustained release formulations include, but are not limited to, poly(2-hydroxy ethyl methacrylate), poly( methyl methacrylate), poly(acrylic acid), poly(ethylene-co-vinyl acetate), poly(methacrylic acid), polyglycolides (PLG), polyanhydrides, poly(N- vinyl pyrrolidone), poly( vinyl alcohol), polyacrylamide, poly(ethylene glycol), polylactides (PLA), poly(lactide-co-glycolides) (PLGA), and polyorthoesters.
  • the polymer used in a sustained release formulation may be inert, free of leachable impurities, stable on storage, sterile, and biodegradable.
  • a controlled or sustained release system can be placed in proximity of the prophylactic or therapeutic target, thus requiring only a fraction of the systemic dose. Any suitable technique known to one of skill in the art may be used.
  • an engineered bacterium disclosed herein comprising a protein having a nonstandard amino acid.
  • the engineered bacterium described herein comprise a protein having a nonstandard amino acid, wherein the nonstandard amino acid comprises a bioorthogonal reactive functional group.
  • the engineered bacterium can be exposed to a labeling reagent or detectable compound also having a bioorthogonal reactive functional group that will react the bioorthogonal reactive functional group of the nonstandard amino acid.
  • methods for labeling a protein having a nonstandard amino acid expressed by an engineered bacterium described herein are provided.
  • the protein comprises a nonstandard amino acid, wherein the nonstandard amino acid comprises a bioorthogonal reactive functional group.
  • the protein can be reacted with a labeling reagent or detectable compound having a bioorthogonal reactive functional group to attach the labeling reagent or detectable compound to the bioorthogonal reactive functional group of the nonstandard amino acid.
  • the method is performed in vitro. In some embodiments, the method is performed in vivo.
  • the method comprises administering to the subject an engineered bacterium having a protein comprising at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid of the protein, thereby labeling the engineered bacterium in the subject in vivo.
  • the labeling reagent or detectable compound comprises a fluorescent moiety, a radioactive moiety, a colorimetric dye, a fluorescent dye, a luminescent dye, or a magnetic resonance imaging (MRI) contrast agent, a CT contrast agent, a PET contrast agent, or an ultrasound contrast agent.
  • the labeling reagent or detectable compound comprises a drug delivery vehicle selected from the group consisting of a nanocarrier (e.g., a polymer), a nanoparticle (e.g., a metal gold, silver, or iron
  • the labeling reagent or detectable compound comprises a bioorthogonal reactive functional group selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a hydrazine moiety, a tetrazine moiety, a norbornene moiety and a hydroxylamine moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises a ketone moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises a hydrazine moiety or a hydroxylamine moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises an azide moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises an alkyne moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises an alkyne moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises an azide moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises a tetrazine moiety
  • the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises a norbornene moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises a norbornene moiety
  • the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises a tetrazine moiety.
  • the labeling reagent or detectable compound is a detectable or traceable compound.
  • the labeling reagent or detectable compound is selected from the group consisting of a fluorescent moiety, a radioactive moiety, a
  • labeling reagents or detectable compounds include, but are not limited to, radioisotopes, dyes, enzymes, contrast agents, fluorescent compounds or molecules such as a fluorescent dye, MRI contrast agents (e.g. , paramagnetic ions such as Gadolinium(III)-based MRI contrast agents, , superparamagnetic iron oxide (SPIO) and ultrasmall
  • F-based contrast agents such as [ F] maltose, [ F]-maltohexaose and [ F]2- fluorodeoxysorbitol (FDS) and 64 Cu-based contrast agents
  • CT contrast agents e.g., iodine- based contrast agents
  • ultrasound contrast agents and small molecules including both inorganic and organic small molecules.
  • the labeling reagent or detectable compound may include any suitable label or detectable group detectable by optical, spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means including but not limited to biotin, dyes, fluorophores, antigens, porphyrins, chromophores, and radioactive isotopes. Diagnostic agents include, but are not limited to, radiolabels
  • radioacoustic labels e.g., S, 1, P, H, C
  • enzyme labels e.g. , horseradish peroxidase, alkaline phosphatase
  • gold beads e.g., gold beads
  • chemiluminescence labels e.g. , ligands (e.g. , biotin, digoxin) and/or fluorescence labels (e.g.
  • rhodamine phycoerythrin, fluorescein, fluorescent proteins
  • a fluorescent protein including, but not limited to, a green fluorescent protein or one of its many modified forms, energy absorbing and energy emitting agents, fluorescent dyes (e.g., fluorescein, fluorescein-isothiocyanate (FITC), Texas red, rhodamine, green fluorescent protein, enhanced green fluorescent protein, lissamine, phycoerythrin, near-IR dye, Cy2, Cy3, Cy3.5, Cy5, Cy5.5, Cy7, FluorX (Amersham), and SyBR Green I & II (Molecular Probes)), chemiluminescent groups, and chromogenic agents.
  • fluorescent dyes e.g., fluorescein, fluorescein-isothiocyanate (FITC), Texas red, rhodamine, green fluorescent protein, enhanced green fluorescent protein, lissamine, phycoerythrin, near-IR dye, Cy2, Cy3, Cy3.5, Cy5, Cy
  • the labeling reagent or detectable compound comprises a dibenzocyclooctyne group (DBCO).
  • the labeling reagent or detectable compound is selected from the group consisting of BDP-FL-PEG4-DBCO, DBCO-PEG4-5/6-FAM, DBCO-PEG4-ATTO-488, DBCO-PEG4-5/6-Carboxyrhodamine 110, DBCO-PEG4-5/6-TAMRA, DBCO-Sulfo-Cy3, DBCO-5/6-Sulforhodamine B, DBCO-PEG4-5/6-Sulforhodamine B, DBCO-5/6-Texas Red, DBCO-PEG4-5/6-Texas Red, DBCO-Sulfo-Cy5, DBCO-Cy5.5, DBCO-Cy7.
  • BDP-FL-PEG4-DBCO DBCO-PEG4-5/6-FAM
  • DBCO-PEG4-ATTO-488
  • the labeling reagent or detectable compound is dibenzyl cyclooctyne- conjugated Cy5 (DBCO-Cy5). In some embodiments, the labeling reagent or detectable compound is dibenzyl cyclooctyne-conjugated Cy3 (DBCO-Cy3).
  • Methods for detection of the detectable compound include, for example, microscopy (e.g., confocal microscopy), x-rays, ultrasound, X-ray computed tomography (CT), magnetic resonance imaging (MRI), positron emission tomography (PET) scan, ultrasound imaging (tomography), optical imaging, scintigraphy (including PET scintigraphy and gamma scintigraphy), and near infrared imaging.
  • microscopy e.g., confocal microscopy
  • CT computed tomography
  • MRI magnetic resonance imaging
  • PET positron emission tomography
  • PET positron emission tomography
  • optical imaging e.g., positron emission tomography
  • the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid and detecting the detectable compound in the subject, thereby detecting the distribution of the engineered bacterium in the subject.
  • the engineered bacterium is administered to the gastrointestinal tract of the subject. In some embodiments, the engineered bacterium is administered to the respiratory tract of the subject. In some embodiments, the engineered bacterium is administered to the circulatory system of the subject. In some embodiments, the engineered bacterium is administered to an organ or tissue selected from the group consisting of mouth, esophagus, heart, lung, stomach, small intestine, large intestine, rectum, anal canal, hair, and skin. In some embodiments, the engineered bacterium is administered to specifically target a lesion in the subject. In some embodiments, the engineered bacterium senses changes in the local gut environment that indicates a disease or disorder.
  • the biofilm comprises a protein having a nonstandard amino acid that is secreted by the engineered bacterium.
  • the biofilm comprises an engineered bacterium disclosed herein.
  • the biofilm comprises a protein having a nonstandard amino acid produced by the engineered bacterium disclosed herein (e.g., CsgA).
  • the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid and detecting the detectable compound in the subject, thereby determining the distribution of the biofilm produced by the engineered bacterium in the subject.
  • the biofilm is present in the gastrointestinal tract of the subject.
  • the biofilm is present in the respiratory tract of the subject. In some embodiments, the biofilm is present in the circulatory system of the subject. In some embodiments, the biofilm is present in an organ or tissue selected from the group consisting of mouth, esophagus, lung, heart, stomach, small intestine, large intestine, rectum, anal canal, hair, and skin.
  • the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a drug comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the drug to the nonstandard amino acid, thereby delivering the drug to the subject.
  • any drug comprising a bioorthogonal reactive functional group that reacts with a bioorthogonal reactive functional group of the nonstandard amino acid may be used.
  • the drug comprises a drug delivery vehicle selected from the group consisting of a nanocarrier (e.g., a polymer), a nanoparticle (e.g. , a metal gold, silver, or iron nanoparticle), a liposome, a dendrimer, a carbon nanotube, a micelle, and a protein.
  • the bioorthogonal reactive functional group may be present on the drug delivery vehicle.
  • the drug comprises a bioorthogonal reactive functional group selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a hydrazine moiety, a tetrazine moiety, a norbornene moiety and a hydroxylamine moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises a ketone moiety
  • the bioorthogonal reactive functional group of the drug comprises a hydrazine moiety or a hydroxylamine moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises an azide moiety, and the bioorthogonal reactive functional group of the drug comprises an alkyne moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises an alkyne moiety, and the bioorthogonal reactive functional group of the drug comprises an azide moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises a tetrazine moiety, and the bioorthogonal reactive functional group of the drug comprises a norbornene moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises a norbornene moiety
  • the bioorthogonal reactive functional group of the drug comprises a tetrazine moiety.
  • the drug is selected from the group consisting of a nonsteroidal ant i- inflammatory drug (NSAID), a steroidal ant i- inflammatory drugs, an antifungal drugs, a detoxifying drug, an analgesics, a bronchodilator, an antibiotic, a monoclonal antibody, a diuretic, an immunosuppressant, a lymphokine, a hormone and a calcium channel blocker.
  • NSAID nonsteroidal ant i- inflammatory drug
  • an antifungal drugs a detoxifying drug
  • an analgesics a bronchodilator
  • an antibiotic a monoclonal antibody
  • a diuretic an immunosuppressant
  • a lymphokine a hormone and a calcium channel blocker.
  • the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid and detecting the detectable compound in the subject, thereby diagnosing the disease or disorder in the subject.
  • the disease or disorder is a gastrointestinal disease or disorder. In some embodiments, the disease or disorder is a respiratory disease or disorder. In some embodiments, the disease or disorder is an autoimmune disease or disorder. In some embodiments, the disease is an infectious disease. In some embodiments, the disease or disorder is a proliferative disease or disorder. In some embodiments, the disease or disorder is cancer. In some embodiments, the disease or disorder is a precancerous lesion. In some embodiments, the disease or disorder is an inflammatory disease or disorder.
  • the disease or disorder is selected from the group consisting of cystic fibrosis, congestive heart failure, benign prostatic hyperplasia, a gastrointestinal motility disorder, irritable bowel syndrome, chronic constipation, gastroesophageal reflux disease, functional heartburn, dyspepsia, functional dyspepsia, non-ulcer dyspepsia, gastroparesis, chronic intestinal pseudo-obstruction, colonic pseudo-obstruction, Crohn's disease, ulcerative colitis, and inflammatory bowel disease.
  • the subject is an animal. In some embodiments, the subject is a mammal. In some embodiments, the subject is a domesticated animal. In some embodiments, the subject is a ruminant. In some embodiments, the subject is a non-human mammal. In some embodiments, the subject is a human subject.
  • the method may comprise preparing a pharmaceutical composition with at least one genetically engineered species, strain, or subtype of bacteria described herein, and administering the pharmaceutical composition to a subject in a therapeutically effective amount.
  • the engineered bacteria disclosed herein are administered orally, e.g., in a liquid suspension.
  • the engineered bacteria are lyophilized in a gel cap and administered orally.
  • the engineered bacteria are administered via a feeding tube or gastric shunt.
  • the engineered bacteria are administered rectally, e.g., by enema.
  • the engineered bacteria are administered topically, intraintestinally, intrajejunally,
  • intraduodenally intraileally, and/or intracolically.
  • the methods disclosed herein may comprise administration of a composition alone or in combination with one or more additional therapies, e.g., chemotherapy.
  • the pharmaceutical composition may be administered alone or in combination with one or more additional therapeutic agents.
  • An important consideration in the selection of the one or more additional therapeutic agents is that the agent(s) should be compatible with the bacteria, e.g., the agent(s) must not interfere with or kill the bacteria.
  • compositions comprising the engineered bacterium described herein may be administered to a subject, and a period of time is allowed to lapse in order to allow the bacterium to engraft and/or colonize in the subject (e.g., in the subject's gastrointestinal tract, skin and/or respiratory tract). Thereafter, any intervention using the methods described herein may be used.
  • nonstandard amino acid it may be necessary to administer a nonstandard amino acid to the subject that can be used by the orthogonal translation systems described herein to incorporate the nonstandard amino acid into the protein expressed by the engineered bacterium.
  • the nonstandard amino acid is administered in a pharmaceutical composition.
  • the nonstandard amino acid is administered to the subject as part of a nutritional product.
  • the nonstandard amino acid is administered orally, intravenously, intradermally or rectally.
  • the nonstandard amino acid is administered to the subject at least one, two, three, four, five, six, eight, twelve, sixteen, twenty, twenty-four, thirty-six or forty-eight hours prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group. In some embodiments, the nonstandard amino acid is administered to the subject at least one, two, three, four, five, six, or seven days prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group.
  • an agent i.e., an inducer
  • the inducer will activate the expression of one or more of the orthogonal translation system and the heterologous gene encoding the protein of interest.
  • the inducer is administered in a pharmaceutical composition.
  • the inducer is administered to the subject as part of a nutritional product.
  • the inducer is administered orally, intravenously, intradermally or rectally.
  • the inducer is administered to the subject at least one, two, three, four, five, six, eight, twelve, sixteen, twenty, twenty-four, thirty-six or forty-eight hours prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group. In some embodiments, the inducer is administered to the subject at least one, two, three, four, five, six, or seven days prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group.
  • both an inducer and a nonstandard amino acid are administered to the subject.
  • the inducer is administered to the subject concurrently with the nonstandard amino acid.
  • the inducer is administered the subject after the nonstandard amino acid is administered to the subject.
  • the inducer is administered before the nonstandard amino acid is administered to the subject.
  • the inducer and the nonstandard amino acid are administered in the same dosage form.
  • the inducer and the nonstandard amino acid are administered in separate dosage forms.
  • the inducer and the nonstandard are administered concurrently to the subject at least one, two, three, four, five, six, eight, twelve, sixteen, twenty, twenty-four, thirty-six or forty-eight hours prior to administering a detectable compound or drug to the subject comprising a
  • the inducer and the nonstandard amino acid are administered concurrently to the subject at least one, two, three, four, five, six, or seven days prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group.
  • an inducer, a nonstandard amino acid and a detectable agent are administered to the subject.
  • the inducer is administered to the subject concurrently with the non standard amino acid, followed by administration of the detectable agent to the subject.
  • the inducer is administered to the subject concurrently with the detectable agent, followed by administration of the nonstandard amino acid.
  • the nonstandard amino acid is administered concurrently with the detectable agent, followed by administration of the inducer.
  • the inducer, the nonstandard amino acid and the detectable agent are administered separately.
  • two or more of the inducer, the nonstandard amino acid and the detectable agent are administered in the same dosage form.
  • the inducer, the nonstandard amino acid and the detectable agent are administered in separate dosage forms.
  • Example 1 Generation of engineered bacteria expressing proteins comprising the nonstandard amino acid ?-AzF
  • Engineered heterologous nucleic acids expressing proteins comprising InaV, Trat, CsgA (as part of a synthetic curli csgBACEFG operon, which excludes the gene encoding the regulatory protein csgD), and MBP were cloned in pBbB8k plasmids, under the control of arabinose-inducible promoters. The proteins were cloned to incorporate a poly-histidine tag that allowed for affinity purification. Plasmid maps of engineered proteins are shown in Figures 1A and IB. Table 2 lists the DNA sequences of engineered proteins. Table 2. Sequences of engineered proteins containing the nonstandard amino acid p- AzF.
  • All proteins contain a poly-His tag (a 12 amino acid flexible linker followed by a 6X His tag).
  • p-AzF inserted in a linker are placed just after the 6 histidine tag, and before a 36 or 48 amino acid flexible linker and a myc Tag. The position of p-AzF amino acid residue(s) is indicated with a " :
  • WKVCEVAVADIIGLEEPGMVKFPRAEVVHVGDR IS AS HFIS ARQ ADP AS TPTPTPTPM ATPTP AA ANI
  • WKVCEVAVADIIGLEEPGMVKFPRAEVVHVGDR IS AS HFIS ARQ ADP AS TPTPTPTPM ATPTP AA ANI
  • E. coli Nissle (ECN) 1917 strain comprising a knockout of the csgBAC and csgDEFG operons was developed using the lambda red system.
  • ECN E. coli Nissle
  • pBbB8k plasmids containing the whole synthetic curli operon csgBACEFG operon
  • the knockout of the native curli operons allows for clear assessment of recombinant curli fibers production.
  • the developed curli operons knockout strain was used for all experiments described in Examples 2 - 8 below.
  • Bacterial cells were transformed with a pBbB8k plasmid encoding the engineered proteins above by inserting a TAG codon at the corresponding nucleotide location in the open reading frame of the protein, and with the plasmid pEVOL-pAzF (a gift from Peter Schultz (Addgene plasmid # 31186)) which encodes an orthogonal translation system that incorporates p-AzF into proteins encoded by nucleic acids having the TAG codon.
  • pEVOL-pAzF a gift from Peter Schultz (Addgene plasmid # 31186)
  • Engineered ECN were grown in 3 to 5 mL of Luria broth (LB) with the appropriate antibiotics (kanamycin for pBbB8k plasmids only, or kanamycin and
  • spectinomycin for pBbB8k and pEVOL-pAzF plasmids overnight at 37°C.
  • Fresh cultures were inoculated by diluting the overnight culture 100 times in fresh LB with the appropriate antibiotic, and the cultures were grown at 37° C to an optical density at 600 nm (OD600) of 0.6 to 0.7. The cultures were then induced with 0.01 to 0.2 % arabinose (inducer) overnight.
  • p-AzF was added to the cultures to a final concentration ranging between 0.1 to 5 mM. The cells were then pelleted, resuspended in lysis buffer and sonicated to complete the lysis.
  • Example 2 Maltose-binding protein (MBP) comprising the nonstandard amino acid p- AzF was expressed and purified from E. coli Nissle 1917
  • Example 1 three different bacterial cells were used: cells transformed with a single plasmid to express wild-type MBP (without a nonstandard amino acid), where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express wild-type MBP (without a nonstandard amino acid) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS”). 0.05% arabinose was added as an inducer to induce the production of the orthogonal translation system and of MBP.
  • p-AzP was not added to the culture media of the bacteria of the first group ⁇ i.e., No mutation/No OTS and UAG mutation/With OTS). However, p-AzF was added at a final concentration of 1 mM to the culture media of the bacteria of the remaining two groups ⁇ i.e., No mutation/With OTS and UAG mutation/With OTS) at the time of induction. As shown in Figure 3, E.
  • coli Nissle comprising an orthogonal translation system encoded by the plasmid pEVOL-pAzF, and a heterologous nucleic acid encoding MBP protein comprising a nonstandard amino acid can be successfully expressed in and purified from the bacterial cells without needing to recode the bacterial genome to remove the used labeling codon (TAG).
  • TAG used labeling codon
  • Example 3 MBP comprising the nonstandard amino acid p-AzF purified from in E. coli Nissle was labeled with DBCO-Cy5
  • MBP comprising the nonstandard amino acid p-AzF purified from in E. coli Nissle could successfully be reacted with a detectable moiety (DBCO-Cy5).
  • MBP expression and purification was performed as described in Examples 1 and 2.
  • DBCO-Cy5 dye For labeling of proteins with DBCO-Cy5, the purified protein eluates were incubated for 1 hour at room temperature with DBCO-Cy5 dye at molar ratios ranging between 1: 10 to 10: 1 MBP:DBCO-Cy5. Labeling reactions were run on SDS- PAGE gels and Cy5 fluorescence was detected using a FluorChem M System.
  • MBP comprising /?-AzF can be successfully reacted with DBCO-Cy5 to label the protein. Further, very little background incorporation of p-AzP into endogenous E. coli proteins appears to have occurred, as determined by analyzing the background fluorescence in cells transformed with a plasmid to express wild-type MBP (without a nonstandard amino acid) expressed and a plasmid comprising an orthogonal translation system ("No
  • E. coli Nissle could successfully used to express an operon comprising a heterologous gene encoding CsgA comprising the non-standard amino acid p-Az ⁇ .
  • three different bacterial cells were used: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon), where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • p- zF was not added to the culture media of the bacteria of the first group ⁇ i.e., No mutation/No OTS and UAG mutation/With OTS). However, p- zF was added at a final concentration of 1 mM to the culture media of the bacteria of the remaining two groups ⁇ i.e., No mutation/With OTS and UAG mutation/With OTS) at the time of induction. As shown in Figure 5, E.
  • coli Nissle comprising an orthogonal translation system encoded by the plasmid pEVOL-pAzF, and a heterologous nucleic acid encoding the synthetic curli operon, which encodes the CsgA protein comprising a nonstandard amino acid can be successfully expressed in and purified from the bacterial cells.
  • a heterologous nucleic acid encoding the synthetic curli operon, which encodes the CsgA protein comprising a nonstandard amino acid can be successfully expressed in and purified from the bacterial cells.
  • Example 5 CsgA comprising the nonstandard amino acid ⁇ - ⁇ purified from in E. coli Nissle was labeled with DBCO-Cy5
  • CsgA comprising the nonstandard amino acid p-AzF purified from in E. coli Nissle could successfully be reacted with a detectable moiety (DBCO-Cy5).
  • CsgA expression and purification was performed as described in Examples 1 and 2.
  • DBCO-Cy5 concentrated 500 mM eluates of the purified protein were incubated for 1 hour at room temperature with DBCO-Cy5 dye at a molar excess of DBCO-Cy5 to MBP. Labeling reactions were run on SDS-PAGE gels and Cy5 fluorescence was detected using a FluorChem M System.
  • CsgA comprising p-AzP can be successfully reacted with DBCO-Cy5 to label the protein. Further, the apparent higher background staining observed could be due to the low CsgA concentration loaded onto the SDS-PAGE gel.
  • Example 6 CsgA comprising the nonstandard amino acid ?-AzF expressed in E. coli Nissle 1917 forms curli fibers
  • the membranes were then washed in water, and the solvent was gradually exchanged to ethanol with an increasing ethanol 15 minute incubation step gradient (25 %, 50 %, 75 % and 100 % (v/v) ethanol).
  • the membranes were dried in a critical point dryer and sputtered until they were coated in a 5 nm layer of Pt/Pd. Imaging was performed using a Zeiss Ultra 55 Field Emission SEM. As shown in Figure 9, no curli fiber production was observed in cells expressing MBP as expected, since the strain of E. coli Nissle has a deletion of the endogenous curli operons.
  • DBCO-Cy5 could be varied by administering less p-AzP to the cultured cells. As shown in Figure 13, when cells were grown in media containing varying concentrations of the nonstandard amino acid, lower concentrations of p-AzP resulted in a smaller fraction of labeled fibers after incubation with DBCO-Cy5.
  • Example 7 Growth of engineered E. coli Nissle to express proteins having a
  • E. coli Nissle was grown in a deep- well 96 well plate, and arabinose, /?-AzF, or arabinose and /?-AzF were added to the culture media at an OD600 of ⁇ 0.2. Growth curves of E. coli Nissle cells either: lacking plasmid ("No plasmid"); comprising an orthogonal translation system
  • Example 8 TraT was expressed and purified from E. coli Nissle 1917
  • Example 9 In vivo labeling of engineered bacteria
  • the number of recombinant proteins produced per cell is in the order of 10 6 proteins/cells (approximately the same number of available bioorthogonal reactive functional groups (i.e., azide moieties) per cell).
  • concentration of the bioorthogonal reactive functional group azide in the gut of a mouse could range between tens of nM to
  • mice For in vivo studies, 6-8 week old female mice are administered selection marker antibiotics (e.g., kanamycin and spectinomycin; 1 g/L in drinking water), to maintain the plasmids of the engineered bacteria, continuously during the course of the experiment beginning 24 hours prior to administration of the engineered bacteria.
  • selection marker antibiotics e.g., kanamycin and spectinomycin; 1 g/L in drinking water
  • the mice are divided into four separate groups: one experimental group and three control groups.
  • mice of control group 1 are administered engineered bacteria (as described, for example in Example 1 above) and a detectable compound (e.g., DBCO-Cy5), but will not receive inducer (e.g., arabinose, to induce the expression of the protein comprising /?-AzF and the expression of the orthogonal translation system) nor the nonstandard amino acid (e.g. , p-AzF).
  • inducer e.g., arabinose, to induce the expression of the protein comprising /?-AzF and the expression of the orthogonal translation system
  • nonstandard amino acid e.g. p-AzF
  • mice of control group 2 are administered detectable compound, but will not be administered engineered bacteria, inducer, nor nonstandard amino acid.
  • mice of control group 3 do not receive engineered bacteria, inducer, nonstandard amino acid, nor detectable compound.
  • mice the experimental group and of control group 1 are administered a single dose of engineered bacteria by oral gavage (10 9 -10 10 colony forming units (CFUs)).
  • mice of the experimental group and control group 1 are administered inducer (e.g. , arabinose at 10 g/L in drinking water) and nonstandard amino acid (e.g. , p-AzF at 0.25 g/L in drinking water).
  • inducer e.g. , arabinose at 10 g/L in drinking water
  • nonstandard amino acid e.g. , p-AzF at 0.25 g/L in drinking water
  • the mice of the experimental group, control group 1 and control group 2 are administered detectable compound (e.g. , DBCO-Cy5, 100 ⁇ ⁇ at 0.08 mM) by oral gavage.
  • mice Body weight, plasma samples, and fecal samples are taken throughout the duration of the study. In vivo imaging of the mice using the IVIS Spectrum In Vivo Imaging System (PerkinElmer) is performed throughout the study to determine labeling of the engineered bacteria in vivo. Fecal samples are also analyzed by fluorescence microscopy to determine bacterial labeling. Upon conclusion of the study at day 13, the mice can be euthanized, and internal organs (liver, spleen, intestines) collected and assayed.
  • IVIS Spectrum In Vivo Imaging System PerkinElmer
  • Example 10 In vivo labeling and detection of engineered bacteria comprising mutant CsgA or mutant TraT having the non-standard amino acid pAzF
  • Plasmids expressing either wild-type (wt) TraT or a mutant TraT having a labeling codon were transformed into PBP8 cells with or without the pEVOL-pAzF plasmid, which encodes an orthogonal translation system (OTS), and expression was induced. Proteins were purified after cells lysis and detected using Western Blot with either anti-myc or anti-his antibodies. Both wt and mutant TraT proteins have an expected molecular weight of about 27 kDa, each variants having a his-tag before either the stop-codon or the amber-codon (i.e. , labeling codon), respectively (FIG. 15A).
  • a second band having a molecular weight of about 34 kDa was observed in Western Blots of cells expressing the mutant TraT protein using either an anti-His antibody (FIG. 15A) or an anti-myc antibody (FIG. 15B).
  • the 34 kDa band is the expected size of the full length mutant TraT.
  • FIG. 15C in cells lacking the OTS and not grown in the presence of NSAA, about 5% of the protein expressed was the 34 kDa variant. This read-through might be a result of an Amber suppression mutation.
  • about 35% of TraT protein observed in the cells expressing both the mutant TraT, the OTS, and cultured in the presence of NSAA was full length. Premature termination of translation appears to have occurred at the amber codon, perhaps due to inefficiencies of the OTS.
  • Mutant TraT comprising pAzF, mutant CsgA comprising pAzF, wild-type
  • CsgA, and wild-type TraT were purified, incubated with DBCO-Cy5 and analyzed through SDS PAGE.
  • Two bands, each representing TraT or CsgA were visible using red fluorescence imaging (FIG. 16), and solely observed in cells comprising both the plasmid expressing the mutant TraT or mutant CsgA and the plasmid comprising the OTS, when the cells were grown in the presence of the NSAA pAzF. Since no protein bands were observed in the negative controls (i.e., bacterial cells expressing wt CsgA or wt TraT in the presence or absence of both the OTS and NSAA pAzF), both the mutation and OTS are necessary for the incorporation of the NSAA.
  • Cy5 either non-transformed PBP8 cells (control), or PBP8 cells transformed to express mutant TraT and the OTS were incubated with either 100 ⁇ or 200 ⁇ DBCO-Cy5 at either 25°C or 37°C.
  • labeling performed using 200 ⁇ DBCO-Cy5 at 25°C resulted in comparable fluorescence intensity as labeling performed using 100 ⁇ DBCO-Cy5 at 37°C.
  • concentrations of DBCO-Cy5 for labeling demonstrated that fluorescence intensity increased proportionally with higher concentration of DBCO-Cy5, with saturation observed at 300 ⁇ DBCO-Cy5.
  • FIGs. 18C and 18D cells expressing either mutant CsgA or mutant TraT incubated with 200 ⁇ DBCO-Cy5 for labeling between 1-4 hours, showed maximum labeling after 2 hours. Fluorescence intensity decrease after 2 hours, which may be due to protein degradation.
  • Cy5- DBCO labeling was detected in both PBP8 cells expressing either mutant CsgA comprising pAzF or mutant TraT comprising pAzF and the OTS. Further, as shown in FIGs. 19 and 20, a bimodal distribution was observed when flow cytometry was performed on cell
  • mice comprising pAzF labelled with Cy5-DBCO were detectable after passing the gastrointestinal tract, in vivo experiments were designed to label the bacteria in vivo. Briefly, four groups of mice were treated with either (a) Cy5-DBCO dye alone (Group 1); (b) bacteria expressing wild-type CsgA (Group 2); (c) bacteria expressing mutant CsgA comprising pAzF in the absence of arabinose inducer (Group 3); or (d) bacteria expressing mutant CsgA comprising pAzF in the presence of arabinose inducer (Group 4). For the groups of mice receiving bacteria (Groups 2-4), unlabeled bacteria were administered by oral gavage at day 0. Mice were continuously administered pAzF in water.
  • mice from Groups 2 and 4 were also administered the arabinose inducer. Subsequently (day 1), mice in all groups were administered Cy5-DBCO by gavage and no longer administered pAzF and arabinose (as applicable) 2 hours prior to administration of Cy5-DBCO. Mice were imaged using the VIS Lumina II system (PERKIN ELMER) to detect the clearance rate of the dye alone as well as the labeled bacteria. As shown in FIG. 24, a difference in the residence time was observed between mice administed the Cy5-DBCO dye alone (Group 1) and mice administered both Cy5-DBCO and bacteria expressing mutant CsgA comprising pAzF in the presence of arabinose inducer (Group 4).
  • VIS Lumina II system VIS Lumina II system
  • the Cy5-DBCO dye was no longer detectable after about 24 hours in the mice of Group 1, while fluorescence was detectable for an extended period of time (> 35 hours) in the majority of mice of Group 4, indicative of labeling of the the engineered bacteria. The differences in fluorescence residence time was statistically significant (see FIG. 25).
  • mutant CsgA comprising pAzF were detectable in some of the isolated bacteria. Not all of the bacteria retained the ability to express mutant CsgA comprising pAzF which may be due to the loss of the plasmid encoding the mutant CsgA protein, and/or the plasmid encoding the OTS.
  • mice were sacrificed and the gastrointestinal tract was imaged using the IVIS Lumina II system (PERKIN ELMER). As shown in FIGs. 27A and 27B, a significant difference was observed in the level of fluorescence detected in mice receiving the control untransformed PBP8 bacteria and mice receiving bacteria expressing the mutant CsgA comprising pAzF. Non-specific binding of the Cy5-DBCO dye was detected in the gut.
  • mice were administered PBP8 cells expressing either mutant CsgA comprising pAzF and the OTS, arabinose inducer, and pAzF.
  • a group of mice were not treated with bacteria, nor administered pAzF and arabinose.
  • the gastrointestinal tract tissue was collected from the mice and imaged using the IVIS Lumina II system (PERKIN ELMER) (see FIGs. 28 and 29). The cecal tissue was isolated and homogenized.
  • HFIP:TFA to disassemble aggregated curli fibers.
  • Cy5-DBCO-labelled mutant CsgA was detected in the soluble fractions of untreated cecum homogenate of every mouse to which bacteria expressing mutant CsgA comprising pAzF was administered, but not in the cecum homogenate from mice not administered bacteria.
  • a six-histidine tag (HisTag) was added to the C-terminus of CsgA to allow for immunodetection (pBbB8k-WT).
  • a control plasmid was constructed by cloning the malE gene encoding for the maltose binding protein (MBP) from the W3110 genome into the pBbB8k plasmid under the control of the araBp promoter (pBbB8k-MBP).
  • a mutation encoding for the amber stop codon was inserted within the open-reading frame of CsgA (pBbB8k-Mut) or MBP (pBbB8k-MBPMut) using site-directed mutagenesis.
  • the pEVOL-pAzF plasmid was used as orthogonal translation system (OTS).
  • E. coli strain derived from E. coli Nissle 1917 (ECN).
  • PBP8 strain was constructed using the lambda red recombineering method as previously described (see Datsenko and Wanner (2000) Proc. Nat'l. Acad. Set USA 97(12): 6640-5). Briefly, the chloramphenicol acetyltransferase (CAT) cassette was constructed with 500 bp homology arms upstream and downstream of the curli operon using SOEing PCR. The CAT cassette was transformed into electrocompetent EcN with pre-induced lambda red genes from pKD46 plasmid using 0.5% arabinose during the growth step of electrocompetent cell preparation.
  • CAT chloramphenicol acetyltransferase
  • Transformants were expanded using SOC media at 30°C shaking incubator for 3 hours to promote the genomic replacement of the curli operon with the CAT cassette. Transformants were then plated onto LB agar plates containing 25 ⁇ g/mL chloramphenicol and incubated overnight at 37 °C. Colonies that were resistant to chloramphenicol were selected and verified for knockout of the curli operon by colony PCR and genomic DNA sequencing as compared to wild-type EcN.
  • PBP8 cells transformed with a pBbB8k plasmid were streaked onto lysogeny broth (LB) agar plates containing 50 ⁇ g/mL kanamycin.
  • PBP8 cells transformed both with a pBbB8k plasmid and with the OTS plasmid were streaked onto Luria Broth (LB) agar plates containing both 50 ⁇ g/mL kanamycin and 50 ⁇ g/mL spectinomycin. Colonies were picked from the plates and 5 mL cultures were inoculated (in LB containing the appropriate antibiotics). Cultures were grown overnight at 37°C.
  • the overnight cultures were diluted 100-fold in fresh LB medium containing the appropriate antibiotics, and cultured at 37°C until they reached an optical density (OD) at 600 nm of 0.6 to 0.8.
  • Arabinose was added to the bacterial cultures at a final concentration of 0.05 % to induce protein expression.
  • the NSAA 4-azido-L-phenylalanine (pAzF) was also added to the cultures to a final concentration ranging between 1 mM and 5 mM. Higher concentrations of NSAA affected cell growth. Protein expression was allowed to occur at 37°C overnight.
  • Bacterial cells were grown in LB overnight, diluted 1: 100 in fresh LB, and grown in 1 mL-well 96 wells plate at 37 °C and shaken at 900 rpm. Once the culture reached an optical density (OD) of 0.6, measured at 600 nm (optimal for protein expression), the cultures were again diluted 1: 100 in fresh LB in a 250 mL 96 well plate. Half of each cell culture was induced with 0.05% arabinose and incubated with 5 mM NSAA. The other half of the cell culture was used as negative control and were not induced with arabinose nor exposed to NSAA. Bacterial cells expressing either the curli operon, or MBP as control, were used.
  • Samples were dried in a critical point dryer, placed onto SEM sample holders using silver adhesive (Electron Microscopy Sciences), and sputtered until they were coated in a 5 nm layer of Pt/Pd. Imaging was performed using a Zeiss Ultra 55 Field Emission SEM.
  • This wash step was repeated 3 times to remove any unbound dye. Labeling was assessed by spotting 10 ⁇ of labeled cells at OD 1 on a nitrocellulose membrane and detecting the fluorescence of Cy5 using a FluorChemTM M system (Protein Simple). Flow cytometry was used to determine the fraction of cells that were labeled.
  • 33342 (THERMO SCIENTIFIC) in PBS for 1 hour and rinsed 3 times using 1 mL of PBS. Subsequently, the bacterial cells were fixed in 2% paraformaldehyde for 10 minutes at 25 °C and washed 3 times with 1 mL of PBS. 10 ⁇ of cells were deposited on a glass slide for imaging using a Leica SP5 X MP Inverted Confocal Microscope (Leica Microsystems).
  • Pre-labeled bacterial cells were pelleted at 4,000 x g for 20 min, and resuspended in lysis buffer (50 mM phosphate buffer, 100 mM NaCl, 7 M guanidinium hydrochloride). A protease inhibitor cocktail was added, and the suspension was stored at - 20 °C overnight. The suspension was thawed on ice, and sonicated to fully lyse the cells (40% amplitude, 3 x 25 seconds ON, 35 seconds OFF). After centrifugation at 10,000 x g for 30 minutes, the supernatant was applied to a NiNTA column and incubated 2 hours with agitation at room temperature in the presence of 10 mM imidazole.
  • lysis buffer 50 mM phosphate buffer, 100 mM NaCl, 7 M guanidinium hydrochloride.
  • a protease inhibitor cocktail was added, and the suspension was stored at - 20 °C overnight. The suspension was thawed
  • His-tag purification was performed by washing the column 3 times with 40 mM imidazole, and eluting His-tagged CsgA proteins with 500 mM imidazole (both in 50 mM phosphate buffer with 100 mM NaCl). Eluates were concentrated using 3 kDa Amicon ultracentrifugal filters and analyzed by SDS-PAGE using a 4-20% polyacrylamide gel. Prior to staining with Coomassie Blue, Cy5 fluorescence within the SDS-PAGE gel was also detected. Mass spectrometry analysis was used to confirm the presence of CsgA in the Cy5-labeled bands.
  • mice Prior to the experiments, mice were given a non- fluorescent food (alfalfa- free) for at least 5 days to minimize background autofluorescence. At six hours prior to oral gavage with bacteria, mice were fasted and given water containing antibiotics (1 g/L kanamycin (RPI), 1 g/L spectinomycin (RPI)), inducer (10 g/L L-(+)-Arabinose (Sigma)) and NSAA (5 mM) based on their assigned experimental conditions.
  • antibiotics (1 g/L kanamycin (RPI), 1 g/L spectinomycin (RPI)
  • inducer (10 g/L L-(+)-Arabinose (Sigma)
  • NSAA 5 mM
  • the starting culture of PBP8 transformed with pBbB8k-WT was expanded 1: 100 dilution in LB containing 50 ⁇ g/mL kanamycin, while that of PBP8 transformed with pBbB8k-Mut and pEVOL-pAzF was expanded 1: 100 dilution in LB containing 50 ⁇ g/mL kanamycin and spectinomycin to OD of 0.5.
  • Log-phase cultures were centrifuged at 4,000 x g for 15 minutes at 4°C and resuspended in 20% sucrose (OmniPur) in PBS to an OD of 10. Once the mice were fasted for six hours, 100 ⁇ ⁇ of the prepared log-phase bacteria were administered to the mice via oral gavage.
  • mice The alfalfa- free food and water were administered again to the mice to allow for proliferation and protein induction of the engineered bacteria in vivo. Meanwhile, the abdominal hair of the mice was removed to allow for imaging. 40 hours after gavage with the bacteria, pAzF and arabinose-containing water was switched for antibiotic-only- containing water, and the food was briefly remove to prepare the mice for dye administration.
  • IVIS Lumina II PerkinElmer
  • mice experiments were performed in the same manner as the in vivo tracking experiment described above, except that 36 hours after administration of the Cy5- DBCO dye.
  • the mice were euthanized to harvest the whole gastrointestinal (GI) tract for ex vivo fluorescence imaging.
  • the GI tract was placed on the lid of 150x25 mm polystyrene tissue culture plate (Falcon) and imaged using IVIS Lumina II with the same setting as the in vivo imaging. After imaging, the GI tract was kept at -20°C for protein extraction.
  • the GI tract specimens used in the ex vivo fluorescence imaging were further analyzed for curli and Cy5-DBCO interaction.
  • the mouse GI tracts were removed from - 20°C.
  • the cecum from each sample was excised, transferred to a 15-ml falcon tube, and crushed to homogenize.
  • 3 mL of PBS was added to each sample, supplemented with 4 of benzonase nuclease (NOVAGEN) and 8 of 1 M magnesium sulfate (MgS0 4 ) (SIGMA).
  • NOVAGEN benzonase nuclease
  • SIGMA 1 M magnesium sulfate
  • Coomassie Brilliant Blue to detect the presence of proteins and compared the size against standard protein ladder (Bio-Rad).
  • fecal pellets were collected from each mouse in a sterile manner at 24-hour time point after dye administration.
  • the pellets were homogenized using bead mill homogenizer TissueLyser LT (Qiagen) and 5-mm stainless steel beads (Qiagen) with the frequency of 30 Hz for 2 minutes.
  • the fecal homogenates were centrifuged briefly at 1,000 rpm for 1 minute to loosely pellet the large particulates. The supernatant was serially diluted and plated on appropriate antibiotic- selection plates. The colonies were grown, induced, and undergone similar in vitro labeling experiment and analysis mentioned previously.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Public Health (AREA)
  • Physics & Mathematics (AREA)
  • Mycology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Toxicology (AREA)
  • Analytical Chemistry (AREA)
  • Plant Pathology (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

L'invention concerne des bactéries modifiées qui expriment une protéine comportant un acide aminé non standard, des compositions pharmaceutiques comprenant les bactéries, des biofilms comprenant une protéine comportant un acide aminé non standard, et des procédés d'utilisation des bactéries à des fins diagnostiques et thérapeutiques.
PCT/US2017/045869 2016-08-08 2017-08-08 Bactéries modifiées pour imagerie non invasive et applications thérapeutiques WO2018031531A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662372148P 2016-08-08 2016-08-08
US62/372,148 2016-08-08

Publications (2)

Publication Number Publication Date
WO2018031531A1 true WO2018031531A1 (fr) 2018-02-15
WO2018031531A4 WO2018031531A4 (fr) 2018-04-05

Family

ID=61162476

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/045869 WO2018031531A1 (fr) 2016-08-08 2017-08-08 Bactéries modifiées pour imagerie non invasive et applications thérapeutiques

Country Status (1)

Country Link
WO (1) WO2018031531A1 (fr)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020041723A1 (fr) * 2018-08-24 2020-02-27 Talis Biomedical Corporation Capture de cellules vivantes
WO2021137937A3 (fr) * 2019-11-05 2021-09-30 The Trustees Of Columbia University In The City Of New York Bactéries modifiées contenant des biocapteurs pour le confinement et le ciblage de précision
CN114053430A (zh) * 2020-07-29 2022-02-18 深圳先进技术研究院 一种负载纳米载药颗粒的细菌及其制备方法和应用
US11661600B2 (en) 2017-11-02 2023-05-30 University Of Iowa Research Foundation Methods of rescuing stop codons via genetic reassignment with ACE-tRNA
US11891662B2 (en) 2019-12-02 2024-02-06 Talis Biomedical Corporation Polynucleotides for amplification and detection of human beta actin

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090081669A1 (en) * 2006-02-01 2009-03-26 Encode Bio, Inc. Fluorescent Assays Using Orthogonal tRNA - Aminoacyl Synthetase Pairs
US20130244245A1 (en) * 2004-10-27 2013-09-19 The Scripps Research Institute Orthogonal Translation Components for the in Vivo Incorporation of Unnatural Amino Acids
US20130323821A1 (en) * 2008-09-26 2013-12-05 Ambrx, Inc. Non-Natural Amino Acid Replication-Dependent Microorganisms and Vaccines

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130244245A1 (en) * 2004-10-27 2013-09-19 The Scripps Research Institute Orthogonal Translation Components for the in Vivo Incorporation of Unnatural Amino Acids
US20090081669A1 (en) * 2006-02-01 2009-03-26 Encode Bio, Inc. Fluorescent Assays Using Orthogonal tRNA - Aminoacyl Synthetase Pairs
US20130323821A1 (en) * 2008-09-26 2013-12-05 Ambrx, Inc. Non-Natural Amino Acid Replication-Dependent Microorganisms and Vaccines

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11661600B2 (en) 2017-11-02 2023-05-30 University Of Iowa Research Foundation Methods of rescuing stop codons via genetic reassignment with ACE-tRNA
WO2020041723A1 (fr) * 2018-08-24 2020-02-27 Talis Biomedical Corporation Capture de cellules vivantes
WO2021137937A3 (fr) * 2019-11-05 2021-09-30 The Trustees Of Columbia University In The City Of New York Bactéries modifiées contenant des biocapteurs pour le confinement et le ciblage de précision
US11891662B2 (en) 2019-12-02 2024-02-06 Talis Biomedical Corporation Polynucleotides for amplification and detection of human beta actin
CN114053430A (zh) * 2020-07-29 2022-02-18 深圳先进技术研究院 一种负载纳米载药颗粒的细菌及其制备方法和应用

Also Published As

Publication number Publication date
WO2018031531A4 (fr) 2018-04-05

Similar Documents

Publication Publication Date Title
WO2018031531A1 (fr) Bactéries modifiées pour imagerie non invasive et applications thérapeutiques
KR20170121291A (ko) 감소된 창자 염증 및/또는 강화된 창자 점막 장벽으로부터 이익을 얻는 질병을 치료하기 위해 공학처리된 박테리아
US11850268B2 (en) Engineered bacteria secreting therapeutic proteins and methods of use thereof
US11618894B2 (en) Bacteria engineered to reduce hyperphenylalaninemia
US20200248190A1 (en) Biosynthetic amyloid-based materials displaying functional protein sequences
JP2023026681A (ja) 免疫調節ミニ細胞および使用方法
JP2008519002A (ja) 細菌ベクター
JP2009525727A (ja) 操作された抗体−ストレスタンパク質融合体
EP2436756B1 (fr) Bactéries ciblant de manière sélective des tissus lésés par infarctus et leur utilisation
AU2024201593A1 (en) A genetically modified Lactobacillus and uses thereof
EP2873726B1 (fr) Agent antitumoral, marqueur de détection de tumeur, et agent vaccinal à usage oral
An et al. Colorectal cancer therapy using a Pediococcus pentosaceus SL4 drug delivery system secreting lactic acid bacteria-derived protein p8
EP3328988A1 (fr) Bactéries modifiées pour traiter les troubles impliquant le catabolisme du propionate
CA2801729A1 (fr) Compositions et procedes d'activation de la guanylyl cyclase c
EP4019539A1 (fr) Bactérie recombinante et ses utilisations
US20230293603A1 (en) Recombinant bacteria for production of d-lactate and/or l-lactate and uses thereof
KR20170059729A (ko) 리피바디-단백질 독소 복합체, 그 제조방법 및 용도
JP2023511282A (ja) シュウ酸塩が有害となる障害を治療するための遺伝子改変細菌
US20230172997A1 (en) Recombinant bacteria for production of indole-3-acetic acid (iaa) and uses thereof
EP3612552A1 (fr) Peptides, en particulier polypeptides, procédé de criblage d'exposition sur phages, moyens associés et leurs utilisations pour des applications de recherche et biomédicales
KR102327091B1 (ko) 암의 치료용 살모넬라 균주 및 이의 용도
WO2024064888A2 (fr) Microorganismes modifiés présentant une expression et une sécrétion de protéines améliorées
WO2021233244A1 (fr) Conjugués à base de sous-unités à chaîne lourde de ferritine et leur application
US20230174926A1 (en) Bacteria engineered to treat disorders involving the catabolism of leucine
WO2023225667A2 (fr) Bactéries recombinantes pour la production d'acide indole-3-acétique (aia) et leurs utilisations

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17840136

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17840136

Country of ref document: EP

Kind code of ref document: A1