WO2018023093A1 - Immunomodulatory polypeptides and related compositions and methods - Google Patents
Immunomodulatory polypeptides and related compositions and methods Download PDFInfo
- Publication number
- WO2018023093A1 WO2018023093A1 PCT/US2017/044549 US2017044549W WO2018023093A1 WO 2018023093 A1 WO2018023093 A1 WO 2018023093A1 US 2017044549 W US2017044549 W US 2017044549W WO 2018023093 A1 WO2018023093 A1 WO 2018023093A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- immunomodulatory polypeptide
- peptide
- cells
- cell
- polynucleotide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/521—Chemokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/53—Colony-stimulating factor [CSF]
- C07K14/535—Granulocyte CSF; Granulocyte-macrophage CSF
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/57554—Prolactin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/61—Growth hormone [GH], i.e. somatotropin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
Definitions
- the present disclosure relates in some aspects to immunomodulatory polypeptides containing a first and second peptide, such as a first and second subunit of a cytokine or a chemokine, connected by a joining region containing a targeting moiety that binds to a target molecule.
- the disclosure further relates to engineered cells and compositions comprising the immunomodulatory polypeptides and methods for their administration to subjects.
- the cells engineered to contain the immunomodulatory polypeptide, such as T cells further contain a genetically engineered recombinant receptor that specifically binds to antigens, such as a chimeric antigen receptor (CAR).
- CAR chimeric antigen receptor
- features of the polypeptides, engineered cells, and methods provide for improved treatment of diseases or conditions, e.g., cancer, such as by reducing adverse effects of cytokine or chemokine therapy or increasing the activity, efficacy and/or persistence of cell therapy.
- compositions, cells, and methods that meet such needs.
- an immunomodulatory polypeptide containing a first peptide; a second peptide; and a joining region connecting the first and second peptides, wherein the joining region contains a targeting moiety that binds to a target molecule.
- At least one of the first and second peptide is a cytokine or chemokine, a subunit a cytokine or chemokine or is a functional portion of the cytokine or chemokine.
- the first peptide is a cytokine or chemokine, a subunit of a cytokine or chemokine, or is a functional portion of the cytokine or chemokine.
- the second peptide is a cytokine or chemokine, a subunit of a cytokine or chemokine, or is a functional portion of the cytokine or chemokine.
- both the first and second peptide are independently a cytokine or chemokine, a subunit of a cytokine or chemokine or a functional portion of the cytokine or chemokine.
- the first or second peptide is a tag or label.
- an immunomodulatory polypeptide containing a first peptide containing a first subunit of a cytokine or chemokine or a functional portion thereof; a second peptide containing a second subunit of the cytokine or chemokine or a functional portion thereof; and a joining region connecting the first and second peptides, wherein the joining region contains a targeting moiety that binds to a target molecule.
- the cytokine or chemokine is a homodimer or heterodimer.
- the joining region further contains at least one polypeptide linker linking the targeting moiety to the first or second peptide.
- the cytokine or chemokine or subunit or functional portion thereof is selected from the group consisting of IL-12, IL-15, IL-2, IL-18, GM-CSF, IL-7, IL-21, IFNa, IFNp, IFNy, IL-17, IL-23, IL-3, IL-4, IL-5, IL-6, IL-9, IL-11, IL- 13, IL-27, Erythropoietin, G-CSF, Growth hormone, Prolactin, Oncostatin M, and Leukemia inhibitory factor or a subunit or functional portion thereof.
- the first or second peptide independently contains a subunit of a cytokine or chemokine selected from IL-12, IL-23, IL-27 and IL-35 or a functional portion thereof.
- the first or second peptide is independently a subunit of IL-12 or a functional portion thereof.
- the first peptide contains an IL-12 p35 subunit or an IL-12 p40 subunit or a functional portion thereof and the second peptide contains the other of the IL-12 p35 subunit and the IL-12 p40 subunit or a functional portion thereof.
- an immunomodulatory polypeptide containing a first peptide containing a p35 subunit of IL-12 or a functional portion thereof; a second peptide containing a p40 subunit of IL-12 or a functional portion thereof; and a joining region connecting the first and second peptides, wherein the joining region contains a targeting moiety that binds to a target molecule.
- the p35 subunit contains the sequence of amino acids set forth in SEQ ID NO: 10 or a sequence that has at least 95% sequence identity thereto and/or the p40 subunit contains the sequence of amino acids set forth in SEQ ID NO: 11 or a sequence that has at least 95% sequence identity thereto.
- the joining region further contains at least one polypeptide linker linking the targeting moiety to the p35 subunit or the p40 subunit.
- the polypeptide linker contains from about 2 to about 20 amino acids.
- the polypeptide linker contains the sequence GGGGS(n), wherein n is 1-5 (SEQ ID NO:29).
- the polypeptide linker contains the sequence set forth in any of SEQ ID NOs: 7-9.
- the target molecule is associated with a tumor or present on a tumor.
- the target molecule is a tumor antigen.
- the target molecule is selected from the group consisting of: hepatocyte growth factor (HGF), heparin, VEGF, VEGF-A, VEGFR2, VEGFR3, HER2, PD-1, tenascin-C, CTLA-4, LAG3, PD-L1, EGFR, EPCAM, RANKL, NG2 proteoglycan, CD20, CD52, CD19, CD3, CD30, IL-6, CD38, SLAMF7, GD2, CD13, CD274, CD279, CD40L, and CD47.
- HGF hepatocyte growth factor
- the targeting moiety contains from about 3 to about 300 amino acids, about 3 to about 100 amino acids, about 3 to about 20 amino acids, about 6 to about 20 amino acids, or about 10 amino acids.
- the targeting moiety exhibits a k 0ff rate for binding the target molecule that is about 0.5xl0 -4 sec -1 or less, about lxlO -4 sec -1 or less, about 2xl0 -4 sec -1 or less, about 3x1 ⁇ -4 sec -1 or less, about 4xl0 -4 sec -1 or less, about 5x1 ⁇ -4 sec -1 or less, about lxlO -3 sec -1 or less, about 1.5xl0 -3 sec -1 or
- the dissociation constant (K D ) of the targeting moiety to the target molecule is at or about or less than at or about 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 nM, such as between at or about 1 nM and at or about 15 nM, e.g., between at or about 5 and at or about 10 nM.
- the targeting moiety is or contains an antibody or antibody fragment.
- the antibody fragment is a single chain fragment.
- the antibody fragment is a single domain antibody containing the variable heavy chain region.
- the antibody fragment contains antibody variable regions joined by a flexible linker.
- the antibody fragment contains an scFv.
- the targeting moiety contains a variable heavy (VH) chain and/or variable light (VL) chain of an antibody selected from the group consisting of: trastuzumab, pertuzumab, ramucirumab, atezolizumab, bevacizumab, panitumumab, cetuximab, necitumumab, denosumab, nivolumab, pembrolizumab, rituximab, ofatumumab, obinutuzumab, alemtuzumab, blinatumomab, brentuximab vedotin, siltuximab, ipilimumab, daratumumab, elotuzumab, dinutuximab, catumaxomab.
- VH variable heavy
- VL variable light chain of an antibody selected from the group consisting of: trastuzumab, pertuzumab, ramucirum
- the targeting moiety contains a V H chain and/or V L chain of an anti-EPCAM antibody. In some of any such embodiments, the targeting moiety contains the sequence set forth in SEQ ID NO: 17, 24 or 25, or a sequence that has at least 95% sequence identity to SEQ ID NO: 17, 24 or 25 and binds to the target molecule.
- the targeting moiety is or contains a peptide binding motif. In some of any such embodiments, the targeting moiety is a heparin binding peptide. In some aspects, the heparin binding peptide (HBP) is derived from fibronectin or BMP4, and/or is of bovine origin.
- HBP heparin binding peptide
- the targeting moiety is selected from the group consisting of a hepatocyte growth factor (HGF) binding peptide, a VEGF binding peptide, a VEGF-A binding peptide, a VEGFR2 binding peptide, an EPCAM binding peptide, a HER2 binding peptide, a PD- 1 binding peptide, a tenascin-C binding peptide, a CTLA-4 binding peptide, a LAG3 binding peptide, a PD-Ll binding peptide, a EGFR binding peptide, a RANKL binding peptide, a CD20 binding peptide, a CD52 binding peptide, a CD 19 binding peptide, a CD3 binding peptide, a CD30 binding peptide, a IL-6 binding peptide, a CD38 binding peptide, a SLAMF7 binding peptide, a GD2 binding peptide
- HGF hepatocyte growth factor
- the targeting moiety contains a HGF binding peptide or an EGFR binding peptide (EGFRBP).
- EGFRBP EGFR binding peptide
- the targeting moiety contains the sequence set forth in any of SEQ ID NOs: 13, 14, 15, 16, 26, 27 or 28, or a sequence that has at least 95% sequence identity to such a sequence and binds to the target molecule.
- the immunomodulatory polypeptide contains the sequence set forth in any of SEQ ID NOs: 1-5, or a sequence that has at least 95% sequence identity to such a sequence.
- immunomodulatory polypeptide exhibits increased activity to stimulate via the IL-12R compared to a recombinant IL-12 not containing the joining region.
- the immunomodulatory polypeptide exhibits increased binding to a target cell expressing the target molecule as compared with its binding to a cell not expressing the target molecule.
- the increased activity and/or binding is/are by greater than 1.2-fold, greater than 1.5-fold, greater than 2.0- fold, greater than 3.0-fold, greater than 4.0-fold, greater than 5.0-fold or greater than 10.0-fold.
- the increased activity and/or binding is greater than that exhibited by a reference immunomodulatory polypeptide containing a polypeptide linker between subunits but not containing the targeting moiety.
- the polynucleotide encoding the immunomodulatory polypeptide according to any one of the embodiments described above.
- the polynucleotide further contains a signal sequence.
- the signal sequence encodes a signal peptide derived from CD33.
- the signal peptide contains the sequence set forth in SEQ ID NO: 18, or a sequence that has at least 95% sequence identity to such a sequence.
- the polynucleotide further contains at least one promoter that is operatively linked to control expression of the immunomodulatory polypeptide.
- the expression of the immunomodulatory polypeptide is inducible or conditional.
- the polynucleotide further contains a conditional promoter, enhancer, or transactivator.
- the conditional promoter, enhancer, or transactivator is an inducible promoter, enhancer, or transactivator or a repressible promoter, enhancer, or transactivator.
- the promoter, enhancer or transactivator is a T cell activation factor.
- the promoter, enhancer or transactivator contains a binding site for one or more T cell transcription factor(s).
- the promoter, enhancer or transactivator contains a binding site for nuclear factor of activated T-cells (NFAT), C/EBP, STAT1, STAT2, and/or NFKB.
- activation of the promoter, enhancer, or transactivator is a conditional, optionally an inducible promoter, enhancer, or transactivator or a repressible promoter, enhance or transactivator.
- the promoter, enhancer or transactivator is active in the presence of one or more conditions present in the tumor microenvironment.
- the one or more conditions present in the tumor microenvironment can be selected from hypoxia, low glucose, acidic pH and/or oxidative stress.
- the one or more conditions present in the tumor are selected from the one or more conditions present in the tumor.
- the microenvironment is hypoxia.
- the polynucleotide is operatively linked to a promoter, and the promoter is a HIF-1 -alpha-responsive promoter.
- the polynucleotide is operatively linked to a promoter, and the promoter contains one or more hypoxia response element(s).
- An exemplary hypoxia response element contains the sequence 5'-(A/G)CGT(G/C)(G/C)-3'.
- the promoter can be an erythropoietin (Epo), VEGF-A, phosphoglycerate kinase 1 (PGK1), lactate dehydrogenase A (LDH A), aldolase A (ALDA) or glyceraldehyde 3-phosphate dehydrogenase (GAPDH) promoter.
- Epo erythropoietin
- VEGF-A VEGF-A
- PGK1 phosphoglycerate kinase 1
- LDH A lactate dehydrogenase A
- ALDA aldolase A
- GPDH glyceraldehyde 3-phosphate dehydrogenase
- the one or more conditions present in the tumor are selected from the one or more conditions present in the tumor.
- the micorenvironment is low glucose.
- the polynucleotide is operatively linked to a promoter that is a GRP78 or hexokinase II promoter.
- the promoter, enhancer, or transactivator is inducible by radiation, heat or in the presence of a drug.
- the promoter is a radiation-inducible promoter.
- exemplary radiation-inducible promoters can contain a CArG element or a CC(A+T rich) 6 GG motif.
- the radiation-inducible promoter is an EGR-1, Waf-1, RecA, or cIAP2 promoter or is a synthetic promoter, such as a promoter with a sequence set forth in SEQ ID NOs 92-95.
- the promoter, enhancer or transactivator is a heat-inducible promoter, enhancer or transactivator.
- the heat-inducible promoter, enhancer, or transactivator contains a heat shock element (HSE).
- HSE heat shock element
- the heat-inducible promoter, enhancer, or transactivator is a heat shock promoter (HSP), such as an HSP70B promoter or a Gadd 153 promoter.
- the promoter, enhancer, or transactivator is a drug-inducible promoter, enhancer, or transactivator.
- the inducible promoter, enhancer, or transactivator contains a Lac operator sequence, a tetracycline operator sequence, a galactose operator sequence, a doxycycline operator sequence, a rapamycin operator sequence, a tamoxifen operator sequence, or a hormone-responsive operator sequence, or an analog thereof.
- the inducible promoter contains a tetracycline response element (TRE).
- the drug-inducible promoter, enhancer, or transactivator contains a multidrug resistance (mdrl) gene promoter.
- the polynucleotide contains a single nucleic acid sequence. In some of any such embodiments, the polynucleotide contains a first nucleic acid sequence encoding the immunomodulatory polypeptide and a second nucleic acid sequence encoding a recombinant receptor. In some aspects, the recombinant receptor is or contains a chimeric antigen receptor (CAR). In some embodiments, the polynucleotide further contains at least one promoter that is operatively linked to control expression of the immunomodulatory polypeptide and/or the recombinant receptor.
- CAR chimeric antigen receptor
- the polynucleotide further contains an internal ribosome entry site (IRES) between the first and second nucleic acid sequences to yield translation products of the first and second nucleic acid sequences after translation.
- the polynucleotide contains a nucleic acid sequence encoding a linking peptide between the first and second nucleic acid sequences, wherein the linking peptide separates the translation products of the first and second nucleic acid sequences during or after translation.
- the linking peptide contains a self-cleaving peptide, or a peptide that causes ribosome skipping, optionally a T2A peptide.
- any of the embodied polynucleotides can be optimized to remove CpG motifs and/or codon-optimized.
- the polynucleotide is human codon-optimized.
- the engineered cell secretes the
- the engineered cell further contains a recombinant receptor.
- the recombinant receptor binds to a target antigen that is associated with a disease or disorder.
- the disease or disorder is an infectious disease or disorder, an autoimmune disease, an inflammatory disease, or a tumor or a cancer.
- the target antigen is a tumor antigen.
- the target antigen is selected from the group consisting of RORl, Her2, Ll-CAM, CD19, CD20, CD22, mesothelin, CEA, hepatitis B surface antigen, anti-folate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, EPHa2, ErbB2, ErbB3, ErbB4, FBP, fetal acetylcholine e receptor, GD2, GD3, HMW-MAA, IL-22R-alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, Ll-cell adhesion molecule, MAGE-A1, mesothelin, MUC1, MUC16, PSCA, NKG2D Ligands, NY-ESO-1, MART-1, gplOO, oncofetal antigen, TAG72, VEGF-R2, carcinoembra light chain, gplOO, on
- the recombinant receptor is a functional non-TCR antigen receptor or a transgenic TCR.
- the recombinant receptor is a chimeric antigen receptor (CAR).
- the recombinant receptor contains an extracellular portion containing an antigen-binding domain.
- the antigen -binding domain is or contains an antibody or an antibody fragment.
- the antibody fragment is a single chain fragment.
- the fragment contains antibody variable regions joined by a flexible linker.
- the fragment contains an scFv.
- the recombinant receptor contains an intracellular signaling region.
- the intracellular signaling region is capable of inducing a primary activation signal in a T cell, is a T cell receptor (TCR) component, and/or contains an immunoreceptor tyrosine -based activation motif (IT AM).
- TCR T cell receptor
- IT AM immunoreceptor tyrosine -based activation motif
- the intracellular signaling region is or contains an intracellular signaling domain of a CD3-zeta ( ⁇ ⁇ 3 ⁇ ) chain or a signaling portion thereof.
- the engineered cell further contains a
- the intracellular region contains an intracellular signaling domain.
- the recombinant receptor further contains a costimulatory signaling domain.
- the costimulatory signaling domain contains an intracellular signaling domain of a T cell costimulatory molecule or a signaling portion thereof.
- the costimulatory signaling domain contains an intracellular signaling domain of CD28, 4- IBB or ICOS or a signaling portion thereof.
- the costimulatory signaling domain is between the transmembrane domain and the intracellular signaling region.
- the engineered cell is a T cell. In some of any such embodiments, the engineered cell is a CD8+ T cell or a CD4+ T cell.
- the engineered cell exhibits increased persistence and/or survival compared to cells not engineered or compared to cells containing a recombinant receptor but not the immunomodulatory polypeptide. In some of any such embodiments, the engineered cell exhibits increased activity to stimulate via the IL-12R compared to a
- the reference IL-12 does not contain a joining region or contains a joining region that consists of any of the sequences set forth in SEQ ID NOs 7-9.
- the engineered cell secretes an
- the engineered cell effects increased killing of a target cell expressing the target molecule compared to killing of cells not expressing the target molecule.
- the increased persistence, activity, binding, and/or killing is greater than effected by a reference engineered cell expressing or secreting an
- immunomodulatory polypeptide containing a polypeptide linker between subunits but not containing the targeting moiety.
- compositions containing the immunomodulatory polypeptide according to any one of the embodiments described above are provided herein.
- a composition containing the engineered cell according to any one of the embodiments described above is provided herein.
- the composition further contains a pharmaceutically acceptable excipient.
- the immunomodulatory polypeptide specifically binds to a target molecule expressed by a cell associated with the disease or disorder.
- the engineered cell expresses a recombinant receptor that specifically binds to an antigen associated with the disease or condition.
- the disease or disorder is a cancer, a tumor, an autoimmune disease or disorder, or an infectious disease.
- FIG. 1 depicts interferon gamma (IFN- ⁇ ) secretion in PHA blasts following stimulation with recombinant human IL-12 (rHuIL-12), a scIL-12 or immunomodulatory polypeptides containing either a HBP targeting moiety (IL-12 HBP) or an EGFR targeting moiety (IL-12 EGFR).
- rHuIL-12 recombinant human IL-12
- scIL-12 scIL-12
- FIG. 2 depicts the fold change in total number of cells following stimulation of cells with the tested IL-12 immunomodulatory protein at various effector target cell ratios.
- FIG. 4 depicts the binding affinities of IL-12 immunomodulatory proteins as assessed by surface plasmon resonance.
- the cytokine is IL-12 and the immunomodulatory polypeptide contains a p35 and p40 subunit of IL- 12 linked by a joining region containing a targeting moiety that binds to a target molecule.
- the target molecule is a molecule overexpressed in or specific to a diseased environment, such as a tumor microenvironment, such as on a cell present in a diseased or tumor microenvironment. Also provided are compositions and engineered cells containing the immunomodulatory polypeptides and methods of administering such compositions and cells.
- the immunomodulatory polypeptides provided herein specifically bind to a target molecule expressed by a cell associated with the disease or condition.
- the immunomodulatory polypeptide is targeted to tissues and cells that express known target molecules, e.g., tumor cells.
- targeting of the immunomodulatory polypeptide to cells containing the target molecule is associated with less unwanted, or more desired, outcomes as compared to treatment with the peptides, such as cytokines or chemokines, e.g., recombinant human cytokines or chemokines, not containing a linker or targeting moiety.
- the provided embodiments exhibit comparable safety, and improved efficacy, as compared to a reference treatment regime or composition, such as compared to cell- based or local delivery-based administration of the cytokine or a related or unmodified version thereof, generally designed for tumor-localization of the cytokine.
- the provided embodiments include systemic administration, with increased safety profile as compared to systemic administration of native or unmodified version of the cytokine molecule.
- IL-12 serves as a co-stimulus for maximum secretion of IFN- ⁇ by differentiated Thl cells responding to a specific antigen.
- IL-12 in some contexts, stimulates the development of IFN- ⁇ producing Thl cells from populations of resting memory T cells interacting with an antigen to which they have been previously exposed.
- IL-12 can promote or mediate immune effector functions to enhance anti-tumor immune responses, including in connection with administration of cells in adoptive cell therapy.
- IL-12 IL-12
- engineered T cells such as those expressing chimeric antigen receptors, also expressing recombinant or exogenous IL-12, e.g., a single-chain heterodimeric format, that is secreted, have been reported with encouraging results (Pegram et al. (2012) Blood, 119:4133-4141).
- subjects when administered with a provided
- immunomodulatory polypeptide containing a targeting moiety or cells expressing or secreting such immunomodulatory polypeptide do not or do not, on average of the subjects administered, exhibit severe toxicity or an IL-12 associated toxicity that is grade 3 or higher.
- the subjects compared to other methods, the subjects exhibit the same or reduced toxicity or lack thereof and increased efficacy, such as an increase in the immunomodulatory effects of the IL-12 as provided herein.
- the structure of the immunomodulatory polypeptide is such that when the targeting moiety binds the target molecule, e.g., on the surface of a target cell, the first and second peptides (e.g. subunits of the cytokine or chemokine) are oriented away from the target cell.
- the subunits of the cytokine or chemokine are oriented towards an adjacent non-target cell, such as an immune cell.
- such an orientation may discourage the cytokine or chemokine from binding to its receptor on the target cells.
- such an orientation may promote binding of the cytokine or chemokine to its receptor on immune cells, e.g., T cells.
- such an orientation may effect enhanced T cell stimulation as compared with other immunomodulatory polypeptides not designed to be oriented away from the target cell or designed to be oriented toward the target cell.
- the structure, e.g., order and size of components, of the joining region is designed to promote binding of the targeting moiety to a target cell while promoting binding of the first and second peptides, e.g. first and second cytokines or subunits of cytokines, toward an adjacent non-target cell, e.g. such that the subunits are oriented away from the target cell.
- the targeting moiety is connected to one or both of peptides, such as one or both of the subunits.
- the targeting moiety is configured between the first and second peptide, such as the first and second subunit of a cytokine or chemokine (e.g. IL-12).
- the targeting moiety is connected directly or indirectly, such as via one or more linker(s).
- the joining region further contains at least one polypeptide linker linking the targeting moiety to the first or second peptides, such as first or second subunit of a cytokine or chemokine. In some cases, the joining region contains two or more polypeptide linkers.
- the first peptide (e.g. first subunit) is attached to a first polypeptide linker, the first polypeptide linker is attached to a first end of the targeting moiety, and a second polypeptide linker is attached to the second end of the targeting moiety and the second peptide (e.g. second subunit).
- the targeting moiety is flanked between two or more polypeptide linkers that attach it to one or both of the peptides (e.g. subunits of a cytokine or chemokine).
- the length of the joining region is between or between about 200 and 400 amino acids, between or between about 100 and 200 amino acids, or between or between about 5 and 50 amino acids, such as between or between about 10 and 50 amino acids, 10 and 40 amino acids, 10 and 30 amino acids, 10 and 20 amino acids, 20 and 50 amino acids, 20 and 40 amino acids, 20 and 30 amino acids, 30 and 50 amino acids or 30 and 40 amino acids.
- the nucleic acid molecule encoding the immunomodulatory polypeptide is operably linked to a promoter, such as an inducible, conditional, or activation- induced promoter or enhancer.
- a promoter such as an inducible, conditional, or activation- induced promoter or enhancer.
- the promoter or enhancer controls expression of the immunomodulatory polypeptide.
- immunomodulatory polypeptide is expressed essentially only when the promoter or enhancer is active.
- a conditional promoter may be activated by coadministration of a molecule or compound or may be downregulated following coadministration with a molecule or compound.
- the T cell activation factor can be a regulatory element, such as a promoter, enhancer or response element or elements, that contains a binding site for a T cell transcription factor, and that thereby is associated with the downstream activity of a T cell transcription factor.
- the transcription factor is nuclear factor of activated T-cells (NFAT), C/EBP, STAT1, STAT2, or NFKB.
- the T cell activation factor contains a response element or elements recognized by a nuclear factor of activated T-cells (NFAT), C/EBP, STAT1, STAT2, and NFKB.
- the T cell activation factor can contain a regulatory element or elements recognized by or responsive to one or two, and in some cases three or more, unique transcription factors.
- the efficacy of the immunomodulatory polypeptide is improved as compared to a recombinant human cytokine or chemokine or to an immunomodulatory polypeptide not operably linked to such a promoter or enhancer.
- the risk of potential side effects or outcomes indicative of toxicity, of the immunomodulatory polypeptide operably linked to such a promoter or enhancer is reduced as compared with a recombinant human cytokine or chemokine or to an immunomodulatory polypeptide not operably linked to such a promoter or enhancer.
- efficacy is increased comparatively. For example, in some cases, provided
- immunomodulatory polypeptides whose expression is inducibily or conditionally controlled may have decreased or no expression in non-target tissues, but can be activated in the vicinity of target tissues.
- the nucleic acid molecules encoding the provided immunomodulatory polypeptides operably linked to an activation-induced promoter may have decreased or no expression in non-target tissues, but can be activated in the vicinity of target tissues where an immune response has been elicited.
- Such approaches may result in reduced potential for unwanted outcomes or increased efficacy as compared with other compositions and methods.
- the immunomodulatory polypeptide exhibits activity to stimulate a receptor recognized by the first or second peptide, e.g. a cytokine or chemokine receptor.
- the activity of the immunomodulatory polypeptide to stimulate the receptor is increased as compared to an immunomodulatory protein not containing the targeting moiety, such as a recombinant cytokine or chemokine not comprising the joining region.
- the immunomodulatory polypeptide exhibits increased binding to a target cell expressing the target molecule as compared with its binding to a cell not expressing the target molecule.
- the increased activity and/or binding is greater than effected by a reference immunomodulatory polypeptide containing a polypeptide linker between subunits but not containing the targeting moiety.
- the increase is by greater than 1.2-fold, greater than 1.5-fold, greater than 2.0-fold, greater than 3.0-fold, greater than 4.0-fold, greater than 5.0-fold or greater than 10.0-fold.
- the immunomodulatory protein is not immunogenic. In some cases, the immunomodulatory polypeptide does not induce an immune response in a subject to which it is administered. In some cases, the immunomodulatory polypeptide is less
- a subject that is administered the immunomodulatory protein or a cell expressing the immunomodulatory protein does not exhibit or exhibits a reduced immune response or a particular type or degree of immune response, against the immunomodulatory protein compared to administration of such other alternative molecules or administration of cells expressing such other alternative molecules, respectively.
- the type of immune response that is reduced may be a detectable immune response, a humoral immune response, and/or a cell-mediated immune response.
- the provided immunomodulatory polypeptides and recombinant receptors when genetically engineered into immune cells can modulate T cell stimulation and/or activation, thereby resulting in genetically engineered cells with improved longevity, survival and/or persistence in vivo, such as for use in adoptive cell therapy methods.
- cells such as cells that contain the immunomodulatory polypeptide and/or an engineered recombinant receptor, such as described herein.
- the cells are capable of secreting or are designed to secrete the
- immunomodulatory peptide such as the cytokine, such as the modified IL- 12 polypeptide.
- Methods for engineering cells to secrete polypeptides are described, for example, in Pegram et al. (2012) Blood, 119:4133-4141; U.S. publ. No. US20160045551 and U.S. publ. No.
- the engineered cell secretes the immunomodulatory polypeptide that exhibits increased binding to a target cell expressing the target molecule as compared with its binding to a cell not expressing the target molecule, and/or exhibits increased binding to the target cell and/or increased efficacy as compared to a cell expressing a cytokine, e.g., IL-12, that is otherwise the same or substantially the same or similar to the cytokine, e.g., IL-12, that is otherwise the same or substantially the same or similar to the
- the engineered cell effects increased killing of a target cell expressing the target molecule compared to killing of cells not expressing the target molecule.
- the immunomodulatory polypeptides and recombinant receptors can be expressed in cells to produce genetically engineered T cells that, when administered to a subject, exhibit one or more properties that are improved compared to a reference cell composition that does not express or secrete the immunomodulatory protein.
- the increased persistence, activity, binding, and/or killing is greater than effected by a reference composition comprising an engineered cell not expressing an immunomodulatory polypeptide or expressing or secreting an immunomodulatory polypeptide comprising a polypeptide linker between subunits but not comprising the targeting moiety.
- one or more properties of administered genetically engineered cells that can be improved or increased or greater compared to administered cells of a reference composition include decreased
- engineered cells containing the immunomodulatory polypeptide and a recombinant receptor exhibit increased persistence and/or survival compared to cells not engineered or compared to cells comprising a recombinant receptor but not the immunomodulatory polypeptide.
- a genetically engineered cell with increased persistence exhibits better potency in a subject to which it is administered.
- the persistence of administered cells is increased at least or about at least 1.5-fold, 2- fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold, 50-fold, 60- fold, 70-fold, 80-fold, 90-fold, 100-fold or more.
- the degree or extent of persistence of administered cells can be detected or quantified after administration to a subject.
- quantitative PCR qPCR is used to assess the quantity of cells expressing the recombinant receptor (e.g., CAR-expressing cells) in the blood or serum or organ or tissue (e.g., disease site) of the subject.
- persistence is quantified as copies of DNA or plasmid encoding the receptor, e.g., CAR, per microgram of DNA, or as the number of receptor-expressing, e.g., CAR-expressing, cells per microliter of the sample, e.g., of blood or serum, or per total number of peripheral blood mononuclear cells (PBMCs) or white blood cells or T cells per microliter of the sample.
- PBMCs peripheral blood mononuclear cells
- flow cytometric assays detecting cells expressing the receptor generally using antibodies specific for the receptors also can be performed.
- Cell-based assays may also be used to detect the number or percentage of functional cells, such as cells capable of binding to and/or neutralizing and/or inducing responses, e.g., cytotoxic responses, against cells of the disease or condition or expressing the antigen recognized by the receptor.
- functional cells such as cells capable of binding to and/or neutralizing and/or inducing responses, e.g., cytotoxic responses, against cells of the disease or condition or expressing the antigen recognized by the receptor.
- the extent or level of expression of another marker associated with the recombinant receptor e.g. CAR-expressing cells
- kits and devices containing and for using, producing and administering the compositions or cells.
- methods, compounds, and compositions for producing the engineered cells are also provided.
- nucleic acids such as constructs, e.g., viral vectors encoding the immunomodulatory polypeptides and/or genetically engineered recombinant receptors, and methods for introducing such nucleic acids into the cells, such as by transduction.
- compositions containing the immunomodulatory polypeptides and engineered cells and methods, kits, and devices for administering the cells and compositions to subjects, such as for adoptive cell therapy.
- the cells are isolated from a subject, engineered, and administered to the same subject. In other aspects, they are isolated from one subject, engineered, and administered to another subject.
- a functional portion typically contains at least or about at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or more of the full length sequence, such as the full length mature sequence lacking the signal peptide.
- the provided immunomodulatory polypeptides or cells containing such a peptide exhibit increased or decreased activity to stimulate or suppress the activity or response of a cognate receptor, compared to a reference polypeptide, wherein the reference polypeptide is the polypeptide, such as a recombinant protein, not containing the joining region or the reference polypeptide is a recombinant protein containing the joining region, but not containing a targeting moiety.
- the immunomodulatory polypeptide exhibits increased affinity for one or more cognate receptor and exhibits increased activity to stimulate via the one or more cognate receptor, compared to the reference polypeptide. In other embodiments, the immunomodulatory polypeptide exhibits decreased affinity for one or more cognate receptor and exhibits decreased stimulation via the one or more cognate receptor, compared to the reference polypeptide. In some embodiments, the immunomodulatory receptor modulates activity by exhibiting increased or decreased binding affinity for the cognate receptor, compared to the reference polypeptide.
- the immunomodulatory polypeptide exhibits a binding affinity for the target molecule with a K D (i.e., an equilibrium dissociation constant of a particular binding interaction with units of M; equal to the ratio of the off-rate [k 0ff or kj to the on-rate [k on or k a ] for this association reaction, assuming bimolecular interaction) of equal to or less than 10 "5 M.
- K D i.e., an equilibrium dissociation constant of a particular binding interaction with units of M; equal to the ratio of the off-rate [k 0ff or kj to the on-rate [k on or k a ] for this association reaction, assuming bimolecular interaction
- the increased activity and/or binding is greater or less than the activity and/or binding effected by a reference immunomodulatory polypeptide containing a polypeptide linker between subunits but not containing a targeting moiety.
- the increase is by greater than 1.2-fold, greater than 1.5-fold, greater than 2.0-fold, greater than 3.0-fold, greater than 4.0-fold, greater than 5.0-fold or greater than 10.0-fold.
- the immunomodulatory polypeptide specifically or preferentially binds to a target molecule expressed by a cell associated with the disease or disorder.
- the joining region contains a targeting moiety that binds to a target molecule.
- the joining region further contains at least one polypeptide linker linking the targeting moiety to the first or second subunit.
- the cytokine or chemokine or a subunit or functional portion thereof is a cytokine or chemokine that binds to a receptor on an immune cell, such as a T cell, NK cell, macrophage, dendritic cell or other immune cell.
- an immune cell such as a T cell, NK cell, macrophage, dendritic cell or other immune cell.
- the immune cell is a T cell, such as a CD4+ or CD8+ T cell.
- the first or second cytokine or chemokine or a first or second subunit of a cytokine or chemokine or a functional portion thereof is independently selected from IL-12, IL-15, IL-2, IL-18, GM-CSF, IL-7, IL-21, IFNa, IFNp, IFNy, IL-17, IL-23, IL-3, IL-4, IL-5, IL-6, IL-9, IL-11, IL-13, IL-27, Erythropoietin, G-CSF, Growth hormone, prolactin, oncostatin M, leukemia inhibitory factor, IL-22, and IL-10, or a subunit or functional portion thereof.
- the first and second peptide such as a first and second cytokine or chemokine, subunit of a cytokine or chemokine or functional portion thereof, does not contain a signal peptide or propeptide.
- ARVFAHGAATLSP IL-3 APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNL P08700 53 NGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILK NLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLE NAQAQQTTLSLAIF
- At least one of the first or second peptide is a cytokine or chemokine, a subunit of a cytokine or chemokine or a functional portion thereof.
- the other of the first or second peptide is a tag or other peptide moiety.
- both of the first and second peptides are a cytokine or chemokine, a subunit of a cytokine or chemokine or a functional portion thereof.
- the cytokine or chemokine is a monomer.
- the cytokine or chemokine is homodimer or heterodimer and the first or second cytokine is a subunit of the homodimer of heterodimer.
- the first and second peptides are the same cytokine or chemokine or functional portion thereof or are the same subunit of the same cytokine or chemokine.
- the first and second peptides are a different cytokine or chemokine or functional portion thereof or are a different subunit of the same or different cytokine or chemokine.
- the cytokine or chemokine is a multimeric protein, such as is a homodimer or heterodimer, in which the first peptide is a first subunit of a cytokine or chemokine and the second peptide is a second subunit of the cytokine or chemokine.
- the joining region containing the targeting moiety connects the first and second subunits, such as the first and second subunits of a cytokine or chemokine that is a homodimer or heterodimer.
- the cytokine or chemokine is interleukin-12 (IL-12).
- IL-12 is a heterodimeric cytokine containing a p35 and a p40 subunit covalently linked by a disulfide bridge.
- the first subunit of the IL-12 is a heterodimeric cytokine containing a p35 and a p40 subunit covalently linked by a disulfide bridge.
- the immunomodulatory polypeptide is p35 or p40 or a functional portion thereof and the second subunit is the other of p35 and p40 or a functional portion thereof.
- the joining region containing the targeting moiety connects or joins the p35 and p40 subunits of IL- 12.
- the p35 subunit has the sequence set forth in SEQ ID NO: 10 or a sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 10.
- the p40 subunit has the sequence set forth in SEQ ID NO: 11 or a sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: l l.
- the cytokine or chemokine is interleukin-23 (IL-23).
- IL-23 is a heterodimeric cytokine containing an IL-12p40 and an IL-23 alpha subunit.
- the first subunit of the IL-23 immunomodulatory polypeptide is IL-12p40 or IL-23 alpha or a functional portion thereof and the second subunit is the other of IL-12p40 and IL-23alpha or a functional portion thereof.
- the joining region containing the targeting moiety connects or joins the IL-12p40 and an IL-23alpha subunit of IL-23.
- the IL-23alpha subunit has the sequence set forth in SEQ ID NO: 52 or a sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO:52.
- the p40 subunit has the sequence set forth in SEQ ID NO: 11 or a sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: l l.
- the cytokine or chemokine is interleukin-27 (IL-27).
- IL-27 is a heterodimeric cytokine containing an IL-27 alpha (p28) and an IL-27 beta (EBI3) subunit.
- the first subunit of the IL-27 immunomodulatory polypeptide is p28 or EBI3 or a functional portion thereof and the second subunit is the other of p28 and EBI3 or a functional portion thereof.
- the joining region containing the targeting moiety connects or joins the p28 and EBI3 subunits of IL-27.
- the p28 subunit has the sequence set forth in SEQ ID NO: 60 or a sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO:60.
- the EBI3 subunit has the sequence set forth in SEQ ID NO: 61 or a sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO:61.
- the cytokine or chemokine is interleukin-35 (IL-35).
- IL-35 is a heterodimeric cytokine containing an IL-12p35 and an IL-27 beta (EBI3) subunit covalently linked by a disulfide bridge.
- the first subunit of the IL-35 immunomodulatory polypeptide is p35 or EBI3 or a functional portion thereof and the second subunit is the other of p35 and EBI3 or a functional portion thereof.
- the joining region containing the targeting moiety connects or joins the p35 and EBI3 subunits of IL-35.
- the p35 subunit has the sequence set forth in SEQ ID NO: 10 or a sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 10.
- the EBI3 subunit has the sequence set forth in SEQ ID NO: 61 or a sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO:61.
- the cytokine or chemokine is or comprises interleukin-15 (IL- 15).
- IL-15 is a cytokine and may be soluble or membrane -bound.
- IL-15 is monomeric and in other embodiments, IL-15 is heterodimeric.
- IL-15 is associated with IL-15Ra.
- the first subunit of the IL-15 immunomodulatory polypeptide is IL-15 or IL-15Ra or a functional portion thereof and the second subunit is the other of IL-15 or IL-15Ra or a functional portion thereof.
- the joining region containing the targeting moiety connects or joins the IL-15 or IL- 15Ra peptides.
- the immunomodulatory polypeptide contains a joining region that connects the first and second peptides, such as the first and second cytokine or chemokine or the first and second subunit of the cytokine or chemokine or functional portions thereof.
- the joining region contains a targeting moiety, such as a targeting peptide, that binds to a target molecule.
- the targeting moiety is directly connected to at least one of the first and second peptides and, in some cases, both of the first and second peptides.
- the targeting moiety is indirectly connected to at least one of the first and second peptides and, in some cases, both of the first and second peptides, such as indirectly connective via a linker.
- the joining region further contains one or more polypeptide linkers connecting the targeting moiety to one or both of the first and second peptide.
- the targeting moiety is flanked by two polypeptide linkers connecting the first and second peptides.
- the immunomodulatory protein comprises: a first peptide, a targeting moiety and a second peptide. In some aspects, the immunomodulatory protein comprises: a first peptide, a linker, a targeting moiety, and a second peptide. In some aspects, the immunomodulatory protein comprises: a first peptide, a targeting moiety, a linker, and a second peptide. In some aspects, the immunomodulatory protein comprises: a first peptide, a linker, a targeting moiety, a linker and a second peptide. In any of such embodiments, the first and second peptide can be reversed in position.
- the joining region does not exceed a maximum length.
- the maximum length of the joining region is or is about no more than 400, 300, 250, 200, 150, 100, 50, 40, 30, 25, 20, 15, 10, or 5 amino acids. In some embodiments, the length of the joining region exceeds 400 amino acids.
- the length of the joining region is between or between about 5 and 400 amino acids, such as between or between about 10 and 400 amino acids, 10 and 300 amino acids, 10 and 200 amino acids, 10 and 100 amino acids, 10 and 50 amino acids, 10 and 30 amino acids, 10 and 20 amino acids, 20 and 400 amino acids, 20 and 300 amino acids, 20 and 200 amino acids, 20 and 100 amino acids, 20 and 50 amino acids, 20 and 30 amino acids, 30 and 400 amino acids, 30 and 300 amino acids, 30 and 200 amino acids, 30 and 100 amino acids, 30 and 50 amino acids, 50 and 400 amino acids, 50 and 300 amino acids, 50 and 200 amino acids, 50 and 100 amino acids, 100 and 400 amino acids, 100 amino acids, 100 and 400 amino acids, 100 and 300 amino acids, 100 and 200 amino acids, 200 and 400 amino acids or 200 and 300 amino acids.
- amino acids such as between or between about 10 and 400 amino acids, 10 and 300 amino acids, 10 and 200 amino acids, 10 and 100 amino acids, 10 and 50 amino acids, 10 and 30 amino acids, 10 and 20 amino acids, 20 and 400 amino acids, 20
- the length of the joining region is between or between about 5 and 50 amino acids, such as 5 and 40 amino acids, 5 and 30 amino acids, 5 and 20 amino acids, 5 and 10 amino acids, 10 and 50 amino acids, 10 and 40 amino acids, 10 and 30 amino acids, 10 and 20 amino acids, 20 and 50 amino acids, 20 and 40 amino acids, 20 and 30 amino acids, 30 and 50 amino acids, 30 and 40 amino acids or 40 and 50 amino acids.
- 5 and 50 amino acids such as 5 and 40 amino acids, 5 and 30 amino acids, 5 and 20 amino acids, 5 and 10 amino acids, 10 and 50 amino acids, 10 and 40 amino acids, 10 and 30 amino acids, 10 and 20 amino acids, 20 and 50 amino acids, 20 and 40 amino acids, 20 and 30 amino acids, 30 and 50 amino acids, 30 and 40 amino acids or 40 and 50 amino acids.
- the joining region contains a targeting moiety, such as a targeting peptide that binds to a target molecule on the surface of a cell.
- a targeting moiety such as a targeting peptide that binds to a target molecule on the surface of a cell.
- the joining region contains two or more targeting moieties.
- the two or more targeting moieties may be the same or different.
- the targeting moiety is human or is derived from a human protein.
- the targeting moiety is a binding peptide.
- the targeting moiety is an antibody or antigen-binding fragment thereof.
- the targeting moiety binds to a target molecule that is a protein, glycoprotein or lipid.
- the target molecule is associated with a disease or disorder.
- the disease or disorder is an infectious disease or disorder, an autoimmune disease, an inflammatory disease, or a tumor or a cancer.
- the target molecule is associated with a tumor or present on a tumor.
- the target molecule is a tumor antigen.
- the target molecule is expressed on the surface of a cell, such as a tumor cell.
- the target molecule is selected from among: hepatocyte growth factor (HGF), heparin, VEGF, VEGF-A, VEGFR2, VEGFR3, HER2, PD-1, tenascin-C, CTLA-4, LAG3, PD-L1, EGFR, EPCAM, RANKL, NG2 proteoglycan, CD20, CD52, CD19, CD3, CD30, IL-6, CD38, SLAMF7, GD2, CD13, CD274, CD279, CD40L, and CD47.
- HGF hepatocyte growth factor
- the targeting moiety has a length of no more than 400, 300, 250, 200, 150, 100, 50, 40, 30, 25, 20, 15, 10, or 5 amino acids.
- the length of the targeting moiety is between or between about 5 and 400 amino acids, such as between or between about 10 and 400 amino acids, 10 and 300 amino acids, 10 and 200 amino acids, 10 and 100 amino acids, 10 and 50 amino acids, 10 and 30 amino acids, 10 and 20 amino acids, 20 and 400 amino acids, 20 and 300 amino acids, 20 and 200 amino acids, 20 and 100 amino acids, 20 and 50 amino acids, 20 and 30 amino acids, 30 and 400 amino acids, 30 and 300 amino acids, 30 and 200 amino acids, 30 and 100 amino acids, 30 and 50 amino acids, 50 and 400 amino acids, 50 and 300 amino acids, 50 and 200 amino acids, 50 and 100 amino acids, 100 and 400 amino acids, 100 amino acids, 100 and 400 amino acids, 100 and 300 amino acids, 100 and 200 amino acids, 200 and 400 amino acids or 200 and 300 amino acids.
- the length of the joining region is between or between about 5 and 50 amino acids, such as 5 and 40 amino acids, 5 and 30 amino acids, 5 and 20 amino acids, 5 and 10 amino acids, 10 and 50 amino acids, 10 and 40 amino acids, 10 and 30 amino acids, 10 and 20 amino acids, 20 and 50 amino acids, 20 and 40 amino acids, 20 and 30 amino acids, 30 and 50 amino acids, 30 and 40 amino acids or 40 and 50 amino acids.
- 5 and 50 amino acids such as 5 and 40 amino acids, 5 and 30 amino acids, 5 and 20 amino acids, 5 and 10 amino acids, 10 and 50 amino acids, 10 and 40 amino acids, 10 and 30 amino acids, 10 and 20 amino acids, 20 and 50 amino acids, 20 and 40 amino acids, 20 and 30 amino acids, 30 and 50 amino acids, 30 and 40 amino acids or 40 and 50 amino acids.
- the targeting moiety binds the target molecule with at least a certain affinity, as measured by any of a number of known methods.
- the affinity is represented by a dissociation constant (K D ) or an association constant (KA).
- the affinity is represented by EC50.
- the targeting moiety binds, such as specifically binds, to the target molecule with an affinity or KA (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M; equal to the ratio of the on-rate [k on or k a ] to the off -rate [k 0 ff or k d ] for this association reaction, assuming bimolecular interaction) equal to or greater than 10 5 M "1 .
- affinity or KA i.e., an equilibrium association constant of a particular binding interaction with units of 1/M; equal to the ratio of the on-rate [k on or k a ] to the off -rate [k 0 ff or k d ] for this association reaction, assuming bimolecular interaction
- the targeting moiety exhibits a binding affinity for the target molecule with a K D (i.e., an equilibrium dissociation constant of a particular binding interaction with units of M; equal to the ratio of the off-rate [k 0 ff or k d ] to the on-rate [k on or k a ] for this association reaction, assuming bimolecular interaction) of equal to or less than 10 "5 M.
- K D i.e., an equilibrium dissociation constant of a particular binding interaction with units of M; equal to the ratio of the off-rate [k 0 ff or k d ] to the on-rate [k on or k a ] for this association reaction, assuming bimolecular interaction
- the equilibrium dissociation constant K D ranges from or from about 10 "5 M to or to about 10 "15 M, such as from or from about 10 "6 M to or to about 10 "12 M, from or from about 10 "7 M to or to about 10 "11 M, from or from about 10 "6 M to or to about 10 s M, or from or from about
- the K D of the targeting moiety to the target molecule is at or about or less than at or about 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 19, 18, 17, 16, 15, 14, 13, 12, 1 1 , 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 nM, such as between at or about 1 nM and at or about 15 nM, e.g., between at or about 5 and at or about 10 nM.
- the K D of the targeting moiety to the target molecule is at or about or less than at or about 1 nM, 100 picomolar (pM), 90 pM, 80 pM, 70 pM, 60 pM, 50 pM, 40 pM, 30 pM, 25 pM, 20 pM, 15 pM, 10 pM, or 1 pM, such as between at or about 10 pM and at or about 100 pM, e.g., between at or about 25 pM and at or about 75 pM.
- the on-rate (association rate constant; k on or k a ; units of l/M- sec or M ' ⁇ ec "1 ) and the off-rate (dissociation rate constant; k 0 ff or k d ; units of 1/s or sec "1 ) can be determined using any of the assay methods known in the art, for example, surface plasmon resonance (SPR, e.g., using a Biacore instrument).
- the targeting moiety binds the target molecule with a higher affinity that the cytokine or chemokine binds its receptor.
- the targeting moiety exhibits a k 0 ff rate for binding the target molecule that is about 0.5xl0 -4 sec -1 or less, about lxlO -4 sec -1 or less, about 2xl0 -4 sec -1 or less, about 3x1 ⁇ -4 sec -1 or less, about 4xl0 -4 sec -1 or less, about 5x1 ⁇ -4 sec -1 or less, about
- the targeting moiety is or contains a peptide binding motif.
- the targeting moiety is or is derived from a hepatocyte growth factor (HGF) binding peptide (HGFBP), a heparin binding peptide (HBP) (e.g., BMP4 or fibronectin), a VEGF binding peptide, a VEGF-A binding peptide, a VEGFR (e.g.
- VEGFR2 or VEGFR3 binding peptide an EPCAM binding peptide, a HER2 binding peptide, a PD-1 binding peptide, a tenascin-C binding peptide, a CTLA-4 binding peptide, a LAG3 binding peptide, a PD-L1 binding peptide, an EGFR binding peptide, a RANKL binding peptide, a CD20 binding peptide, a CD52 binding peptide, a CD 19 binding peptide, a CD3 binding peptide, a CD30 binding peptide, a IL-6 binding peptide, a CD38 binding peptide, a SLAMF7 binding peptide, a GD2 binding peptide, a CD274 binding peptide, a CD279 binding peptide, a CD40L binding peptide, a CD47 binding peptide, a CD 13 binding peptide, an NGR motif, an RGD motif, or an
- the targeting moiety is or contains an HGF binding peptide (HGFBP), an HBP or an EGFR binding peptide (EGFRBP).
- HGFBP HGF binding peptide
- EGFRBP EGFR binding peptide
- the heparin binding peptide (HBP) is derived from fibronectin or BMP4, and/or is of bovine origin. Examples of such binding peptides are known, see e.g. Tarn et al. (2009) Journal of Molecular Biology, 385:79-90; Ahsan et al. (2014) Neoplasia, 16: 105-14; Binetruy-Tournaire et al. (2000) EMBO J., 19: 1525-1533; Vicari et al. (2011) J. Biol.
- Targeting moieties also can be peptides that are identified in binding assays as peptides that bind a selected target molecule.
- Table 2 provides non-limiting examples of peptide binding motifs that can be a targeting moiety.
- the targeting moiety is or comprises a sequence of amino acids set forth in any of SEQ ID NOS: 13-16 and 27-28 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 89%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
- variable heavy chain (V H ) regions single-chain antibody molecules such as scFvs and single- domain V H single antibodies; and multispecific antibodies formed from antibody fragments.
- the antibodies are single-chain antibody fragments comprising a variable heavy chain region and/or a variable light chain region, such as scFvs.
- antibodies that bind a particular antigen may be isolated using a V H or V L domain from an antibody that binds the antigen to screen a library of complementary V L or V H domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
- Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
- a single-domain antibody is a human single-domain antibody.
- Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells.
- the antibodies are recombinantly-produced fragments, such as fragments comprising arrangements that do not occur naturally, such as those with two or more antibody regions or chains joined by synthetic linkers, e.g., peptide linkers, and/or that are may not be produced by enzyme digestion of a naturally-occurring intact antibody.
- the antibody fragments are scFvs.
- the targeting moiety is or comprises an antibody fragment that is a single chain fragment.
- the antibody fragment comprises antibody variable regions joined by a flexible linker, such as a linker set forth in SEQ ID NO:9, SEQ ID NO:22 or SEQ ID NO: 23.
- the antibody fragment is or contains an scFv.
- the targeting moiety contains a variable heavy (VH) chain and a variable light (VL) chain.
- the targeting moiety is or contains a VH chain, but does not contain a VL chain.
- the targeting moiety is or contains a high-affinity, e.g., super high-affinity, VH chain.
- the targeting moiety is or contains a variable heavy (VH) chain and/or variable light (VL) chain of an antibody.
- the antibody is an anti-hepatocyte growth factor (HGF) antibody, an anti-heparin antibody, and anti-VEGF antibody, and anti-VEGF-A antibody, an anti- VEGFR antibody, an anti- VEGFR2 antibody, an anti-HER2 antibody, an anti-PD- 1 antibody, an anti-tenascin-C antibody, an anti-CTLA-4, an anti-LAG3 antibody, an anti-PD-Ll antibody, an anti-EGFR antibody, an anti-EPCAM antibody, an anti-RANKL antibody, and anti- CD20 antibody, an anti-CD52 antibody, an anti-CD 19 antibody, an anti-CD3 antibody, an anti- CD30 antibody, an anti-IL-6 antibody, an anti-CD38 antibody, an anti-SLAMF7 antibody, an anti-GD2 antibody, an anti-CD274 antibody, an anti-CD279 antibody, an anti-CD40L antibody, and an anti-CD47-antibody or antigen-binding fragments thereof.
- HGF hepatocyte growth factor
- the targeting moiety is or contains an anti-EPCAM antibody.
- the targeting moiety has the sequence set forth in SEQ ID NO: 17, or a sequence that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more sequence identity to such a sequence and binds to the target molecule.
- the joining region further contains at least one polypeptide linker linking the targeting moiety to the first or second peptide, such as the first or second subunit of the cytokine or chemokine.
- the joining region contains two polypeptide linkers.
- one of the polypeptide linkers links the first peptide, such as the first subunit of the cytokine or chemokine, to the targeting moiety and the other polypeptide linker links the second peptide, such as the second subunit of the cytokine or chemokine, to the targeting moiety.
- the targeting moiety is contained between a first and a second polypeptide linker, which together form the joining region.
- the polypeptide linker contains from about 2 to about 20 amino acids, such as about 5 to about 15 amino acids, such as 15 or about 15 amino acids.
- the polypeptide linker has the sequence GGGGS(n), wherein n is greater than or equal to one.
- n is greater than or equal to one.
- the polypeptide linker has the sequence set forth in SEQ ID NO: 7.
- the polypeptide linker has the sequence set forth in SEQ ID NO: 8.
- the joining region further contains at least one polypeptide linker linking the targeting moiety to the p35 subunit or the p40 subunit.
- the p40 subunit is connected to a first polypeptide linker that is also attached to a first end of the targeting moiety, and the second end of the targeting moiety is connected to a second polypeptide linker that is also attached to one end of the p35 subunit.
- the IL-12 immunomodulatory polypeptide exhibits increased activity to stimulate via the IL-12R compared to a recombinant IL-12 not comprising the joining region. In some aspects, the immunomodulatory polypeptide exhibits increased binding to a target cell expressing the target molecule as compared with its binding to a cell not expressing the target molecule. In some embodiments, the IL-12 immunomodulatory polypeptides or cells containing such a peptide exhibit increased or decreased activity to stimulate via the IL-12R compared to a recombinant IL-12 not containing the joining region.
- the IL-12 immunomodulatory polypeptide exhibits an increased binding affinity for the IL-12R. In some embodiments, the IL-12 immunomodulatory polypeptide exhibits a decreased binding affinity for the IL-12R.
- the equilibrium dissociation constant K D of the IL-12 immunomodulatory polypeptide and the IL- 12R is from or from about 10 "5 M to or to about 10 "15 M, such as from or from about 10 "6 M to or to about 10 "12 M, from or from about 10 "7 M to or to about 10 "11 M, from or from about 10 "6 M to or to about 10 - " 8 M, or from or from about 10 - " 7 M to or to about 10 - " 8 M.
- the K D of the IL-12 immunomodulatory polypeptide and the IL-12R is at or about or less than at or about 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 nM, such as between at or about 1 nM and at or about 15 nM, e.g., between at or about 5 and at or about 10 nM.
- the K D of the IL-12 is at or about or less than at or about 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 nM, such as between at or about 1 nM and at or about 15 nM, e.g., between at or about 5 and at or about 10 nM.
- immunomodulatory polypeptide and the IL-12R is at or about or less than at or about 1 nM, 100 picomolar (pM), 90 pM, 80 pM, 70 pM, 60 pM, 50 pM, 40 pM, 30 pM, 25 pM, 20 pM, 15 pM, 10 pM, or 1 pM, such as between at or about 10 pM and at or about 100 pM, e.g., between at or about 25 pM and at or about 75 pM.
- the increased activity and/or binding is greater than effected by a reference immunomodulatory polypeptide containing a polypeptide linker between subunits but not containing the targeting moiety.
- the increase is by greater than 1.2- fold, greater than 1.5-fold, greater than 2.0-fold, greater than 3.0-fold, greater than 4.0-fold, greater than 5.0-fold or greater than 10.0-fold.
- the immunomodulatory protein contains: a p35 subunit that has the sequence of amino acids set forth in SEQ ID NO: 10 or a sequence that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 10; a joining region comprising a targeting moiety set forth in SEQ ID NO: 13 (HBP BMP4); and a p40 subunit that has the sequence of amino acids set forth in SEQ ID NO: 11 or a sequence that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 11.
- the joining region contains the targeting moiety flanked on either side by a linker each independently set forth in SEQ ID NO:29, such as set forth in SEQ ID NO:7.
- the immunomodulatory protein comprises the sequence of amino acids set forth in SEQ ID NO:2 or a sequence of amino acids that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO:2.
- the immunomodulatory protein contains: a p35 subunit that has the sequence of amino acids set forth in SEQ ID NO: 10 or a sequence that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 10; a joining region comprising a targeting moiety set forth in SEQ ID NO: 14 (HBP FBN); and a p40 subunit that has the sequence of amino acids set forth in SEQ ID NO: 11 or a sequence that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 11.
- the joining region contains the targeting moiety flanked on either side by a linker each independently set forth in SEQ ID NO:29, such as set forth in SEQ ID NO:7.
- the immunomodulatory protein comprises the sequence of amino acids set forth in SEQ ID NO:3 or a sequence of amino acids that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO:3.
- the immunomodulatory protein contains: a p35 subunit that has the sequence of amino acids set forth in SEQ ID NO: 10 or a sequence that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 10; a joining region comprising a targeting moiety set forth in SEQ ID NO: 15 (HGF binding peptide); and a p40 subunit that has the sequence of amino acids set forth in SEQ ID NO: 11 or a sequence that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 11.
- the joining region contains the targeting moiety flanked on either side by a linker each independently set forth in SEQ ID NO:29, such as set forth in SEQ ID NO:7.
- the linker each independently set forth in SEQ ID NO:29, such as set forth in SEQ ID NO:7.
- immunomodulatory protein comprises the sequence of amino acids set forth in SEQ ID NO:4 or a sequence of amino acids that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO:4.
- the immunomodulatory protein contains: a p35 subunit that has the sequence of amino acids set forth in SEQ ID NO: 10 or a sequence that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 10; a joining region comprising a targeting moiety set forth in SEQ ID NO: 16 (EGFRBP); and a p40 subunit that has the sequence of amino acids set forth in SEQ ID NO: 11 or a sequence that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 11.
- the joining region contains the targeting moiety flanked on either side by a linker each independently set forth in SEQ ID NO:29, such as set forth in SEQ ID NO:7.
- the immunomodulatory protein comprises the sequence of amino acids set forth in SEQ ID NO:5 or a sequence of amino acids that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO:5.
- the immunomodulatory protein contains: a p35 subunit that has the sequence of amino acids set forth in SEQ ID NO: 10 or a sequence that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 10; a joining region comprising a targeting moiety that is an anti- EPCAM antibody comprising the VH chain set forth in SEQ ID NO:25 and/or the VL chain set forth in SQE ID NO: 24, such as an scFv set forth in SEQ ID NO: 17 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to any of SEQ ID NOS: 17, 24 and 25; and a p40 subunit that has the sequence of amino acids set forth in SEQ ID NOS:
- the joining region contains the targeting moiety flanked on either side by a linker each independently set forth in SEQ ID NO:29, such as set forth in SEQ ID NO:7.
- the immunomodulatory protein comprises the sequence of amino acids set forth in SEQ ID NO:6 or a sequence of amino acids that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO:6.
- the engineered or recombinant receptors include chimeric receptors, including those containing ligand-binding domains or binding fragments thereof, such as functional non-TCR antigen receptors, such as chimeric antigen receptors (CARs), and also include T cell receptors (TCRs), such as transgenic TCRs, and components thereof.
- the chimeric receptor, such as a CAR generally includes the extracellular antigen (or ligand) binding domain linked to one or more intracellular signaling components, in some aspects via linkers and/or transmembrane domain(s).
- the recombinant receptor such as chimeric receptor, contains an intracellular signaling domain, which includes an activating cytoplasmic signaling domain (also interchangeably called an intracellular signaling region), such as an activating cytoplasmic (intracellular) domain capable of inducing a primary activation signal in a T cell, for example, a cytoplasmic signaling domain of a T cell receptor (TCR) component (e.g. a cytoplasmic signaling domain of a zeta chain of a CD3-zeta ⁇ 3 ⁇ ) chain or a functional variant or signaling portion thereof) and/or that comprises an immunoreceptor tyrosine-based activation motif ( ⁇ ).
- TCR T cell receptor
- ⁇ immunoreceptor tyrosine-based activation motif
- the antigen (or a ligand) is a tumor antigen or cancer marker.
- the CAR is constructed with a specificity for a particular antigen (or marker or ligand), such as an antigen expressed in a particular cell type to be targeted by adoptive therapy, e.g. , a cancer marker, and/or an antigen intended to induce a dampening response, such as an antigen expressed on a normal or non-diseased cell type.
- a particular antigen or marker or ligand
- the CAR typically includes in its extracellular portion one or more antigen binding molecules, such as one or more antigen-binding fragment, domain, or portion, or one or more antibody variable domains, and/or antibody molecules.
- the CAR includes an antigen- binding portion or portions of an antibody molecule, such as a single-chain antibody fragment (scFv) derived from the variable heavy (VH) and variable light (VL) chains of a monoclonal antibody (mAb).
- an antibody molecule such as a single-chain antibody fragment (scFv) derived from the variable heavy (VH) and variable light (VL) chains of a monoclonal antibody (mAb).
- the antigen-binding proteins, antibodies and antigen binding fragments thereof specifically recognize an antigen of a full-length antibody.
- the heavy and light chains of an antibody can be full-length or can be an antigen- binding portion (a Fab, F(ab')2, Fv or a single chain Fv fragment (scFv)).
- the antibody heavy chain constant region is chosen from, e.g. , IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE, particularly chosen from, e.g.
- variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen.
- the variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three CDRs.
- FRs conserved framework regions
- a single VH or VL domain may be sufficient to confer antigen-binding specificity.
- antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary V L or V H domains, respectively. See, e.g. , Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
- Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
- a single-domain antibody is a human single-domain antibody.
- the CAR comprises an antibody heavy chain domain that specifically binds the antigen, such as a cancer marker or cell surface antigen of a cell or disease to be targeted, such as a tumor cell or a cancer cell, such as any of the target antigens described herein or known in the art.
- a “humanized” antibody is an antibody in which all or substantially all CDR amino acid residues are derived from non-human CDRs and all or substantially all FR amino acid residues are derived from human FRs.
- a humanized antibody optionally may include at least a portion of an antibody constant region derived from a human antibody.
- a "humanized form" of a non-human antibody refers to a variant of the non-human antibody that has undergone humanization, typically to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
- some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g. , the antibody from which the CDR residues are derived), e.g. , to restore or improve antibody specificity or affinity.
- the CAR contains an antibody or an antigen-binding fragment (e.g. scFv) that specifically recognizes an antigen, such as an intact antigen, expressed on the surface of a cell.
- the CAR contains a TCR-like antibody, such as an antibody or an antigen-binding fragment (e.g. scFv) that specifically recognizes an intracellular antigen, such as a tumor-associated antigen, presented on the cell surface as a MHC-peptide complex.
- an antibody or antigen-binding portion thereof that recognizes an MHC- peptide complex can be expressed on cells as part of a recombinant receptor, such as an antigen receptor.
- antigen receptors are functional non-TCR antigen receptors, such as chimeric antigen receptors (CARs).
- CARs chimeric antigen receptors
- a CAR containing an antibody or antigen-binding fragment that exhibits TCR-like specificity directed against peptide-MHC complexes also may be referred to as a TCR-like CAR.
- MHC Major histocompatibility complex
- a protein generally a glycoprotein, that contains a polymorphic peptide binding site or binding groove that can, in some cases, complex with peptide antigens of polypeptides, including peptide antigens processed by the cell machinery.
- MHC molecules can be displayed or expressed on the cell surface, including as a complex with peptide, i.e. MHC-peptide complex, for presentation of an antigen in a conformation recognizable by an antigen receptor on T cells, such as a TCRs or TCR-like antibody.
- the MHC-peptide complex is present or displayed on the surface of cells.
- the MHC-peptide complex can be specifically recognized by an antigen receptor, such as a TCR, TCR-like CAR or antigen-binding portions thereof.
- a peptide, such as a peptide antigen or epitope, of a polypeptide can associate with an MHC molecule, such as for recognition by an antigen receptor.
- the peptide is derived from or based on a fragment of a longer biological molecule, such as a polypeptide or protein.
- the peptide typically is about 8 to about 24 amino acids in length.
- a peptide has a length of from or from about 9 to 22 amino acids for recognition in the MHC Class II complex.
- a peptide has a length of from or from about 8 to 13 amino acids for recognition in the MHC Class I complex.
- the antigen receptor upon recognition of the peptide in the context of an MHC molecule, such as MHC-peptide complex, produces or triggers an activation signal to the T cell that induces a T cell response, such as T cell proliferation, cytokine production, a cytotoxic T cell response or other response.
- an antibody or antigen-binding portion thereof that specifically binds to a MHC-peptide complex can be produced by immunizing a host with an effective amount of an immunogen containing a specific MHC-peptide complex.
- the peptide of the MHC-peptide complex is an epitope of antigen capable of binding to the MHC, such as a tumor antigen, for example a universal tumor antigen, myeloma antigen or other antigen as described below.
- an effective amount of the immunogen is then administered to a host for eliciting an immune response, wherein the immunogen retains a three-dimensional form thereof for a period of time sufficient to elicit an immune response against the three-dimensional presentation of the peptide in the binding groove of the MHC molecule.
- Serum collected from the host is then assayed to determine if desired antibodies that recognize a three-dimensional presentation of the peptide in the binding groove of the MHC molecule is being produced.
- the produced antibodies can be assessed to confirm that the antibody can differentiate the MHC-peptide complex from the MHC molecule alone, the peptide of interest alone, and a complex of MHC and irrelevant peptide. The desired antibodies can then be isolated.
- an antibody or antigen-binding portion thereof that specifically binds to an MHC-peptide complex can be produced by employing antibody library display methods, such as phage antibody libraries.
- phage display libraries of mutant Fab, scFV or other antibody forms can be generated, for example, in which members of the library are mutated at one or more residues of a CDR or CDRs. Exemplary of such methods are known in the art (see e.g. US published application No. US20020150914,
- TCRs T cell Receptors
- a T cell receptor contains a variable a and ⁇ chains (also known as TCRa and TCRp, respectively) or a variable ⁇ and ⁇ chains (also known as TCRy and TCR5, respectively), or a functional fragment thereof such that the molecule is capable of specifically binding to an antigen peptide bound to a MHC receptor.
- the TCR is in the ⁇ form.
- TCRs that exist in ⁇ and ⁇ forms are generally structurally similar, but T cells expressing them may have distinct anatomical locations or functions.
- a TCR can be found on the surface of a cell or in soluble form.
- TCR includes any TCR or functional fragment, such as an antigen-binding portion of a TCR that binds to a specific antigenic peptide bound in an MHC molecule, i.e. MHC-peptide complex.
- An "antigen-binding portion" or antigen-binding fragment" of a TCR which can be used
- an antigen-binding portion contains the variable domains of a TCR, such as variable a chain and variable ⁇ chain of a TCR, sufficient to form a binding site for binding to a specific MHC-peptide complex, such as generally where each chain contains three complementarity determining regions.
- the TCR chains can contain a transmembrane domain.
- the transmembrane domain is positively charged.
- the TCR chain contains a cytoplasmic tail.
- the structure allows the TCR to associate with other molecules like CD3. For example, a TCR containing constant domains with a
- the TCR may be a heterodimer of two chains a and ⁇ (or optionally ⁇ and ⁇ ) or it may be a single chain TCR construct.
- the TCR is a heterodimer containing two separate chains (a and ⁇ chains or ⁇ and ⁇ chains) that are linked, such as by a disulfide bond or disulfide bonds.
- a TCR for a target antigen e.g., a cancer antigen
- nucleic acid encoding the TCR can be obtained from a variety of sources, such as by polymerase chain reaction (PCR) amplification of publicly available TCR DNA sequences.
- the TCR is obtained from a biological source, such as from cells such as from a T cell (e.g. cytotoxic T cell), T-cell hybridomas or other publicly available source.
- the T-cells can be obtained from in vivo isolated cells.
- a high-affinity T cell clone can be isolated from a patient and the TCR isolated.
- the T- cells can be a cultured T-cell hybridoma or clone.
- the TCR clone for a target antigen has been generated in transgenic mice engineered with human immune system genes (e.g., the human leukocyte antigen system, or HLA). See, e.g., tumor antigens (see, e.g., Parkhurst et al.
- the spacer can be of a length that provides for increased responsiveness of the cell following antigen binding, as compared to in the absence of the spacer.
- the spacer is at or about 12 amino acids in length or is no more than 12 amino acids in length.
- Exemplary spacers include those having at least about 10 to 229 amino acids, about 10 to 200 amino acids, about 10 to 175 amino acids, about 10 to 150 amino acids, about 10 to 125 amino acids, about 10 to 100 amino acids, about 10 to 75 amino acids, about 10 to 50 amino acids, about 10 to 40 amino acids, about 10 to 30 amino acids, about 10 to 20 amino acids, or about 10 to 15 amino acids, and including any integer between the endpoints of any of the listed ranges.
- the antigen recognition domain generally is linked to one or more intracellular signaling components, such as signaling components that mimic activation through an antigen receptor complex, such as a TCR complex, in the case of a CAR, and/or signal via another cell surface receptor.
- the antigen binding component e.g., antibody
- the antigen binding component is linked to one or more transmembrane and intracellular signaling domains.
- the transmembrane domain is fused to the extracellular domain.
- a transmembrane domain that naturally is associated with one of the domains in the receptor e.g., CAR
- the transmembrane domain is selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- the transmembrane domain in some embodiments is derived either from a natural or from a synthetic source. Where the source is natural, the domain in some aspects is derived from any membrane-bound or transmembrane protein.
- Transmembrane regions include those derived from (i.e. comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154.
- the transmembrane domain in some embodiments is synthetic.
- the receptor e.g., the CAR
- the receptor generally includes at least one intracellular signaling component or components.
- the receptor includes an intracellular component of a TCR complex, such as a TCR CD3 chain that mediates T-cell activation and cytotoxicity, e.g., CD3 zeta chain.
- the CAR is linked to one or more cell signaling modules.
- cell signaling modules include CD3 transmembrane domain, CD3 intracellular signaling domains, and/or other CD transmembrane domains.
- the receptor e.g., CAR
- the receptor further includes a portion of one or more additional molecules such as Fc receptor ⁇ , CD8, CD4, CD25, or CD16.
- the CAR includes a chimeric molecule between CD3-zeta (CD3 ⁇ ) or Fc receptor ⁇ and CD8, CD4, CD25 or CD16.
- the cytoplasmic domain or intracellular signaling domain of the CAR activates at least one of the normal effector functions or responses of the immune cell, e.g., T cell engineered to express the CAR.
- full activation In the context of a natural TCR, full activation generally requires not only signaling through the TCR, but also a costimulatory signal.
- a component for generating secondary or co-stimulatory signal is also included in the CAR.
- the CAR does not include a component for generating a costimulatory signal.
- an additional CAR is expressed in the same cell and provides the component for generating the secondary or costimulatory signal.
- the CAR includes a primary cytoplasmic signaling sequence that regulates primary activation of the TCR complex.
- Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
- ITAM containing primary cytoplasmic signaling sequences include those derived from TCR or CD3 zeta, FcR gamma or FcR beta.
- cytoplasmic signaling molecule(s) in the CAR contain(s) a cytoplasmic signaling domain, portion thereof, or sequence derived from CD3 zeta.
- the activating domain is included within one CAR, whereas the costimulatory component is provided by another CAR recognizing another antigen.
- the CARs include activating or stimulatory CARs, and costimulatory CARs, both expressed on the same cell (see WO2014/055668).
- the intracellular signaling domain comprises a CD28 transmembrane and signaling domain linked to a CD3 (e.g., CD3-zeta) intracellular domain.
- the intracellular signaling domain comprises a chimeric CD28 and CD 137 (4- IBB, TNFRSF9) co- stimulatory domains, linked to a CD3 zeta intracellular domain.
- the CAR encompasses one or more, e.g., two or more, costimulatory domains and an activation domain, e.g., primary activation domain, in the cytoplasmic portion.
- exemplary CARs include intracellular components of CD3-zeta, CD28, and 4- IBB.
- the CAR or other antigen receptor may further include a marker or the cell may further express a marker, such as a surrogate marker, which may be used to confirm transduction or engineering of the cell to express the receptor, such as a truncated version of a cell surface receptor, such as truncated EGFR (tEGFR).
- a marker such as a surrogate marker, which may be used to confirm transduction or engineering of the cell to express the receptor, such as a truncated version of a cell surface receptor, such as truncated EGFR (tEGFR).
- the marker includes all or part (e.g., truncated form) of CD34, a NGFR, or epidermal growth factor receptor (e.g., tEGFR).
- the nucleic acid encoding the marker is operably linked to a polynucleotide encoding for a linker sequence, such as a cleavable linker sequence, e.g., T2A.
- a linker sequence such as a cleavable linker sequence, e.g., T2A.
- introduction of a construct encoding the CAR and EGFRt separated by a T2A ribosome switch can express two proteins from the same construct, such that the EGFRt can be used as a marker to detect cells expressing such construct.
- a marker, and optionally a linker sequence can be any as disclosed in published patent application No. WO2014031687.
- the marker can be a truncated EGFR (tEGFR) that is, optionally, linked to a linker sequence, such as a T2A cleavable linker sequence.
- tEGFR truncated EGFR
- An exemplary polypeptide for a truncated EGFR comprises the sequence of amino acids set forth in SEQ ID NO: 75 or 101 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 75 or 101.
- An exemplary T2A linker sequence comprises the sequence of amino acids set forth in SEQ ID NO: 76 or 96 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 76 or 96.
- the marker is a molecule, e.g., cell surface protein, not naturally found on T cells or not naturally found on the surface of T cells, or a portion thereof.
- the molecule is a non-self molecule, e.g., non-self protein, i.e., one that is not recognized as "self by the immune system of the host into which the cells will be adoptively transferred.
- the marker serves no therapeutic function and/or produces no effect other than to be used as a marker for genetic engineering, e.g., for selecting cells successfully engineered.
- the marker may be a therapeutic molecule or molecule otherwise exerting some desired effect, such as a ligand for a cell to be encountered in vivo, such as a costimulatory or immune checkpoint molecule to enhance and/or dampen responses of the cells upon adoptive transfer and encounter with ligand.
- the chimeric antigen receptor includes an extracellular portion containing the antibody or fragment described herein. In some aspects, the chimeric antigen receptor includes an extracellular portion containing the antibody or fragment described herein and an intracellular signaling domain. In some embodiments, the antibody or fragment includes an scFv or a single-domain V H antibody and the intracellular domain contains an IT AM. In some aspects, the intracellular signaling domain includes a signaling domain of a zeta chain of a CD3-zeta ⁇ 3 ⁇ ) chain. In some embodiments, the chimeric antigen receptor includes a transmembrane domain linking the extracellular domain and the intracellular signaling domain.
- the transmembrane domain contains a transmembrane portion of CD28.
- the extracellular domain and transmembrane can be linked directly or indirectly.
- the extracellular domain and transmembrane are linked by a spacer, such as any described herein.
- the chimeric antigen receptor contains an intracellular domain of a T cell costimulatory molecule, such as between the transmembrane domain and intracellular signaling domain.
- the T cell costimulatory molecule is CD28 or 4- IBB.
- the CAR contains an antibody, e.g., an antibody fragment, a transmembrane domain that is or contains a transmembrane portion of CD28 or a functional variant thereof, and an intracellular signaling domain containing a signaling portion of CD28 or functional variant thereof and a signaling portion of CD3 zeta or functional variant thereof.
- the CAR contains an antibody, e.g., antibody fragment, a transmembrane domain that is or contains a transmembrane portion of CD28 or a functional variant thereof, and an intracellular signaling domain containing a signaling portion of a 4- IBB or functional variant thereof and a signaling portion of CD3 zeta or functional variant thereof.
- the receptor further includes a spacer containing a portion of an Ig molecule, such as a human Ig molecule, such as an Ig hinge, e.g. an IgG4 hinge, such as a hinge-only spacer.
- an Ig molecule such as a human Ig molecule
- an Ig hinge e.g. an IgG4 hinge, such as a hinge-only spacer.
- the transmembrane domain of the receptor e.g., the CAR is a transmembrane domain of human CD28 or variant thereof, e.g., a 27-amino acid transmembrane domain of a human CD28 (Accession No.: P10747.1), or is a transmembrane domain that comprises the sequence of amino acids set forth in SEQ ID NO: 77 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO:77; in some embodiments, the
- transmembrane-domain containing portion of the recombinant receptor comprises the sequence of amino acids set forth in SEQ ID NO: 78 or a sequence of amino acids having at least at or about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto.
- the chimeric antigen receptor contains an intracellular domain of a T cell costimulatory molecule.
- the T cell costimulatory molecule is CD28 or 4-1BB.
- the intracellular signaling domain comprises an intracellular costimulatory signaling domain of human CD28 or functional variant or portion thereof, such as a 41 amino acid domain thereof and/or such a domain with an LL to GG substitution at positions 186-187 of a native CD28 protein.
- the intracellular signaling domain can comprise the sequence of amino acids set forth in SEQ ID NO: 79 or 80 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 79 or 80.
- the intracellular domain comprises an intracellular costimulatory signaling domain of 4- IBB or functional variant or portion thereof, such as a 42-amino acid cytoplasmic domain of a human 4- 1BB (Accession No.
- Q07011.1 or functional variant or portion thereof, such as the sequence of amino acids set forth in SEQ ID NO: 81 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 81.
- the intracellular signaling domain comprises a human CD3 zeta stimulatory signaling domain or functional variant thereof, such as a 112 AA cytoplasmic domain of isoform 3 of human CD3 ⁇ (Accession No.: P20963.2) or a CD3 zeta signaling domain as described in U.S. Patent No.: 7,446,190 or U.S. Patent No. 8,911,993.
- a human CD3 zeta stimulatory signaling domain or functional variant thereof such as a 112 AA cytoplasmic domain of isoform 3 of human CD3 ⁇ (Accession No.: P20963.2) or a CD3 zeta signaling domain as described in U.S. Patent No.: 7,446,190 or U.S. Patent No. 8,911,993.
- the intracellular signaling domain comprises the sequence of amino acids set forth in SEQ ID NO: 82, 83 or 84 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 82, 83 or 84.
- the spacer contains only a hinge region of an IgG, such as only a hinge of IgG4 or IgGl, such as the hinge only spacer set forth in SEQ ID NO:70.
- the spacer is an Ig hinge, e.g., and IgG4 hinge, linked to a CH2 and/or CH3 domains.
- the spacer is an Ig hinge, e.g., an IgG4 hinge, linked to CH2 and CH3 domains, such as set forth in SEQ ID NO:73.
- the spacer is an Ig hinge, e.g., an IgG4 hinge, linked to a CH3 domain only, such as set forth in SEQ ID NO:72.
- the spacer is or comprises a glycine-serine rich sequence or other flexible linker such as known flexible linkers.
- the CAR includes an antigen-binding domain, e.g. scFvs, a spacer such as any of the Ig-hinge containing spacers, a CD28 transmembrane domain, a CD28 intracellular signaling domain, and a CD3 zeta signaling domain.
- the CAR includes the antigen-binding domain, e.g. scFv, a spacer such as any of the Ig-hinge containing spacers, a CD28 transmembrane domain, a CD28 intracellular signaling domain, and a CD3 zeta signaling domain.
- such CAR constructs further includes a T2A ribosomal skip element and/or a tEGFR sequence, e.g., downstream of the CAR.
- immunomodulatory peptides and recombinant receptors immunomodulatory peptides and recombinant receptors, vectors for genetically engineering cells to express such polypeptides and receptors, and methods for producing the
- immunomodulatory polypeptides recombinant receptors, and genetically engineered cells.
- polynucleotides that encode any of the immunomodulatory polypeptides provided herein.
- the polynucleotide contains a signal nucleic acid sequence, such as a nucleic acid sequence encoding the immunomodulatory polypeptide.
- the polynucleotide contains a first nucleic acid sequence encoding the immunomodulatory polypeptide and a second nucleic acid sequence encoding a recombinant receptor.
- the recombinant receptor is or contains a chimeric antigen receptor (CAR).
- the recombinant receptor is or contains a T cell receptor (TCR), e.g., a transgenic TCR.
- TCR T cell receptor
- any of the provided polynucleotides can be modified to remove CpG motifs and/or to optimize codons for translation in a particular species, such as human, canine, feline, equine, ovine, bovine, etc. species.
- the polynucleotides are optimized for human codon usage (i.e., human codon-optimized).
- the polynucleotides are modified to remove CpG motifs.
- the provided polynucleotides are modified to remove CpG motifs and are codon-optimized, such as human codon-optimized. Methods of codon optimization and CpG motif detection and modification are well-known.
- polynucleotide optimization enhances transgene expression, increases transgene stability and preserves the amino acid sequence of the encoded polypeptide.
- exemplary optimized polynucleotide sequences, encoding exemplary immunomodulatory polypeptides are set forth in SEQ ID NOs: 102-107.
- the polynucleotide contains a signal sequence that encodes a signal peptide.
- the signal sequence may encode a signal peptide derived from CD33, IL- 12p40 or IL-12p35.
- Some such CD33, IL-12p40 or IL-12p35 signal peptides may have the sequence set forth in SEQ ID NO: 18, 12, or 19, respectively, or a sequence that has at least 95% sequence identity to such a sequence.
- the polynucleotide encoding the immunomodulatory polypeptide and/or recombinant receptor contains at least one promoter that is operatively linked to control expression of the immunomodulatory polypeptide and/or recombinant receptor. In some examples, the polynucleotide contains two, three, or more promoters operatively linked to control expression of the immunomodulatory polypeptide and/or recombinant receptor.
- expression of the immunomodulatory polypeptide and/or recombinant receptor is inducible or conditional.
- the polynucleotide encoding the immunomodulatory polypeptide and/or recombinant receptor contains a conditional promoter, enhancer, or transactivator.
- the conditional promoter, enhancer, or transactivator is an inducible promoter, enhancer, or transactivator or a repressible promoter, enhancer, or transactivator.
- an inducible or conditional promoter can be used to restrict expression of the immunomodulatory polypeptide and/or recombinant receptor to a specific microenvironment, such as a tumor microenvironment.
- the tumor microenvironment includes conditions such as hypoxia and low glucose.
- the inducible or conditional promoter is active in the presence of one or more conditions in the tumor microenvironment, such as hypoxia, low glucose, acidic pH, and/or oxidative stress.
- expression driven by the inducible or conditional promoter is regulated by exposure to an exogenous agent, such as heat, radiation, or drug.
- expression of the immunomodulatory polypeptide and/or recombinant receptor is limited to hypoxic conditions.
- hypoxia-inducible transcription factor- 1 alpha (HIF-1 alpha)-mediated transcription binds to DNA motifs known as hypoxia response elements (HREs) under hypoxic conditions.
- HREs hypoxia response elements
- HREs can be used to drive transgene expression specifically within areas of hypoxia, such as tumors.
- a promoter yielding hypoxia-inducible gene expression can be constructed by combining one or more hypoxia response elements (HRE), from HIF-1 -responsive genes, having the consensus core sequence 5'-(A/G)CGT(G/C)(G/C)-3' with a promoter, such as a basal promoter (e.g., CMV, SV40, or elongation factor- 1 (EF-1) promoter).
- HRE hypoxia response elements
- HIF-1 -responsive genes include erythropoietin (Epo), VEGF-A, phosphoglycerate kinase 1 (PGK1), lactate
- LDH A dehydrogenase A
- ADA aldolase A
- GPDH glyceraldehyde 3-phosphate dehydrogenase
- expression of the immunomodulatory polypeptide and/or recombinant receptor is restricted to conditions of low glucose.
- a glucose- responsive promoter can be used to drive transgene expression in cells exposed to low glucose conditions, such as cells present in a tumor environment.
- Exemplary glucose-responsive promoters include the glucose-regulated protein GRP78 promoter and the hexokinase II promoter.
- exogenously controlled inducible promoters can be used to regulate expression of modulatory polypeptide and/or recombinant receptor.
- radiation-inducible promoters, heat-inducible promoters, and/or drug-inducible promoters can be used to selectively drive transgene expression in, for example, targeted regions.
- the location, duration, and level of transgene expression can be regulated by the administration of the exogenous source of induction.
- transgene expression is limited to a radiation field upon application of radiation therapy, using a radiation inducible promoter.
- Methods of radiation therapy such as conformal radiation therapy, interstitial radiation therapy, brachytherapy, or targeted delivery of radioisotopes can be exploited to induce localized expression of the immunomodulatory polypeptide and/or recombinant receptor under the regulation of a radiation- inducible promoter.
- cells activate transcription of a variety of genes, such as c-jun, NFP, EGR-1 and p21(WAF-l).
- Exemplary radiation-inducible promoters include: EGR-1, Waf-1, RecA, and cIAP2 promoters.
- CArG elements of the EGR-1 promoter contain the consensus sequence CC(A+T rich) 6 GG motif (e.g., CCTTATTTGG; SEQ ID NO: 91), and also confer dose-dependent expression in response to exposure to radiation.
- Exemplary synthetic promoters can contain 1 or more CArG elements, such as 1, 2, 4, 6, 8, 10, 12, 14, or more CArG elements.
- Exemplary synthetic CArG-containing promoters are set forth in SEQ ID NOS: 92-95. When radiation inducible promoters are employed, cells provided herein, containing the constructs provided herein, containing a radiation-inducible promoter.
- expression of the immunomodulatory polypeptide and/or recombinant receptor is regulated by a heat inducible promoter.
- the cellular response to hyperthermia is associated with the synthesis of heat shock proteins (HSPs).
- HSPs heat shock proteins
- expression of the modulatory polypeptide and/or recombinant receptor can be regulated by an HSP promoter, such as an HSP70B promoter, which will selectively activate transgene expression following hyperthermia treatment, thereby controlling the location, duration and level of expression of the transgene.
- HSP promoter such as an HSP70B promoter
- heat shock elements HSE
- Gadd 153 is another exemplary heat-inducible promoter.
- Ultrasound and electromagnetic fields can also be used to stimulate transgene expression under the regulation of an HSP promoter. Temperatures and other exogenous forms of energy transfer, such as ultrasound and electromagnetic radiation, resulting in transgene expression in such systems can be empirically determined. In some embodiments, feedback loops can be incorporated to enhance transgene expression (see, e.g., Emilusen et al., Urol Int. 2001; 67(3):216-223).
- expression of the immunomodulatory polypeptide and/or recombinant receptor is regulated using or a drug-inducible promoter.
- the promoter, enhancer, or transactivator comprises a Lac operator sequence, a tetracycline operator sequence, a galactose operator sequence, a doxycycline operator sequence, a rapamycin operator sequence, a tamoxifen operator sequence, or a hormone-responsive operator sequence, or an analog thereof.
- the inducible promoter comprises a tetracycline response element (TRE).
- the inducible promoter comprises an estrogen response element (ERE), which can activate gene expression in the presence of tamoxifen.
- a drug-inducible element such as a TRE
- a selected promoter to enhance transcription in the presence of drug, such as doxycycline.
- the drug-inducible promoter is a small molecule-inducible promoter.
- a drug-inducible operator such as a tetracycline operator
- mdrl multidrug resistance
- Effective doses of drug or hormone to achieve desired levels of transgene expression can be empirically determined, and methods of determining effective doses are well- known.
- the expression of the immunomodulatory polypeptide is effected in the presence of an immune cell, e.g., T cell, activation, such as by a T cell activation factor.
- an immune cell e.g., T cell
- activation such as by a T cell activation factor.
- the promoter, enhancer or other response element or portion thereof is recognized by a transcription factor to drive expression of a gene whose activity is normally turned on by T cell activation.
- the T cell activation factor can be a regulatory domain or region (e.g. promoter, enhancer or other response element) of a transcription factor whose activity is turned on by T cell activation.
- the T cell activation factor is responsive to one or more of T cell activation, signal strength of TCR signaling and/or quality of TCR signaling.
- the T cell activation factor can be a regulatory element, such as a promoter, enhancer or response element or elements, that contains a binding site for a T cell transcription factor, and that thereby is associated with the downstream activity of a T cell transcription factor.
- the transcription factor is nuclear factor of activated T-cells (NFAT), C/EBP, STAT1, STAT2, or NFKB.
- the T cell activation factor contains a response element or elements recognized by a nuclear factor of activated T-cells (NFAT), C/EBP, STAT1, STAT2, and NFKB.
- the T cell activation factor can contain a regulatory element or elements recognized by or responsive to one or two, and in some cases three or more, unique transcription factors.
- inducible, condition-dependent, and/or cell-specific promoters and/or regulatory elements can be combined to restrict and/or sensitize expression of the immunomodulatory polypeptide and/or recombinant receptor provided herein.
- the polynucleotide further contains a nucleic acid sequence encoding a linking peptide between the first and second nucleic acid sequences.
- the linking peptide separates the translation products of the first and second nucleic acid sequences during or after translation.
- the linking peptide contains an internal ribosome entry site (IRES), a self-cleaving peptide, or a peptide that causes ribosome skipping, such as a T2A peptide.
- the polynucleotide encoding the immunomodulatory polypeptide and/or recombinant receptor is introduced into a composition containing cultured cells, such as by retroviral transduction, transfection, or transformation.
- the polynucleotide (nucleic acid molecule) is one that encodes the immunomodulatory polypeptide and/or recombinant receptor, e.g., chimeric receptor, such as any described above.
- vectors or constructs containing such nucleic acid molecules contain one or more promoters operatively linked to the nucleotide encoding the polypeptide or receptor to drive expression thereof.
- the promoter is operatively linked to one or more than one nucleic acid molecule.
- vectors such as those that contain any of the polynucleotides provided herein.
- the vector is a viral vector, such as a retroviral vector, e.g., a lentiviral vector or a gammaretroviral vector.
- the vector or construct can contain a single promoter that drives the expression of one or more nucleic acid molecules.
- promoters can be multicistronic (bicistronic or tricistronic, see e.g., U.S. Patent No. 6,060,273).
- transcription units can be engineered as a bicistronic unit containing an IRES (internal ribosome entry site), which allows coexpression of gene products (e.g. encoding a first and second recombinant receptor) by a message from a single promoter.
- IRES internal ribosome entry site
- a single promoter may direct expression of an RNA that contains, in a single open reading frame (ORF), two or three genes (e.g. encoding the molecule involved in modulating a metabolic pathway and encoding the recombinant receptor) separated from one another by sequences encoding a self-cleavage peptide (e.g., 2A sequences) or a protease recognition site (e.g., furin).
- ORF thus encodes a single polypeptide, which, either during (in the case of 2A) or after translation, is processed into the individual proteins.
- the peptide such as T2A
- Many 2A elements are known in the art. Examples of 2A sequences that can be used in the methods and nucleic acids disclosed herein, without limitation, 2A sequences from the foot-and-mouth disease virus (F2A, e.g.
- SEQ ID NO: 100 SEQ ID NO: 100
- E2A equine rhinitis A virus
- T2A e.g. , SEQ ID NO: 76 or 96
- P2A porcine teschovirus-1
- cells such as cells that contain the immunomodulatory
- the cells are capable of secreting or are designed to secrete the
- the engineered cell secretes an immunomodulatory peptide.
- the engineered cell secretes an immunomodulatory peptide.
- the engineered cell effects increased killing of a target cell expressing the target molecule compared to killing of cells not expressing the target molecule.
- the increased persistence, activity, binding, and/or killing is greater than effected by a reference engineered cell expressing or secreting an immunomodulatory polypeptide comprising a polypeptide linker between subunits but not comprising the targeting moiety.
- compositions containing such cells and/or enriched for such cells such as in which cells expressing the immunomodulatory polypeptide and/or chimeric receptor make up at least 50, 60, 70, 80, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or more percent of the total cells in the composition or cells of a certain type such as T cells or CD8+ or CD4+ cells.
- pharmaceutical compositions and formulations for administration such as for adoptive cell therapy.
- therapeutic methods for administering the cells and compositions to subjects e.g., patients.
- the cells generally are eukaryotic cells, such as mammalian cells, and typically are human cells.
- the cells are derived from the blood, bone marrow, lymph, or lymphoid organs, are cells of the immune system, such as cells of the innate or adaptive immunity, e.g. , myeloid or lymphoid cells, including lymphocytes, typically T cells and/or NK cells.
- Other exemplary cells include stem cells, such as multipotent and pluripotent stem cells, including induced pluripotent stem cells (iPSCs).
- the cells typically are primary cells, such as those isolated directly from a subject and/or isolated from a subject and frozen.
- the cells include one or more subsets of T cells or other cell types, such as whole T cell populations, CD4+ cells, CD8+ cells, and subpopulations thereof, such as those defined by function, activation state, maturity, potential for differentiation, expansion, recirculation, localization, and/or persistence capacities, antigen-specificity, type of antigen receptor, presence in a particular organ or compartment, marker or cytokine secretion profile, and/or degree of differentiation.
- the cells may be allogeneic and/or autologous.
- the methods include off-the-shelf methods.
- the cells are pluripotent and/or multipotent, such as stem cells, such as induced pluripotent stem cells (iPSCs).
- the methods include isolating cells from the subject, preparing, processing, culturing, and/or engineering them, as described herein, and re-introducing them into the same patient, before or after cryopreservation.
- T N naive T
- T EFF effector T cells
- T EFF memory T cells and sub-types thereof, such as stem cell memory T (T SCM X central memory T (T CM effector memory T (T EM ), or terminally differentiated effector memory T cells, tumor-infiltrating lymphocytes (TIL), immature T cells, mature T cells, helper T cells, cytotoxic T cells, mucosa-associated invariant T (MAIT) cells, naturally occurring and adaptive regulatory T (Treg) cells, helper T cells, such as TH1 cells, TH2 cells, TH3 cells, TH17 cells, TH9 cells, TH22 cells, follicular helper T cells, alpha/beta T cells, and delta/gamma T cells.
- T N stem cell memory T
- T EM terminally differentiated effector memory T cells
- TIL tumor-infiltrating lymphocytes
- immature T cells immature T cells
- the cells are natural killer (NK) cells.
- the cells are monocytes or granulocytes, e.g., myeloid cells, macrophages, neutrophils, dendritic cells, mast cells, eosinophils, and/or basophils.
- the cells include one or more nucleic acids introduced via genetic engineering, and thereby express recombinant or genetically engineered products of such nucleic acids.
- the nucleic acids are heterologous, i.e., normally not present in a cell or sample obtained from the cell, such as one obtained from another organism or cell, which for example, is not ordinarily found in the cell being engineered and/or an organism from which such cell is derived.
- the nucleic acids are not naturally occurring, such as a nucleic acid not found in nature, including one comprising chimeric combinations of nucleic acids encoding various domains from multiple different cell types.
- preparation of the engineered cells includes one or more culture and/or preparation steps.
- the cells for introduction of the immunomodulatory polypeptide and/or recombinant receptor, e.g., CAR may be isolated from a sample, such as a biological sample, e.g., one obtained from or derived from a subject.
- the subject from which the cell is isolated is one having the disease or condition or in need of a cell therapy or to which cell therapy will be administered.
- the subject in some embodiments is a human in need of a particular therapeutic intervention, such as the adoptive cell therapy for which cells are being isolated, processed, and/or engineered.
- the cells in some embodiments are primary cells, e.g., primary human cells.
- the samples include tissue, fluid, and other samples taken directly from the subject, as well as samples resulting from one or more processing steps, such as separation, centrifugation, genetic engineering (e.g. transduction with viral vector), washing, and/or incubation.
- the biological sample can be a sample obtained directly from a biological source or a sample that is processed.
- Biological samples include, but are not limited to, body fluids, such as blood, plasma, serum, cerebrospinal fluid, synovial fluid, urine and sweat, tissue and organ samples, including processed samples derived therefrom.
- the sample from which the cells are derived or isolated is blood or a blood-derived sample, or is or is derived from an apheresis or leukapheresis product.
- exemplary samples include whole blood, peripheral blood mononuclear cells (PBMCs), leukocytes, bone marrow, thymus, tissue biopsy, tumor, leukemia, lymphoma, lymph node, gut associated lymphoid tissue, mucosa associated lymphoid tissue, spleen, other lymphoid tissues, liver, lung, stomach, intestine, colon, kidney, pancreas, breast, bone, prostate, cervix, testes, ovaries, tonsil, or other organ, and/or cells derived therefrom.
- Samples include, in the context of cell therapy, e.g., adoptive cell therapy, samples from autologous and allogeneic sources.
- the cells are derived from cell lines, e.g., T cell lines.
- the cells in some embodiments are obtained from a xenogeneic source, for example, from mouse, rat, non-human primate, or pig.
- isolation of the cells includes one or more preparation and/or non-affinity based cell separation steps.
- cells are washed, centrifuged, and/or incubated in the presence of one or more reagents, for example, to remove unwanted
- cells are separated based on one or more property, such as density, adherent properties, size, sensitivity and/or resistance to particular components.
- cells from the circulating blood of a subject are obtained, e.g., by apheresis or leukapheresis.
- the samples contain lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and/or platelets, and in some aspects contains cells other than red blood cells and platelets.
- the blood cells collected from the subject are washed, e.g., to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
- the cells are washed with phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- the wash solution lacks calcium and/or magnesium and/or many or all divalent cations.
- a washing step is
- a washing step is accomplished by tangential flow filtration (TFF) according to the manufacturer's instructions.
- the cells are resuspended in a variety of biocompatible buffers after washing, such as, for example, Ca ++ /Mg ++ free PBS.
- components of a blood cell sample are removed and the cells directly resuspended in culture media.
- the methods include density-based cell separation methods, such as the preparation of white blood cells from peripheral blood by lysing the red blood cells and centrifugation through a Percoll or Ficoll gradient.
- the isolation methods include the separation of different cell types based on the expression or presence in the cell of one or more specific molecules, such as surface markers, e.g., surface proteins, intracellular markers, or nucleic acid. In some embodiments, any known method for separation based on such markers may be used. In some embodiments, the separation is affinity- or immunoaffinity-based separation.
- the isolation in some aspects includes separation of cells and cell populations based on the cells' expression or expression level of one or more markers, typically cell surface markers, for example, by incubation with an antibody or binding partner that specifically binds to such markers, followed generally by washing steps and separation of cells having bound the antibody or binding partner, from those cells having not bound to the antibody or binding partner.
- Such separation steps can be based on positive selection, in which the cells having bound the reagents are retained for further use, and/or negative selection, in which the cells having not bound to the antibody or binding partner are retained. In some examples, both fractions are retained for further use. In some aspects, negative selection can be particularly useful where no antibody is available that specifically identifies a cell type in a heterogeneous population, such that separation is best carried out based on markers expressed by cells other than the desired population.
- the separation need not result in 100% enrichment or removal of a particular cell population or cells expressing a particular marker.
- positive selection of or enrichment for cells of a particular type refers to increasing the number or percentage of such cells, but need not result in a complete absence of cells not expressing the marker.
- negative selection, removal, or depletion of cells of a particular type refers to decreasing the number or percentage of such cells, but need not result in a complete removal of all such cells.
- multiple rounds of separation steps are carried out, where the positively or negatively selected fraction from one step is subjected to another separation step, such as a subsequent positive or negative selection.
- a single separation step can deplete cells expressing multiple markers simultaneously, such as by incubating cells with a plurality of antibodies or binding partners, each specific for a marker targeted for negative selection.
- multiple cell types can simultaneously be positively selected by incubating cells with a plurality of antibodies or binding partners expressed on the various cell types.
- T cells such as cells positive or expressing high levels of one or more surface markers, e.g., CD28 + , CD62L + , CCR7 + , CD27 + , CD127 + , CD4 + , CD8 + , CD45RA + , and/or CD45RO + T cells, are isolated by positive or negative selection techniques.
- surface markers e.g., CD28 + , CD62L + , CCR7 + , CD27 + , CD127 + , CD4 + , CD8 + , CD45RA + , and/or CD45RO + T cells.
- CD3 + , CD28 + T cells can be positively selected using anti-CD3/anti- CD28 conjugated magnetic beads (e.g., DYNABEADS® M-450 CD3/CD28 T Cell Expander).
- isolation is carried out by enrichment for a particular cell population by positive selection, or depletion of a particular cell population, by negative selection.
- positive or negative selection is accomplished by incubating cells with one or more antibodies or other binding agent that specifically bind to one or more surface markers expressed or expressed (marker "1" ) at a relatively higher level (marker hlgh ) on the positively or negatively selected cells, respectively.
- T cells are separated from a PBMC sample by negative selection of markers expressed on non-T cells, such as B cells, monocytes, or other white blood cells, such as CD 14.
- a CD4 + or CD8 + selection step is used to separate CD4 + helper and CD8 + cytotoxic T cells.
- Such CD4 + and CD8 + populations can be further sorted into sub-populations by positive or negative selection for markers expressed or expressed to a relatively higher degree on one or more naive, memory, and/or effector T cell subpopulations.
- CD8 + cells are further enriched for or depleted of naive, central memory, effector memory, and/or central memory stem cells, such as by positive or negative selection based on surface antigens associated with the respective subpopulation.
- enrichment for central memory T (T CM ) cells is carried out to increase efficacy, such as to improve long-term survival, expansion, and/or engraftment following administration, which in some aspects is particularly robust in such sub-populations. See Terakura et al. (2012) Blood.1:72-82; Wang et al. (2012) J Immunother. 35(9):689-701.
- combining Tc M -enriched CD8 + T cells and CD4 + T cells further enhances efficacy.
- memory T cells are present in both CD62L “1” and CD62L " subsets of CD8 + peripheral blood lymphocytes.
- PBMC can be enriched for or depleted of CD62L CD8 "1” and/or CD62L + CD8 + fractions, such as using anti-CD8 and anti-CD62L antibodies.
- the enrichment for central memory T (T CM ) cells is based on positive or high surface expression of CD45RO, CD62L, CCR7, CD28, CD3, and/or CD 127; in some aspects, it is based on negative selection for cells expressing or highly expressing
- isolation of a CD8 + population enriched for T CM cells is carried out by depletion of cells expressing CD4, CD 14, CD45RA, and positive selection or enrichment for cells expressing CD62L.
- enrichment for central memory T (T CM ) cells is carried out starting with a negative fraction of cells selected based on CD4 expression, which is subjected to a negative selection based on expression of CD 14 and
- CD45RA and a positive selection based on CD62L. Such selections in some aspects are carried out simultaneously and in other aspects are carried out sequentially, in either order.
- the same CD4 expression-based selection step used in preparing the CD8 + cell population or subpopulation also is used to generate the CD4 + cell population or sub- population, such that both the positive and negative fractions from the CD4-based separation are retained and used in subsequent steps of the methods, optionally following one or more further positive or negative selection steps.
- a sample of PBMCs or other white blood cell sample is subjected to selection of CD4 + cells, where both the negative and positive fractions are retained.
- the negative fraction then is subjected to negative selection based on expression of CD 14 and CD45RA or RORl, and positive selection based on a marker characteristic of central memory T cells, such as CD62L or CCR7, where the positive and negative selections are carried out in either order.
- CD4 + T helper cells are sorted into naive, central memory, and effector cells by identifying cell populations that have cell surface antigens.
- CD4 + lymphocytes can be obtained by standard methods.
- naive CD4 + T lymphocytes are CD45RO " , CD45RA + , CD62L + , CD4 + T cells.
- central memory CD4 + cells are CD62L + and CD45RO + .
- effector CD4 + cells are CD62L " and CD45RO " .
- a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CDl lb, CD16, HLA-DR, and CD8.
- the antibody or binding partner is bound to a solid support or matrix, such as a magnetic bead or paramagnetic bead, to allow for separation of cells for positive and/or negative selection.
- the cells and cell populations are separated or isolated using immunomagnetic (or affinitymagnetic) separation techniques (reviewed in Methods in Molecular Medicine, vol. 58: Metastasis Research
- the sample or composition of cells to be separated is incubated with small, magnetizable or magnetically responsive material, such as magnetically responsive particles or microparticles, such as paramagnetic beads (e.g., such as Dynabeads or MACS beads).
- the magnetically responsive material, e.g., particle generally is directly or indirectly attached to a binding partner, e.g., an antibody, that specifically binds to a molecule, e.g., surface marker, present on the cell, cells, or population of cells that it is desired to separate, e.g., that it is desired to negatively or positively select.
- a binding partner e.g., an antibody
- the magnetic particle or bead comprises a magnetically responsive material bound to a specific binding member, such as an antibody or other binding partner.
- a specific binding member such as an antibody or other binding partner.
- Suitable magnetic particles include those described in Molday, U.S. Pat. No. 4,452,773, and in European Patent Specification EP 452342 B, which are hereby
- Colloidal sized particles such as those described in Owen U.S. Pat. No. 4,795,698, and Liberti et al., U.S. Pat. No. 5,200,084 are other examples.
- the incubation generally is carried out under conditions whereby the antibodies or binding partners, or molecules, such as secondary antibodies or other reagents, which specifically bind to such antibodies or binding partners, which are attached to the magnetic particle or bead, specifically bind to cell surface molecules if present on cells within the sample.
- the antibodies or binding partners, or molecules such as secondary antibodies or other reagents, which specifically bind to such antibodies or binding partners, which are attached to the magnetic particle or bead, specifically bind to cell surface molecules if present on cells within the sample.
- the sample is placed in a magnetic field, and those cells having magnetically responsive or magnetizable particles attached thereto will be attracted to the magnet and separated from the unlabeled cells.
- those cells having magnetically responsive or magnetizable particles attached thereto will be attracted to the magnet and separated from the unlabeled cells.
- positive selection cells that are attracted to the magnet are retained; for negative selection, cells that are not attracted (unlabeled cells) are retained.
- a combination of positive and negative selection is performed during the same selection step, where the positive and negative fractions are retained and further processed or subject to further separation steps.
- the magnetically responsive particles are coated in primary antibodies or other binding partners, secondary antibodies, lectins, enzymes, or streptavidin.
- the magnetic particles are attached to cells via a coating of primary antibodies specific for one or more markers.
- the cells, rather than the beads are labeled with a primary antibody or binding partner, and then cell-type specific secondary antibody- or other binding partner (e.g., streptavidin)-coated magnetic particles, are added.
- streptavidin-coated magnetic particles are used in conjunction with biotinylated primary or secondary antibodies.
- the magnetically responsive particles are left attached to the cells that are to be subsequently incubated, cultured and/or engineered; in some aspects, the particles are left attached to the cells for administration to a patient.
- the magnetizable or magnetically responsive particles are removed from the cells. Methods for removing magnetizable particles from cells are known and include, e.g., the use of competing non-labeled antibodies, magnetizable particles or antibodies conjugated to cleavable linkers, etc.
- the magnetizable particles are biodegradable.
- the affinity-based selection is via magnetic-activated cell sorting (MACS) (Miltenyi Biotec, Auburn, CA). Magnetic Activated Cell Sorting (MACS) systems are capable of high-purity selection of cells having magnetized particles attached thereto.
- MACS operates in a mode wherein the non-target and target species are sequentially eluted after the application of the external magnetic field. That is, the cells attached to magnetized particles are held in place while the unattached species are eluted. Then, after this first elution step is completed, the species that were trapped in the magnetic field and were prevented from being eluted are freed in some manner such that they can be eluted and recovered.
- the non-target cells are labelled and depleted from the heterogeneous population of cells.
- the CliniMACS system in some aspects uses antibody-coupled magnetizable particles that are supplied in a sterile, non-pyrogenic solution.
- the cells after labelling of cells with magnetic particles the cells are washed to remove excess particles.
- a cell preparation bag is then connected to the tubing set, which in turn is connected to a bag containing buffer and a cell collection bag.
- the tubing set consists of pre-assembled sterile tubing, including a pre-column and a separation column, and are for single use only. After initiation of the separation program, the system automatically applies the cell sample onto the separation column. Labelled cells are retained within the column, while unlabeled cells are removed by a series of washing steps.
- the cell populations for use with the methods described herein are unlabeled and are not retained in the column. In some embodiments, the cell populations for use with the methods described herein are labeled and are retained in the column. In some embodiments, the cell populations for use with the methods described herein are eluted from the column after removal of the magnetic field, and are collected within the cell collection bag.
- separation and/or other steps are carried out using the CliniMACS Prodigy system (Miltenyi Biotec).
- the CliniMACS Prodigy system in some aspects is equipped with a cell processing unity that permits automated washing and
- the CliniMACS Prodigy system can also include an onboard camera and image recognition software that determines the optimal cell fractionation endpoint by discerning the macroscopic layers of the source cell product. For example, peripheral blood may be automatically separated into erythrocytes, white blood cells and plasma layers.
- the CliniMACS Prodigy system can also include an integrated cell cultivation chamber which accomplishes cell culture protocols such as, e.g., cell differentiation and expansion, antigen loading, and long-term cell culture. Input ports can allow for the sterile removal and replenishment of media and cells can be monitored using an integrated microscope. See, e.g., Klebanoff et al. (2012) J Immunother. 35(9): 651-660, Terakura et al. (2012) Blood.1:72-82, and Wang et al. (2012) Immunother. 35(9):689-701.
- a cell population described herein is collected and enriched (or depleted) via flow cytometry, in which cells stained for multiple cell surface markers are carried in a fluidic stream.
- a cell population described herein is collected and enriched (or depleted) via preparative scale (FACS)-sorting.
- a cell population described herein is collected and enriched (or depleted) by use of
- MEMS microelectromechanical systems
- MEMS microelectromechanical systems
- the preparation methods include steps for freezing, e.g., cryopreserving, the cells, either before or after isolation, incubation, and/or engineering.
- the freeze and subsequent thaw step removes granulocytes and, to some extent, monocytes in the cell population.
- the cells are suspended in a freezing solution, e.g., following a washing step to remove plasma and platelets. Any of a variety of known freezing solutions and parameters in some aspects may be used.
- a freezing solution e.g., following a washing step to remove plasma and platelets.
- Any of a variety of known freezing solutions and parameters in some aspects may be used.
- PBS containing 20% DMSO and 8% human serum albumin (HSA), or other suitable cell freezing media. This is then diluted 1 : 1 with media so that the final concentration of DMSO and HSA are 10% and 4%, respectively.
- the cells are then frozen to -80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen
- the provided methods include cultivation, incubation, culture, and/or genetic engineering steps.
- the cell populations are incubated in a culture-initiating composition.
- the incubation and/or engineering may be carried out in a culture vessel, such as a unit, chamber, well, column, tube, tubing set, valve, vial, culture dish, bag, or other container for culture or cultivating cells.
- the cells are incubated and/or cultured prior to or in connection with genetic engineering.
- the incubation steps can include culture, cultivation, stimulation, activation, and/or propagation.
- the compositions or cells are incubated in the presence of stimulating conditions or a stimulatory agent. Such conditions include those designed to induce proliferation, expansion, activation, and/or survival of cells in the population, to mimic antigen exposure, and/or to prime the cells for genetic engineering, such as for the introduction of a recombinant antigen receptor.
- the conditions can include one or more of particular media, temperature, oxygen content, carbon dioxide content, time, agents, e.g., nutrients, amino acids, antibiotics, ions, and/or stimulatory factors, such as cytokines, chemokines, antigens, binding partners, fusion proteins, recombinant soluble receptors, and any other agents designed to activate the cells.
- agents e.g., nutrients, amino acids, antibiotics, ions, and/or stimulatory factors, such as cytokines, chemokines, antigens, binding partners, fusion proteins, recombinant soluble receptors, and any other agents designed to activate the cells.
- the stimulating conditions or agents include one or more agent, e.g., ligand, which is capable of activating an intracellular signaling domain of a TCR complex.
- the agent turns on or initiates TCR/CD3 intracellular signaling cascade in a T cell.
- agents can include antibodies, such as those specific for a TCR, e.g. anti-CD3.
- the stimulating conditions include one or more agent, e.g. ligand, which is capable of stimulating a costimulatory receptor, e.g., anti-CD28.
- agents and/or ligands may be, bound to solid support such as a bead, and/or one or more cytokines.
- the expansion method may further comprise the step of adding anti-CD3 and/or anti CD28 antibody to the culture medium (e.g., at a concentration of at least about 0.5 ng/ml).
- the stimulating agents include IL-2, IL-15 and/or IL-7.
- the IL-2 concentration is at least about 10 units/mL.
- incubation is carried out in accordance with techniques such as those described in US Patent No. 6,040,1 77 to Riddell et al., Klebanoff et al.(2012) J
- the T cells are expanded by adding to the culture-initiating composition feeder cells, such as non-dividing peripheral blood mononuclear cells (PBMC), (e.g., such that the resulting population of cells contains at least about 5, 10, 20, or 40 or more PBMC feeder cells for each T lymphocyte in the initial population to be expanded); and incubating the culture (e.g. for a time sufficient to expand the numbers of T cells).
- the non-dividing feeder cells can comprise gamma-irradiated PBMC feeder cells.
- the PBMC are irradiated with gamma rays in the range of about 3000 to 3600 rads to prevent cell division.
- the feeder cells are added to culture medium prior to the addition of the populations of T cells.
- the stimulating conditions include temperature suitable for the growth of human T lymphocytes, for example, at least about 25 degrees Celsius, generally at least about 30 degrees, and generally at or about 37 degrees Celsius.
- the incubation may further comprise adding non-dividing EBV-transformed lymphoblastoid cells (LCL) as feeder cells.
- LCL can be irradiated with gamma rays in the range of about 6000 to 10,000 rads.
- the LCL feeder cells in some aspects is provided in any suitable amount, such as a ratio of LCL feeder cells to initial T lymphocytes of at least about 10: 1.
- antigen-specific T cells such as antigen-specific CD4+ and/or CD8+ T cells
- antigen-specific T cell lines or clones can be generated to cytomegalovirus antigens by isolating T cells from infected subjects and stimulating the cells in vitro with the same antigen.
- Various methods for the introduction of genetically engineered components e.g., immunomodulatory polypeptides and recombinant receptors, e.g., CARs or TCRs, are well known and may be used with the provided methods and compositions.
- Exemplary methods include those for transfer of nucleic acids encoding the polypeptides or receptors, including via viral vectors, e.g., retroviral or lentiviral, non-viral vectors or transposons, e.g. Sleeping Beauty transposon system.
- Methods of gene transfer can include transduction, electroporation or other method that results into gene transfer into the cell.
- gene transfer is accomplished by first stimulating the cell, such as by combining it with a stimulus that induces a response such as proliferation, survival, and/or activation, e.g., as measured by expression of a cytokine or activation marker, followed by transduction of the activated cells, and expansion in culture to numbers sufficient for clinical applications.
- a stimulus such as proliferation, survival, and/or activation, e.g., as measured by expression of a cytokine or activation marker
- the engineered cells include gene segments that cause the cells to be susceptible to negative selection in vivo, such as upon administration in adoptive immunotherapy.
- the cells are engineered so that they can be eliminated as a result of a change in the in vivo condition of the patient to which they are administered.
- the negative selectable phenotype may result from the insertion of a gene that confers sensitivity to an administered agent, for example, a compound.
- Negative selectable genes include the Herpes simplex virus type I thymidine kinase (HSV-I TK) gene (Wigler et al., Cell 2:223, 1977) which confers ganciclovir sensitivity; the cellular hypoxanthine phosphoribosyltransferase (HPRT) gene, the cellular adenine
- HSV-I TK Herpes simplex virus type I thymidine kinase
- HPRT hypoxanthine phosphoribosyltransferase
- APRT phosphoribosyltransferase
- recombinant nucleic acids are transferred into cells using recombinant infectious virus particles, such as, e.g., vectors derived from simian virus 40 (SV40), adenoviruses, adeno-associated virus (AAV).
- recombinant nucleic acids are transferred into T cells using recombinant lentiviral vectors or retroviral vectors, such as gamma-retroviral vectors (see, e.g., Koste et al. (2014) Gene Therapy 2014 Apr 3. doi: 10.1038/gt.2014.25; Carlens et al.
- the retroviral vector has a long terminal repeat sequence (LTR), e.g., a retroviral vector derived from the Moloney murine leukemia virus (MoMLV), myeloproliferative sarcoma virus (MPSV), murine embryonic stem cell virus (MESV), murine stem cell virus (MSCV), spleen focus forming virus (SFFV), or adeno-associated virus (AAV).
- LTR long terminal repeat sequence
- MoMLV Moloney murine leukemia virus
- MPSV myeloproliferative sarcoma virus
- MMV murine embryonic stem cell virus
- MSCV murine stem cell virus
- SFFV spleen focus forming virus
- AAV adeno-associated virus
- retroviral vectors are derived from murine retroviruses.
- the retroviruses include those derived from any avian or mammalian cell source.
- the retroviruses typically are amphotropic, meaning that they are capable of infecting host cells of several species, including humans.
- the gene to be expressed replaces the retroviral gag, pol and/or env sequences.
- recombinant nucleic acids are transferred into T cells via electroporation ⁇ see, e.g., Chicaybam et al, (2013) PLoS ONE 8(3): e60298 and Van Tedeloo et al. (2000) Gene Therapy 7(16): 1431-1437).
- recombinant nucleic acids are transferred into T cells via transposition (see, e.g., Manuri et al. (2010) Hum Gene Ther 21(4): 427-437; Sharma et al. (2013) Molec Ther Nucl Acids 2, e74; and Huang et al. (2009) Methods Mol Biol 506: 115-126).
- the cells e.g., T cells
- TCR T cell receptor
- CAR chimeric antigen receptor
- the genetically modified cell population can then be liberated from the initial stimulus (the CD3/CD28 stimulus, for example) and subsequently be stimulated with a second type of stimulus e.g. via a de novo introduced receptor).
- This second type of stimulus may include an antigenic stimulus in form of a peptide/MHC molecule, the cognate (cross-linking) ligand of the genetically introduced receptor (e.g. natural ligand of a CAR) or any ligand (such as an antibody) that directly binds within the framework of the new receptor (e.g. by recognizing constant regions within the receptor).
- the cognate (cross-linking) ligand of the genetically introduced receptor e.g. natural ligand of a CAR
- any ligand such as an antibody
- genes for introduction are those to improve the efficacy of therapy, such as by promoting viability and/or function of transferred cells; genes to provide a genetic marker for selection and/or evaluation of the cells, such as to assess in vivo survival or localization; genes to improve safety, for example, by making the cell susceptible to negative selection in vivo as described by Lupton S. D. et al., Mol. and Cell Biol., 11:6 (1991); and Riddell et al., Human Gene Therapy 3:319-338 (1992); see also the publications of
- compositions containing the chimeric receptor such as CAR or TCR
- compositions containing the engineered cells including pharmaceutical compositions and formulations.
- methods of using and uses of the compositions such as in the treatment of diseases, conditions, and disorders in which the antigen is expressed, or in detection, diagnostic, and prognostic methods.
- composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
- a "pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
- a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
- the choice of carrier is determined in part by the particular cell and/or by the method of administration. Accordingly, there are a variety of suitable
- the pharmaceutical composition can contain preservatives.
- Suitable preservatives may include, for example, methylparaben, propylparaben, sodium benzoate, and benzalkonium chloride.
- a mixture of two or more preservatives is used.
- the preservative or mixtures thereof are typically present in an amount of about 0.0001% to about 2% by weight of the total composition. Carriers are described, e.g., by Remington's
- Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins;
- hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other
- Suitable buffering agents include, for example, citric acid, sodium citrate, phosphoric acid, potassium phosphate, and various other acids and salts. In some aspects, a mixture of two or more buffering agents is used.
- the buffering agent or mixtures thereof are typically present in an amount of about 0.001% to about 4% by weight of the total composition.
- Methods for preparing administrable pharmaceutical compositions are known. Exemplary methods are described in more detail in, for example, Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins; 21st ed. (March 1, 2005).
- the formulation or composition may also contain more than one active ingredient useful for the particular indication, disease, or condition being treated with the cells, preferably those with activities complementary to the cell, where the respective activities do not adversely affect one another.
- active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
- the pharmaceutical composition further includes other pharmaceutically active agents or drugs, such as
- chemotherapeutic agents e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc.
- the cells or antibodies are administered in the form of a salt, e.g., a pharmaceutically acceptable salt.
- Suitable pharmaceutically acceptable acid addition salts include those derived from mineral acids, such as hydrochloric, hydrobromic, phosphoric, metaphosphoric, nitric, and sulphuric acids, and organic acids, such as tartaric, acetic, citric, malic, lactic, fumaric, benzoic, glycolic, gluconic, succinic, and aryl sulfonic acids, for example, p-toluenesulfonic acid.
- mineral acids such as hydrochloric, hydrobromic, phosphoric, metaphosphoric, nitric, and sulphuric acids
- organic acids such as tartaric, acetic, citric, malic, lactic, fumaric, benzoic, glycolic, gluconic, succinic, and aryl sulfonic acids, for example, p-toluenesulfonic acid.
- Active ingredients may be entrapped in microcapsules, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nanoparticles and nanocapsules) or in macroemulsions.
- the pharmaceutical composition is formulated as an inclusion complex, such as cyclodextrin inclusion complex, or as a liposome.
- Liposomes can serve to target the host cells (e.g., T-cells or NK cells) to a particular tissue. Many methods are available for preparing liposomes, such as those described in, for example, Szoka et al., Ann. Rev. Biophys. Bioeng., 9: 467 (1980), and U.S.
- compositions in some aspects can employ time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated.
- time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated.
- release delivery systems Many types are available and known. Such systems can avoid repeated
- the pharmaceutical composition in some embodiments contains immunomodulatory polypeptides and/or engineered cells in amounts effective to treat or prevent the disease or condition, such as a therapeutically effective or prophylactically effective amount.
- Therapeutic or prophylactic efficacy in some embodiments is monitored by periodic assessment of treated subjects. For repeated administrations over several days or longer, depending on the condition, the treatment is repeated until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful and can be determined.
- the desired dosage can be delivered by a single bolus administration of the composition, by multiple bolus administrations of the composition, or by continuous infusion administration of the composition.
- the immunomodulatory polypeptides and/or engineered cells may be administered using standard administration techniques, formulations, and/or devices. Provided are formulations and devices, such as syringes and vials, for storage and administration of the compositions. Administration of the engineered cells can be autologous or heterologous. For example, immunoresponsive cells or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject. Peripheral blood derived immunoresponsive cells or their progeny (e.g., in vivo, ex vivo or in vitro derived) can be administered via localized injection, including catheter administration, systemic injection, localized injection, intravenous injection, or parenteral administration. When administering a therapeutic composition (e.g., a pharmaceutical composition containing a genetically modified immunoresponsive cell), it will generally be formulated in a unit dosage injectable form
- Formulations include those for oral, intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration.
- the cell populations are administered parenterally.
- parenteral includes intravenous, intramuscular, subcutaneous, rectal, vaginal, and intraperitoneal administration.
- the cell populations are administered to a subject using peripheral systemic delivery by intravenous, intraperitoneal, or subcutaneous injection.
- compositions in some embodiments are provided as sterile liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may in some aspects be buffered to a selected pH.
- sterile liquid preparations e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may in some aspects be buffered to a selected pH.
- Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues.
- Liquid or viscous compositions can comprise carriers, which can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
- carriers can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
- Sterile injectable solutions can be prepared by incorporating the cells in a solvent, such as in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like.
- a suitable carrier such as sterile water, physiological saline, glucose, dextrose, or the like.
- the compositions can also be lyophilized.
- the compositions can contain auxiliary substances such as wetting, dispersing, or emulsifying agents (e.g., methylcellulose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired. Standard texts may in some aspects be consulted to prepare suitable preparations.
- compositions including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added.
- antimicrobial preservatives for example, parabens, chlorobutanol, phenol, sorbic acid, and the like.
- Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin.
- Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules. [0293]
- the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
- the immunomodulatory polypeptides, engineered cells, and compositions are administered to a subject or patient having the particular disease or condition to be treated, e.g., via adoptive cell therapy, such as adoptive T cell therapy.
- adoptive cell therapy such as adoptive T cell therapy.
- provided cells and compositions are administered to a subject, such as a subject having or at risk for the disease or condition.
- the methods thereby treat, e.g., ameliorate one or more symptom of, the disease or condition, such as by lessening tumor burden in a cancer expressing an antigen recognized by an engineered T cell.
- a "subject” is a mammal, such as a human or other animal, and typically is human. In some embodiments, the subject, e.g., patient, to whom the
- immunomodulatory polypeptides, engineered cells, or compositions are administered, is a mammal, typically a primate, such as a human.
- the primate is a monkey or an ape.
- the subject can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects.
- the subject is a non- primate mammal, such as a rodent.
- treatment refers to complete or partial amelioration or reduction of a disease or condition or disorder, or a symptom, adverse effect or outcome, or phenotype associated therewith.
- Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- the terms do not imply complete curing of a disease or complete elimination of any symptom or effect(s) on all symptoms or outcomes.
- delay development of a disease means to defer, hinder, slow, retard, stabilize, suppress and/or postpone development of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.
- Preventing includes providing prophylaxis with respect to the occurrence or recurrence of a disease in a subject that may be predisposed to the disease but has not yet been diagnosed with the disease.
- the provided cells and compositions are used to delay development of a disease or to slow the progression of a disease.
- a function or activity is to reduce the function or activity when compared to otherwise same conditions except for a condition or parameter of interest, or alternatively, as compared to another condition.
- cells that suppress tumor growth reduce the rate of growth of the tumor compared to the rate of growth of the tumor in the absence of the cells.
- an "effective amount" of an agent e.g., a pharmaceutical formulation, cells, or composition, in the context of administration, refers to an amount effective, at dosages/amounts and for periods of time necessary, to achieve a desired result, such as a therapeutic or
- a "therapeutically effective amount" of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result, such as for treatment of a disease, condition, or disorder, and/or pharmacokinetic or pharmacodynamic effect of the treatment.
- the therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the subject, and the immunomodulatory polypeptides or engineered cells administered.
- the provided methods involve administering the immunomodulatory polypeptides, engineered cells, or compositions at effective amounts, e.g., therapeutically effective amounts.
- a “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
- the disease or condition that is treated can be any in which expression of an antigen is associated with and/or involved in the etiology of a disease condition or disorder, e.g. causes, exacerbates or otherwise is involved in such disease, condition, or disorder.
- exemplary diseases and conditions can include diseases or conditions associated with malignancy or transformation of cells (e.g. cancer), autoimmune or inflammatory disease, or an infectious disease, e.g. caused by a bacterial, viral or other pathogen.
- Exemplary antigens which include antigens associated with various diseases and conditions that can be treated, are described above.
- the immunomodulatory polypeptide and/or recombinant receptor e.g., the chimeric antigen receptor or transgenic TCR, specifically binds to an antigen associated with the disease or condition.
- the disease or condition is a tumor, such as a solid tumor, lymphoma, leukemia, blood tumor, metastatic tumor, or other cancer or tumor type.
- the disease or condition is an infectious disease or condition, such as, but not limited to, viral, retroviral, bacterial, and protozoal infections,
- CMV Cytomegalovirus
- EBV Epstein-Barr virus
- adenovirus BK polyomavirus
- the disease or condition is an autoimmune or
- inflammatory disease or condition such as arthritis, e.g., rheumatoid arthritis (RA), Type I diabetes, systemic lupus erythematosus (SLE), inflammatory bowel disease, psoriasis, scleroderma, autoimmune thyroid disease, Grave's disease, Crohn's disease, multiple sclerosis, asthma, and/or a disease or condition associated with transplant.
- arthritis e.g., rheumatoid arthritis (RA), Type I diabetes, systemic lupus erythematosus (SLE), inflammatory bowel disease, psoriasis, scleroderma, autoimmune thyroid disease, Grave's disease, Crohn's disease, multiple sclerosis, asthma, and/or a disease or condition associated with transplant.
- RA rheumatoid arthritis
- SLE systemic lupus erythematosus
- bowel disease e.g., psoriasis,
- the antigen associated with the disease or disorder is selected from the group consisting of orphan tyrosine kinase receptor ROR1, tEGFR, Her2, Ll-CAM, CD 19, CD20, CD22, mesothelin, CEA, and hepatitis B surface antigen, anti-folate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, 0EPHa2, ErbB2, 3, or 4, FBP, fetal acetylcholine receptor, GD2, GD3, HMW-MAA, IL-22R- alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, LI -cell adhesion molecule, MAGE-A1, mesothelin, MUC1, MUC16, PSCA, NKG2D Ligands, NY-ESO-1, MART-1, gplOO, oncofetal antigen,
- the provided methods and uses include methods and uses for adoptive cell therapy.
- the methods include administration of the engineered cells or a composition containing the cells to a subject, tissue, or cell, such as one having, at risk for, or suspected of having the disease, condition or disorder.
- the cells, populations, and compositions are administered to a subject having the particular disease or condition to be treated, e.g., via adoptive cell therapy, such as adoptive T cell therapy.
- the cells or compositions are administered to the subject, such as a subject having or at risk for the disease or condition, ameliorate one or more symptom of the disease or condition.
- the cell therapy e.g., adoptive T cell therapy
- the cell therapy is carried out by autologous transfer, in which the cells are isolated and/or otherwise prepared from the subject who is to receive the cell therapy, or from a sample derived from such a subject.
- the cells are derived from a subject, e.g., patient, in need of a treatment and the cells, following isolation and processing are administered to the same subject.
- the cell therapy e.g., adoptive T cell therapy
- the cells are carried out by allogeneic transfer, in which the cells are isolated and/or otherwise prepared from a subject other than a subject who is to receive or who ultimately receives the cell therapy, e.g., a first subject.
- the cells then are administered to a different subject, e.g., a second subject, of the same species.
- the first and second subjects are genetically identical.
- the first and second subjects are genetically similar.
- the second subject expresses the same HLA class or super type as the first subject.
- the cells can be administered by any suitable means.
- the cells, or individual populations of sub-types of cells are administered to the subject at a range of about one million to about 100 billion cells and/or that amount of cells per kilogram of body weight, such as, e.g., 1 million to about 50 billion cells (e.g., about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, or a range defined by any two of the foregoing values), such as about 10 million to about 100 billion cells (e.g., about 20 million cells, about 30 million cells, about 40 million cells, about 60 million cells, about 70 million cells, about 80 million cells, about 90 million cells, about 10 billion cells, about 25 billion cells, about 50 billion cells, about 75 billion cells,
- 1 million to about 50 billion cells e.g., about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, or a range defined by any
- the dose includes fewer than about 1 x 10 total recombinant receptor (e.g., CAR)-expressing cells, T cells, or peripheral blood mononuclear cells (PBMCs), e.g., in the range of about 1 x 10 6 to 1 x 10 s such cells, such as 2 x 10 6 , 5 x 10 6 , 1 x 10 7 , 5 x 10 7 , or 1 x 10 s or total such cells, or the range between any two of the foregoing values.
- CAR total recombinant receptor
- PBMCs peripheral blood mononuclear cells
- the cells are administered as part of a combination treatment, such as simultaneously with or sequentially with, in any order, another therapeutic intervention, such as an antibody or engineered cell or receptor or agent, such as a cytotoxic or therapeutic agent.
- the cells in some embodiments are co-administered with one or more additional therapeutic agents or in connection with another therapeutic intervention, either simultaneously or sequentially in any order.
- the cells are co-administered with another therapy sufficiently close in time such that the cell populations enhance the effect of one or more additional therapeutic agents, or vice versa.
- the cells are administered prior to the one or more additional therapeutic agents.
- the cells are administered after the one or more additional therapeutic agents.
- the one or more additional agents include a cytokine, such as IL-2, for example, to enhance persistence.
- the methods comprise administration of a chemotherapeutic agent.
- the biological activity of the engineered cell populations in some embodiments is measured, e.g., by any of a number of known methods.
- Parameters to assess include specific binding of an engineered or natural T cell or other immune cell to antigen, in vivo, e.g., by imaging, or ex vivo, e.g., by ELISA or flow cytometry.
- the ability of the engineered cells to destroy target cells can be measured using any suitable method known in the art, such as cytotoxicity assays described in, for example, Kochenderfer et al., J. Immunotherapy, 32(7): 689-702 (2009), and Herman et al. J.
- the biological activity of the cells is measured by assaying expression and/or secretion of one or more cytokines, such as CD 107a, IFNy, IL-2, and TNF.
- the biological activity is measured by assessing clinical outcome, such as reduction in tumor burden or load.
- the engineered cells are further modified in any number of ways, such that their therapeutic or prophylactic efficacy is increased.
- the engineered CAR or TCR expressed by the population can be conjugated either directly or indirectly through a linker to a targeting moiety.
- the practice of conjugating compounds, e.g., the CAR or TCR, to targeting moieties is known in the art. See, for instance, Wadwa et al., J. Drug Targeting 3: 1 1 1 (1995), and U.S. Patent 5,087,616.
- composition refers to any mixture of two or more products, substances, or compounds, including cells. It may be a solution, a suspension, liquid, powder, a paste, aqueous, non-aqueous or any combination thereof.
- a statement that a cell or population of cells is "positive" for a particular marker refers to the detectable presence on or in the cell of a particular marker, typically a surface marker.
- a surface marker refers to the presence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is detectable by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control under otherwise identical conditions and/or at a level substantially similar to that for cell known to be positive for the marker, and/or at a level substantially higher than that for a cell known to be negative for the marker.
- a statement that a cell or population of cells is "negative" for a particular marker refers to the absence of substantial detectable presence on or in the cell of a particular marker, typically a surface marker.
- a surface marker refers to the absence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is not detected by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control under otherwise identical conditions, and/or at a level substantially lower than that for cell known to be positive for the marker, and/or at a level substantially similar as compared to that for a cell known to be negative for the marker.
- expression refers to the process by which a polypeptide is produced based on the encoding sequence of a nucleic acid molecule, such as a gene.
- the process may include transcription, post-transcriptional control, post-transcriptional modification, translation, post-translational control, post-translational modification, or any combination thereof.
- a subject includes any living organism, such as humans and other mammals. Mammals include, but are not limited to, humans, and non-human animals, including farm animals, sport animals, rodents and pets.
- a control refers to a sample that is substantially identical to the test sample, except that it is not treated with a test parameter, or, if it is a plasma sample, it can be from a normal volunteer not affected with the condition of interest.
- a control also can be an internal control.
- operably linked refers to the association of components, such as a DNA sequence, e.g. a heterologous nucleic acid) and a regulatory sequence(s), in such a way as to permit gene expression when the appropriate molecules (e.g. transcriptional activator proteins) are bound to the regulatory sequence.
- a DNA sequence e.g. a heterologous nucleic acid
- a regulatory sequence e.g. a promoter for transcription
- the components described are in a relationship permitting them to function in their intended manner.
- percent (%) sequence identity and “percent identity” when used with respect to a nucleotide sequence (reference nucleotide sequence) or amino acid sequence (reference amino acid sequence) is defined as the percentage of nucleotide residues or amino acid residues, respectively, in a candidate sequence that are identical with the residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software.
- vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
- the term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
- Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as "expression vectors.”
- viral vectors such as lentiviral vectors.
- An immunomodulatory polypeptide comprising:
- joining region connecting the first and second peptides, wherein the joining region comprises a targeting moiety that binds to a target molecule.
- An immunomodulatory polypeptide comprising:
- a second peptide comprising a second subunit of the cytokine or chemokine or a functional portion thereof; and c) a joining region connecting the first and second peptides, wherein the joining region comprises a targeting moiety that binds to a target molecule.
- cytokine or chemokine or subunit or functional portion thereof is selected from the group consisting of: IL-12, IL-15, IL-2, IL-18, GM-CSF, IL-7, IL-21, IFNa, IFNp, IFNy, IL-17, IL-23, IL-3, IL-4, IL-5, IL-6, IL-9, IL-11, IL-13, IL-27, Erythropoietin, G-CSF, Growth hormone, Prolactin, Oncostatin M, and Leukemia inhibitory factor or a subunit or functional portion thereof.
- An immunomodulatory polypeptide comprising:
- the immunomodulatory peptide of embodiment 18 or embodiment 19 wherein the p35 subunit comprises the sequence of amino acids set forth in SEQ ID NO: 10 or a sequence that has at least 95% sequence identity thereto and/or the p40 subunit comprises the sequence of amino acids set forth in SEQ ID NO: 11 or a sequence that has at least 95% sequence identity thereto.
- hepatocyte growth factor HGF
- HGFR hepatocyte growth factor receptor
- VEGF VEGF-A
- VEGFR2 hepatocyte growth factor receptor
- HER2 heparin
- VEGF-A hepatocyte growth factor receptor
- VEGFR2 hepatocyte growth factor receptor
- HER2 heparin
- VEGF-A hepatocyte growth factor receptor
- VEGFR2 hepatocyte growth factor receptor
- HER2 heparin
- VEGF VEGF-A
- VEGFR2 VEGF-A
- VEGFR2 VEGF-A
- CTLA-4 LAG3, PD-L1, EGFR
- EPCAM RANKL
- NG2 RANKL
- proteoglycan CD20, CD52, CD19, CD3, CD30, IL-6, CD38, SLAMF7, GD2, CD13, CD274, CD279, CD40L, and CD47.
- the immunomodulatory polypeptide of any of embodiments 1-31, wherein the targeting moiety comprises from about 3 to about 300 amino acids, about 3 to about 100 amino acids, about 3 to about 20 amino acids, about 6 to about 20 amino acids, or about 10 amino acids.
- VH variable heavy
- VL variable light chain of an antibody selected from the group consisting of: trastuzumab, pertuzumab, ramucirumab, atezolizuma
- the immunomodulatory polypeptide of any of embodiments 1-40, wherein the targeting moiety comprises the sequence set forth in SEQ ID NO: 17, 24 or 25, or a sequence that has at least 95% sequence identity to SEQ ID NO: 17, 24 or 25 and binds to the target molecule.
- HBP heparin binding peptide
- a hepatocyte growth factor (HGF) binding peptide a hepatocyte growth factor (HGF) binding peptide, a VEGF binding peptide, a VEGF-A binding peptide, a VEGFR2 binding peptide, an EPCAM binding peptide, a HER2 binding peptide, a PD-1 binding peptide, a tenascin-C binding peptide, a CTLA-4 binding peptide, a LAG3 binding peptide, a PD-L1 binding peptide, a EGFR binding peptide, a RANKL binding peptide, a CD20 binding peptide, a CD52 binding peptide, a CD 19 binding peptide, a CD3 binding peptide, a CD30 binding peptide, a IL-6 binding peptide, a CD38 binding peptide, a SLAMF7 binding peptide
- the targeting moiety comprises the sequence set forth in any of SEQ ID NOs: 13, 14, 15, 16, 26, 27 or 28, or a sequence that has at least 95% sequence identity to any of SEQ ID NOs: 13, 14, 15, 16, 26, 27 or 28 and binds to the target molecule.
- immunomodulatory polypeptide of embodiment 50 wherein the reference IL-12 does not comprise a joining region or comprises a joining region that consists of the sequence set forth in any one of SEQ ID NOs 7-9.
- immunomodulatory polypeptide of any of embodiments 1-51 wherein the immunomodulatory polypeptide exhibits increased binding to a target cell expressing the target molecule as compared with its binding to a cell not expressing the target molecule.
- K D equilibrium dissociation constant
- immunomodulatory polypeptide of any of embodiments 1-54 wherein, the immunomodulatory polypeptide binds the one or more cognate receptor(s) with a K D that is at or about or less than at or about 100, 50, 40, 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0.5, or 0.1 nM; or
- nM 100 picomolar (pM), 90 pM, 80 pM, 70 pM, 60 pM, 50 pM, 40 pM, 30 pM, 25 pM, 20 pM, 15 pM, 10 pM, or 1 pM.
- polynucleotide of embodiment 59, wherein the signal peptide comprises the sequence set forth in SEQ ID NO: 18, or a sequence that has at least 95% sequence identity to such a sequence.
- immunomodulatory polypeptide is inducible or conditional.
- polynucleotide of embodiment 61 or 62, wherein the promoter, enhancer or transactivator is a T cell activation factor.
- T cell transcription factor is nuclear factor of activated T-cells (NFAT), C/EBP, STAT1, STAT2, and/or NFKB.
- the polynucleotide of embodiment 67 or 68, wherein the one or more conditions present in the tumor microenvironment is hypoxia.
- hypoxia response element comprises the sequence 5'-(A/G)CGT(G/C)(G/C)-3'.
- Epo erythropoietin
- VEGF-A VEGF-A
- PGK1 phosphoglycerate kinase 1
- LDH A lactate dehydrogenase A
- ALDA aldolase A
- GPDH glyceraldehyde 3-phosphate dehydrogenase
- the polynucleotide of embodiment 67 or 68, wherein the one or more conditions present in the tumor micorenvironment is low glucose.
- the radiation- inducible promoter is a synthetic promoter that comprises the any of the sequences set forth in SEQ ID NOs 92-95.
- thermo shock element HSE
- thermo shock promoter HSP
- the polynucleotide of embodiment 66 or embodiment 87, wherein the inducible promoter, enhancer, or transactivator comprises a Lac operator sequence, a tetracycline operator sequence, a galactose operator sequence or a doxycycline operator sequence, a rapamycin operator sequence, a tamoxifen operator sequence, or a hormone -responsive operator sequence, or an analog thereof.
- TRE tetracycline response element
- the polynucleotide of embodiment 87, wherein the drug-inducible promoter, enhancer, or transactivator comprises a multidrug resistance (mdrl) gene promoter.
- polynucleotide of any of embodiments 57-90 comprising a first nucleic acid sequence encoding the immunomodulatory polypeptide and a second nucleic acid sequence encoding a recombinant receptor.
- CAR chimeric antigen receptor
- polynucleotide of any of embodiments 92-94 further comprising an internal ribosome entry site (IRES) or a nucleic acid sequence encoding a linking peptide between the first and second nucleic acid sequences, wherein the linking peptide separates the translation products of the first and second nucleic acid sequences during or after translation.
- IRS internal ribosome entry site
- linking peptide comprises a self-cleaving peptide, or a peptide that causes ribosome skipping, optionally a T2A peptide.
- a vector comprising the polynucleotide of any of embodiments 57-98.
- the vector of embodiment 99 that is a viral vector.
- invention 101 The vector of embodiment 99 or embodiment 100 that is a retroviral vector.
- the vector of any of embodiments 99-101 that is a lentiviral vector or a gammaretroviral vector.
- An engineered cell comprising the polynucleotide of any of embodiments 57-98.
- An engineered cell comprising the vector of any of embodiments 99-102.
- the engineered cell of embodiment 108, wherein the disease or disorder is an infectious disease or disorder, an autoimmune disease, an inflammatory disease, or a tumor or a cancer.
- the target antigen is a tumor antigen.
- immunomodulatory protein is not immunogenic and/or does not induce an immune response in a subject in which it is administered.
- the intracellular signaling domain is or comprises a primary signaling domain, a signaling domain that is capable of inducing a primary activation signal in a T cell, a signaling domains of a T cell receptor (TCR) component, and/or a signaling domain comprising an immunoreceptor tyro sine-based activation motif ( ⁇ ).
- TCR T cell receptor
- the intracellular signaling domain is or comprises an intracellular signaling domain of a CD3 chain, optionally a CD3-zeta ( ⁇ )3 ⁇ ) chain, or a signaling portion thereof.
- the costimulatory signaling domain comprises an intracellular signaling domain of a T cell costimulatory molecule or a signaling portion thereof.
- the engineered cell of any of embodiments 103-130 that is a CD8+ T cell or a CD4+ T cell.
- composition comprising the immunomodulatory polypeptide of any of embodiments 1-56.
- composition comprising the engineered cell of any of embodiments 103-137.
- composition of embodiment 138 or embodiment 139 further comprising a pharmaceutically acceptable excipient.
- a method of treatment comprising administering the immunomodulatory polypeptide of any of embodiments 1-56 the engineered cell of any of embodiments 103-137, or the composition of any of embodiments 138-140 to a subject having a disease or disorder.
- Single chain IL-12 (scIL-12) immunomodulatory polypeptides were designed that included one or more targeting moieties that specifically bind to a particular target molecule or motif, for example, for use in targeting, localizing, or orienting the polypeptide in or near or in a particular orientation with respect to a cell expressing the target molecule or motif.
- constructs were synthesized as single-chain sequences encoding the p35 subunit (set forth in SEQ ID NO: 10) and p40 subunit (set forth in SEQ ID NO: 11) of IL-12 joined by a polypeptide linker containing the targeting moiety and, optionally, one or more G4S(3) peptide linkers (SEQ ID NO:7) joining the targeting moiety to the IL-12 subunits.
- Table 3 sets forth the sequences of exemplary IL-12 immunomodulatory
- polypeptides containing various targeting moieties derived from either: a heparin binding peptide of BMP4 (HBP BMP4; SEQ ID NO: 13), a heparin binding peptide of fibronectin (HBP FBN, SEQ ID NO: 14), a hepatocyte growth factor binding peptide (HGFBP, SEQ ID NO: 15), an epidermal growth factor receptor binding peptide (EGFRBP; SEQ ID NO: 16) or an anti- EPCAM scFv antibody (SEQ ID NO: 17).
- HBP BMP4 heparin binding peptide of BMP4
- HBP FBN heparin binding peptide of fibronectin
- HGFBP hepatocyte growth factor binding peptide
- EGFRBP epidermal growth factor receptor binding peptide
- anti- EPCAM scFv antibody SEQ ID NO: 17
- Each sequence also was designed to encode an N-terminal signal sequence derived from CD33 (MPLLLLLPLLWAGALAM, SEQ ID NO: 18) for secretion of the immunomodulatory protein when expressed in a cell.
- MPLLLLLPLLWAGALAM SEQ ID NO: 18
- one or more tags were included at the C-terminus (e.g. 6x His-tag, SEQ ID NO:20 or Strep-tag® II, SEQ ID NO:21).
- Table 3 Exemplary IL-12 Immunomodulatory Polypeptides
- HBP BMP4 EVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGI
- IL-12 immunomodulatory polypeptides scIL-12-HBP FBN (SEQ ID NO: 1).
- scIL-12-EGFRBP SEQ ID NO:5
- IL-12R IL-12 receptor
- scIL-12 SEQ ID NO: l
- rHuIL-12 rHuIL-12
- PBMCs Peripheral blood mononuclear cells
- PHA phytohemagglutinin
- IL-12R IL-12 receptor
- a dose-dependent increase in IFNy and GM-CSF was observed following stimulation of the PHA blasts with the IL-12 immunomodulatory polypeptides or controls.
- PHA blasts treated with the test polypeptides scIL-12- HBP FBN and scIL-12-EGFRBP as well as the scIL-12 control polypeptide displayed similar levels of IFNy and GM-CSF as those treated with rHuIL-12 across the various concentrations.
- the levels of IFNy and GM-CSF were substantially higher in PHA blasts stimulated with each of the single chain polypeptides (scIL-12-HBP FBN, scIL-12-EGFRBP or sc IL-12 G4S(3) polypeptides) compared to PHA blasts stimulated with rHuIL-12.
- T cells were isolated by immunoaffinity-based enrichment from three human donor subjects and cells from each donor were activated and transduced with a viral vector encoding an anti-CD 19 CAR.
- the CAR contained an anti-CD 19 scFv, an Ig-derived spacer, a human CD28-derived transmembrane domain, a human 4-lBB-derived intracellular signaling domain and a human CD3 zeta-derived signaling domain.
- CD19-expressing target cells K562 cells transduced to express CD 19, K562-CD19
- 20,000 cells per well in triplicate in a 96-well poly- D-lysine-coated plate were incubated with the various CAR-expressing T cells (at various effectontarget ratios (5: 1, 2.5: 1, 1: 1), alone or in the presence of the exemplary scIL-12-HBP FBN (SEQ ID NO:3) immunomodulatory polypeptide described in Example 1 (either at 0.5 ng/mL or 5 ng/mL).
- Incubation in the presence of target cells without the scIL2 was used as an "untreated" control.
- CD19-expressing K562-CD19 target cells were co-cultured with anti-CD 19-CAR- expressing T cells at various E:T ratios including 5: 1, 2.5: 1 and 1: 1 as described in Example 3.
- the co-cultures were incubated in the presence of scIL-12-HBP FBN (SEQ ID NO:3) as described in Example 1 at 0.5 or 5 ng/mL or were left untreated.
- Cell lysis was monitored in real-time over a 0 to about 110-hour time course by adding an IncuCyteTM fluorescent Caspase 3/7 Reagent to the co-cultures to detect cells apoptotic cells.
- Target cell death was quantitated by automated image analysis over time. The area under the curve (AUC) of fluorescent signal over time for each concentration was determined.
- a killing index was determined using the formula: 1/AUC.
- Fig. 3 sets forth the killing index for each tested condition. As shown in Fig. 3, stimulation of cells in the presence of scIL-12-HBP FBN polypeptides enhanced T cell killing of target cells at all of the E:T ratios as compared to the control, untreated cells.
- scIL-12 single chain IL-12 immunomodulatory polypeptides
- scIL-12- G4S SEQ ID NO: l
- scIL-12-HBP FBN SEQ ID NO:3
- scIL-12-EGFRBP SEQ ID NO:5
- IL-12Rb beta subunit of the IL-12 Receptor
- RORl-Fc was also assessed for binding to IL-12Rb as a negative control.
- An anti-hlgG capture chip was used to immobilize IL- 12Rb-hIgGl Fc (purchased from R&D Systems).
- Exemplary scIL-12 immunomodulatory polypeptides described in Example 1 are detectably labeled and incubated with target cells known to (or engineered to) express exemplary target molecules (including heparin, EGFR or HGFR), individually capable of being bound by the targeting moiety contained within a given one of the scIL-12 immunomodulatory polypeptides.
- the cells also are incubated with control scIL-12 not containing the respective targeting moiety and/or rhIL-12, and/or the scIL-12 containing the targeting moiety is incubated in the presence of cells that do not express the target molecule or motif thereof recognized by the targeting moiety, or do so at lower levels.
- Binding is assessed by flow cytometry or other methods as appropriate, and compared between the different conditions; in some aspects, increased binding in the condition involving scIL-12 with a targeting moiety as compared to one or more of the controls, indicates specificity of the engineered single-chain IL-12 reagent for target molecules or motifs recognized by the targeting moiety, further supporting the utility of the scIL-12 in a disease, condition or environment in which the target is or is suspected of being expressed or
- n 1 to 5
- LNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTI Propeptide amino SVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFE acids 1-36
- VPGGS SP A WTQCQQLS QKLCTLA WS AHPLVGHMDLREEGDEETTND IL-23 alpha (pi 9) VPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPD SPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSL QAFVAVAARVFAHGAATLSP
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Cell Biology (AREA)
- Endocrinology (AREA)
- Biomedical Technology (AREA)
- Public Health (AREA)
- Biotechnology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Wood Science & Technology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Transplantation (AREA)
- Physics & Mathematics (AREA)
- Epidemiology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2019001185A MX2019001185A (es) | 2016-07-29 | 2017-07-28 | Polipeptidos inmunomoduladores y composiciones y metodos relacionados. |
| CA3031955A CA3031955A1 (en) | 2016-07-29 | 2017-07-28 | Immunomodulatory polypeptides and related compositions and methods |
| JP2019504812A JP7295795B2 (ja) | 2016-07-29 | 2017-07-28 | 免疫調節ポリペプチドならびに関連する組成物および方法 |
| AU2017301880A AU2017301880C1 (en) | 2016-07-29 | 2017-07-28 | Immunomodulatory polypeptides and related compositions and methods |
| CN201780058404.8A CN110087672A (zh) | 2016-07-29 | 2017-07-28 | 免疫调节多肽及相关组合物和方法 |
| US16/320,075 US12304935B2 (en) | 2016-07-29 | 2017-07-28 | Immunomodulatory polypeptides and related compositions and methods |
| EP17752521.9A EP3490585B1 (en) | 2016-07-29 | 2017-07-28 | Immunomodulatory polypeptides and related compositions and methods |
| ES17752521T ES2951552T3 (es) | 2016-07-29 | 2017-07-28 | Polipéptidos inmunomoduladores y composiciones y métodos relacionados |
| JP2023024001A JP2023062104A (ja) | 2016-07-29 | 2023-02-20 | 免疫調節ポリペプチドならびに関連する組成物および方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662369017P | 2016-07-29 | 2016-07-29 | |
| US62/369,017 | 2016-07-29 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018023093A1 true WO2018023093A1 (en) | 2018-02-01 |
Family
ID=59631857
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/044549 Ceased WO2018023093A1 (en) | 2016-07-29 | 2017-07-28 | Immunomodulatory polypeptides and related compositions and methods |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US12304935B2 (https=) |
| EP (1) | EP3490585B1 (https=) |
| JP (2) | JP7295795B2 (https=) |
| CN (1) | CN110087672A (https=) |
| AU (1) | AU2017301880C1 (https=) |
| CA (1) | CA3031955A1 (https=) |
| ES (1) | ES2951552T3 (https=) |
| MA (1) | MA45779A (https=) |
| MX (1) | MX2019001185A (https=) |
| WO (1) | WO2018023093A1 (https=) |
Cited By (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109306016A (zh) * | 2018-08-15 | 2019-02-05 | 华东师范大学 | 共表达细胞因子il-7的nkg2d-car-t细胞及其用途 |
| CN112294760A (zh) * | 2019-07-26 | 2021-02-02 | 张晋宇 | 一种液体制剂及其应用 |
| WO2021081345A1 (en) * | 2019-10-25 | 2021-04-29 | Mayo Foundation For Medical Education And Research | Bi-peptide with affinity to extracellular matrix proteins or cells and to growth factors for tissue healing and regeneration |
| CN112888786A (zh) * | 2018-09-07 | 2021-06-01 | Sotio有限责任公司 | 与调节细胞内乳酸浓度的反式代谢分子组合的嵌合受体多肽及其治疗用途 |
| WO2021115333A1 (zh) * | 2019-12-10 | 2021-06-17 | 苏州克睿基因生物科技有限公司 | 一种融合蛋白及表达此蛋白的工程化免疫细胞及其应用 |
| EP3765487A4 (en) * | 2018-03-14 | 2022-01-05 | Seattle Children's Hospital (DBA Seattle Children's Research Institute) | IL-13REZEPTOR-ALPHA 2 T-CELL IMMUNOTHERAPY TARGETED AGAINST ZETAKIN |
| JP2022524461A (ja) * | 2019-03-12 | 2022-05-02 | 重▲慶▼精准生物技▲術▼有限公司 | 低酸素調節プロモーター及びその応用 |
| US11319380B2 (en) | 2018-06-04 | 2022-05-03 | Precigen, Inc. | MUC16 specific chimeric antigen receptors and uses thereof |
| US11446398B2 (en) | 2016-04-11 | 2022-09-20 | Obsidian Therapeutics, Inc. | Regulated biocircuit systems |
| US11512122B2 (en) | 2019-05-17 | 2022-11-29 | Xencor, Inc. | IL-7-FC-fusion proteins |
| WO2023086772A1 (en) | 2021-11-12 | 2023-05-19 | Xencor, Inc. | Bispecific antibodies that bind to b7h3 and nkg2d |
| EP3964533A4 (en) * | 2019-04-27 | 2023-08-09 | Jinyu Zhang | PROTEIN HETERODIMER AND USE THEREOF |
| EP4096670A4 (en) * | 2020-01-30 | 2024-02-28 | Purdue Research Foundation | LIGAND-MEDIATED DELIVERY OF THERAPEUTIC PROTEINS AND THEIR USES |
| WO2024102636A1 (en) | 2022-11-07 | 2024-05-16 | Xencor, Inc. | Bispecific antibodies that bind to b7h3 and mica/b |
| US12091440B2 (en) | 2019-12-20 | 2024-09-17 | Regeneron Pharmaceuticals, Inc. | IL2 and peptide-MHC complex fusion proteins and methods of use thereof |
| US12152079B2 (en) | 2018-03-14 | 2024-11-26 | Seattle Children's Research Institute | Nucleic acids encoding IL-13 receptor alpha 2 (IL13Ra2) chimeric antigen receptor for tumor specific T cell immunotherapy |
| US12275796B2 (en) | 2019-12-03 | 2025-04-15 | Evotec International Gmbh | Interferon-associated antigen binding proteins and uses thereof |
| WO2025085672A1 (en) | 2023-10-17 | 2025-04-24 | Xencor, Inc. | Bispecific antibodies that bind to nkp46 and mica/b |
| US12304935B2 (en) | 2016-07-29 | 2025-05-20 | Juno Therapeutics, Inc. | Immunomodulatory polypeptides and related compositions and methods |
| WO2025129120A3 (en) * | 2023-12-15 | 2025-07-24 | Port Therapeutics, Inc. | Use of thermal bioswitches for treating autoimmune diseases |
| WO2025176860A1 (en) | 2024-02-23 | 2025-08-28 | Charité - Universitätsmedizin Berlin Körperschaft des öffentlichen Rechts | Dual chimeric antigen receptor construct targeting cea and epcam |
| US12522638B2 (en) | 2021-07-19 | 2026-01-13 | Regeneron Pharmaceuticals, Inc. | IL12 receptor agonists and methods of use thereof |
Families Citing this family (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2020530280A (ja) | 2017-07-03 | 2020-10-22 | トルク セラピューティクス, インコーポレイテッド | 免疫刺激性融合分子およびその使用 |
| WO2019222296A1 (en) * | 2018-05-14 | 2019-11-21 | Werewolf Therapeutics, Inc. | Activatable interleukin 12 polypeptides and methods of use thereof |
| CN111153961B (zh) * | 2020-01-08 | 2022-02-18 | 郑州大学 | 一种亲和pd-1的肽及其应用 |
| CN111533785B (zh) * | 2020-02-11 | 2022-03-08 | 北京市肿瘤防治研究所 | 靶向免疫检查点tim3结合肽及其应用 |
| WO2021163874A1 (zh) * | 2020-02-18 | 2021-08-26 | 苏州工业园区唯可达生物科技有限公司 | 一种重组病毒载体、包含其的免疫组合物以及用途 |
| EP4146798A4 (en) * | 2020-05-04 | 2025-02-12 | Saliogen Therapeutics, Inc. | TRANSPOSITION-BASED THERAPIES |
| CN112063588A (zh) * | 2020-08-13 | 2020-12-11 | 南京北恒生物科技有限公司 | 工程化免疫细胞及其用途 |
| US20230364210A1 (en) * | 2020-09-17 | 2023-11-16 | Othair Prothena Limited | ß-AMYLOID VACCINE FOR THE TREATMENT OF ALZHEIMER’S DISEASE |
| US12234473B2 (en) | 2020-12-31 | 2025-02-25 | Immatics US, Inc. | CD8 polypeptides, compositions, and methods of using thereof |
| CN118146395A (zh) * | 2021-02-08 | 2024-06-07 | 浙江大学 | 一种以内源性蛋白质分子替代单结构域抗体的嵌合抗原受体 |
| CN115029317B (zh) * | 2021-02-23 | 2025-10-28 | 赛浦生物科技(长春)有限公司 | 用于过敏性鼻炎的鼻喷雾剂及制备方法 |
| JP2024530215A (ja) * | 2021-08-13 | 2024-08-16 | 上海▲シン▼湾生物科技有限公司 | 低酸素トリガーの人工転写因子、転写制御システム及びその応用 |
| US20230103980A1 (en) * | 2021-10-04 | 2023-04-06 | California Institute Of Technology | Thermal state switches in macrophages |
| US20250195658A1 (en) * | 2022-01-12 | 2025-06-19 | St. Jude Children's Research Hospital, Inc. | Bispecific chimeric antigen receptors targeting grp78 and cd123 or grp78 and b7h3 |
| CN117986386B (zh) * | 2024-02-06 | 2024-11-29 | 康立泰生物医药(青岛)有限公司 | 重组人白细胞介素-35及其制备方法和应用 |
Citations (49)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4452773A (en) | 1982-04-05 | 1984-06-05 | Canadian Patents And Development Limited | Magnetic iron-dextran microspheres |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4690915A (en) | 1985-08-08 | 1987-09-01 | The United States Of America As Represented By The Department Of Health And Human Services | Adoptive immunotherapy as a treatment modality in humans |
| US4795698A (en) | 1985-10-04 | 1989-01-03 | Immunicon Corporation | Magnetic-polymer particles |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US5019369A (en) | 1984-10-22 | 1991-05-28 | Vestar, Inc. | Method of targeting tumors in humans |
| US5087616A (en) | 1986-08-07 | 1992-02-11 | Battelle Memorial Institute | Cytotoxic drug conjugates and their delivery to tumor cells |
| US5200084A (en) | 1990-09-26 | 1993-04-06 | Immunicon Corporation | Apparatus and methods for magnetic separation |
| US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
| EP0452342B1 (en) | 1988-12-28 | 1994-11-30 | MILTENYI, Stefan | Methods and materials for high gradient magnetic separation of biological materials |
| WO2000014257A1 (en) | 1998-09-04 | 2000-03-16 | Sloan-Kettering Institute For Cancer Research | Fusion receptors specific for prostate-specific membrane antigen and uses thereof |
| US6040177A (en) | 1994-08-31 | 2000-03-21 | Fred Hutchinson Cancer Research Center | High efficiency transduction of T lymphocytes using rapid expansion methods ("REM") |
| US6060273A (en) | 1992-08-27 | 2000-05-09 | Beiersdorf Ag | Multicistronic expression units and their use |
| WO2001010912A1 (en) * | 1999-08-09 | 2001-02-15 | Lexigen Pharmaceuticals Corp. | Multiple cytokine-antibody complexes |
| US6207453B1 (en) | 1996-03-06 | 2001-03-27 | Medigene Ag | Recombinant AAV vector-based transduction system and use of same |
| US6410319B1 (en) | 1998-10-20 | 2002-06-25 | City Of Hope | CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies |
| US6451995B1 (en) | 1996-03-20 | 2002-09-17 | Sloan-Kettering Institute For Cancer Research | Single chain FV polynucleotide or peptide constructs of anti-ganglioside GD2 antibodies, cells expressing same and related methods |
| US20020131960A1 (en) | 2000-06-02 | 2002-09-19 | Michel Sadelain | Artificial antigen presenting cells and methods of use thereof |
| US20020150914A1 (en) | 1995-06-30 | 2002-10-17 | Kobenhavns Universitet | Recombinant antibodies from a phage display library, directed against a peptide-MHC complex |
| US20030170238A1 (en) | 2002-03-07 | 2003-09-11 | Gruenberg Micheal L. | Re-activated T-cells for adoptive immunotherapy |
| EP1418184A1 (en) * | 2002-11-08 | 2004-05-12 | Cell Center Cologne GmbH | Recombinant fusion protein consisting of the p40 and p35 subunits of IL-12 and a ScFv and use thereof |
| US7070995B2 (en) | 2001-04-11 | 2006-07-04 | City Of Hope | CE7-specific redirected immune cells |
| US20070116690A1 (en) | 2001-12-10 | 2007-05-24 | Lili Yang | Method for the generation of antigen-specific lymphocytes |
| US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
| US7446179B2 (en) | 2000-11-07 | 2008-11-04 | City Of Hope | CD19-specific chimeric T cell receptor |
| WO2009072003A2 (en) | 2007-12-07 | 2009-06-11 | Miltenyi Biotec Gmbh | Sample processing system and methods |
| WO2010033140A2 (en) | 2008-05-06 | 2010-03-25 | Innovative Micro Technology | Removable/disposable apparatus for mems particle sorting device |
| US20100178276A1 (en) | 2007-03-30 | 2010-07-15 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred t lymphocytes |
| WO2011112935A2 (en) * | 2010-03-12 | 2011-09-15 | The Regents Of The University Of California | Antibody fusion proteins with disrupted heparin-binding activity |
| US8188220B2 (en) | 2006-12-06 | 2012-05-29 | Sanford-Burnham Medical Research Institute | Methods and compositions related to targeting wounds, regenerating tissue, and tumors |
| WO2012129514A1 (en) | 2011-03-23 | 2012-09-27 | Fred Hutchinson Cancer Research Center | Method and compositions for cellular immunotherapy |
| US8324353B2 (en) | 2001-04-30 | 2012-12-04 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
| US8339645B2 (en) | 2008-05-27 | 2012-12-25 | Canon Kabushiki Kaisha | Managing apparatus, image processing apparatus, and processing method for the same, wherein a first user stores a temporary object having attribute information specified but not partial-area data, at a later time an object is received from a second user that includes both partial-area data and attribute information, the storage unit is searched for the temporary object that matches attribute information of the received object, and the first user is notified in response to a match |
| US8398282B2 (en) | 2011-05-12 | 2013-03-19 | Delphi Technologies, Inc. | Vehicle front lighting assembly and systems having a variable tint electrowetting element |
| WO2013071154A1 (en) | 2011-11-11 | 2013-05-16 | Fred Hutchinson Cancer Research Center | Cyclin a1-targeted t-cell immunotherapy for cancer |
| US20130149337A1 (en) | 2003-03-11 | 2013-06-13 | City Of Hope | Method of controlling administration of cancer antigen |
| US8479118B2 (en) | 2007-12-10 | 2013-07-02 | Microsoft Corporation | Switching search providers within a browser search box |
| WO2013123061A1 (en) | 2012-02-13 | 2013-08-22 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | Bispecific chimeric antigen receptors and therapeutic uses thereof |
| WO2013126726A1 (en) | 2012-02-22 | 2013-08-29 | The Trustees Of The University Of Pennsylvania | Double transgenic t cells comprising a car and a tcr and their methods of use |
| US20130287748A1 (en) | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| WO2013166321A1 (en) | 2012-05-03 | 2013-11-07 | Fred Hutchinson Cancer Research Center | Enhanced affinity t cell receptors and methods for making the same |
| WO2014031687A1 (en) | 2012-08-20 | 2014-02-27 | Jensen, Michael | Method and compositions for cellular immunotherapy |
| WO2014055668A1 (en) | 2012-10-02 | 2014-04-10 | Memorial Sloan-Kettering Cancer Center | Compositions and methods for immunotherapy |
| WO2014139468A1 (en) * | 2013-03-15 | 2014-09-18 | Admark Healthcare, Llc | Fusion protein molecules and method of use |
| US20140294841A1 (en) | 2011-04-01 | 2014-10-02 | Eureka Therapeutics, Inc. | T cell receptor-like antibodies specific for a wti peptide presented by hla-a2 |
| US9108442B2 (en) | 2013-08-20 | 2015-08-18 | Ricoh Company, Ltd. | Image forming apparatus |
| US20160045551A1 (en) | 2013-02-26 | 2016-02-18 | Memorial Sloan-Kettering Cancer Center | Compositions and methods for immunotherapy |
| US9405601B2 (en) | 2012-12-20 | 2016-08-02 | Mitsubishi Electric Corporation | In-vehicle apparatus and program |
Family Cites Families (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IE913929A1 (en) | 1990-11-13 | 1992-05-20 | Immunex Corp | Bifunctional selectable fusion genes |
| AU6953394A (en) | 1993-05-21 | 1994-12-20 | Targeted Genetics Corporation | Bifunctional selectable fusion genes based on the cytosine deaminase (cd) gene |
| US5891680A (en) | 1995-02-08 | 1999-04-06 | Whitehead Institute For Biomedical Research | Bioactive fusion proteins comprising the p35 and p40 subunits of IL-12 |
| US6653105B2 (en) | 1998-02-11 | 2003-11-25 | Vitagen, Inc. | Clonal cells and cell lines derived from C3A cells and methods of making and using them |
| AU3958101A (en) | 2000-03-15 | 2001-09-24 | Univ Pohang | Genes of il-12p40 subunit mutated for improving the activity of il-12 and use thereof for dna vaccine adjuvant |
| EP1268795A2 (en) | 2000-03-24 | 2003-01-02 | Bayer Aktiengesellschaft | Regulation of human mas oncogene-related g protein-coupled receptor |
| GB0228465D0 (en) | 2002-12-06 | 2003-01-08 | Univ Belfast | A method of treating disease |
| CA2607954A1 (en) | 2005-05-11 | 2006-11-16 | Philogen S.P.A. | Conjugate for targeting of drug |
| PL1966238T3 (pl) * | 2005-12-30 | 2012-09-28 | Merck Patent Gmbh | Warianty interleukiny-12p40 o polepszonej stabilności |
| US7833754B2 (en) | 2006-01-13 | 2010-11-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | IL-12 for expression in mammalian cell |
| WO2008079973A2 (en) * | 2006-12-21 | 2008-07-03 | Centocor, Inc. | Egfr binding peptides and uses thereof |
| WO2008134879A1 (en) | 2007-05-04 | 2008-11-13 | University Health Network | Il-12 immunotherapy for cancer |
| US8715964B2 (en) | 2008-05-11 | 2014-05-06 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Expression of IL-12 family heterodimers |
| WO2010126766A1 (en) | 2009-04-30 | 2010-11-04 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Inducible interleukin-12 |
| ES2872964T3 (es) | 2011-07-27 | 2021-11-03 | Philogen Spa | Inmunoconjugado de IL-12 |
| EP3326467B1 (en) | 2011-09-16 | 2020-03-11 | Baylor College of Medicine | Targeting the tumor microenvironment using manipulated nkt cells |
| WO2014183066A2 (en) * | 2013-05-10 | 2014-11-13 | Whitehead Institute For Biomedical Research | Protein modification of living cells using sortase |
| US12304935B2 (en) | 2016-07-29 | 2025-05-20 | Juno Therapeutics, Inc. | Immunomodulatory polypeptides and related compositions and methods |
-
2017
- 2017-07-28 US US16/320,075 patent/US12304935B2/en active Active
- 2017-07-28 MX MX2019001185A patent/MX2019001185A/es unknown
- 2017-07-28 WO PCT/US2017/044549 patent/WO2018023093A1/en not_active Ceased
- 2017-07-28 MA MA045779A patent/MA45779A/fr unknown
- 2017-07-28 CA CA3031955A patent/CA3031955A1/en active Pending
- 2017-07-28 EP EP17752521.9A patent/EP3490585B1/en active Active
- 2017-07-28 JP JP2019504812A patent/JP7295795B2/ja active Active
- 2017-07-28 AU AU2017301880A patent/AU2017301880C1/en not_active Ceased
- 2017-07-28 CN CN201780058404.8A patent/CN110087672A/zh active Pending
- 2017-07-28 ES ES17752521T patent/ES2951552T3/es active Active
-
2023
- 2023-02-20 JP JP2023024001A patent/JP2023062104A/ja active Pending
Patent Citations (55)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4452773A (en) | 1982-04-05 | 1984-06-05 | Canadian Patents And Development Limited | Magnetic iron-dextran microspheres |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US5019369A (en) | 1984-10-22 | 1991-05-28 | Vestar, Inc. | Method of targeting tumors in humans |
| US4690915A (en) | 1985-08-08 | 1987-09-01 | The United States Of America As Represented By The Department Of Health And Human Services | Adoptive immunotherapy as a treatment modality in humans |
| US4795698A (en) | 1985-10-04 | 1989-01-03 | Immunicon Corporation | Magnetic-polymer particles |
| US5087616A (en) | 1986-08-07 | 1992-02-11 | Battelle Memorial Institute | Cytotoxic drug conjugates and their delivery to tumor cells |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
| EP0452342B1 (en) | 1988-12-28 | 1994-11-30 | MILTENYI, Stefan | Methods and materials for high gradient magnetic separation of biological materials |
| US5200084A (en) | 1990-09-26 | 1993-04-06 | Immunicon Corporation | Apparatus and methods for magnetic separation |
| US6060273A (en) | 1992-08-27 | 2000-05-09 | Beiersdorf Ag | Multicistronic expression units and their use |
| US6040177A (en) | 1994-08-31 | 2000-03-21 | Fred Hutchinson Cancer Research Center | High efficiency transduction of T lymphocytes using rapid expansion methods ("REM") |
| US20020150914A1 (en) | 1995-06-30 | 2002-10-17 | Kobenhavns Universitet | Recombinant antibodies from a phage display library, directed against a peptide-MHC complex |
| US6207453B1 (en) | 1996-03-06 | 2001-03-27 | Medigene Ag | Recombinant AAV vector-based transduction system and use of same |
| US6451995B1 (en) | 1996-03-20 | 2002-09-17 | Sloan-Kettering Institute For Cancer Research | Single chain FV polynucleotide or peptide constructs of anti-ganglioside GD2 antibodies, cells expressing same and related methods |
| WO2000014257A1 (en) | 1998-09-04 | 2000-03-16 | Sloan-Kettering Institute For Cancer Research | Fusion receptors specific for prostate-specific membrane antigen and uses thereof |
| US6410319B1 (en) | 1998-10-20 | 2002-06-25 | City Of Hope | CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies |
| WO2001010912A1 (en) * | 1999-08-09 | 2001-02-15 | Lexigen Pharmaceuticals Corp. | Multiple cytokine-antibody complexes |
| US20020131960A1 (en) | 2000-06-02 | 2002-09-19 | Michel Sadelain | Artificial antigen presenting cells and methods of use thereof |
| US7446179B2 (en) | 2000-11-07 | 2008-11-04 | City Of Hope | CD19-specific chimeric T cell receptor |
| US7446191B2 (en) | 2001-04-11 | 2008-11-04 | City Of Hope | DNA construct encoding CE7-specific chimeric T cell receptor |
| US7070995B2 (en) | 2001-04-11 | 2006-07-04 | City Of Hope | CE7-specific redirected immune cells |
| US7265209B2 (en) | 2001-04-11 | 2007-09-04 | City Of Hope | CE7-specific chimeric T cell receptor |
| US7354762B2 (en) | 2001-04-11 | 2008-04-08 | City Of Hope | Method for producing CE7-specific redirected immune cells |
| US8324353B2 (en) | 2001-04-30 | 2012-12-04 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
| US20070116690A1 (en) | 2001-12-10 | 2007-05-24 | Lili Yang | Method for the generation of antigen-specific lymphocytes |
| US20030170238A1 (en) | 2002-03-07 | 2003-09-11 | Gruenberg Micheal L. | Re-activated T-cells for adoptive immunotherapy |
| US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
| EP1418184A1 (en) * | 2002-11-08 | 2004-05-12 | Cell Center Cologne GmbH | Recombinant fusion protein consisting of the p40 and p35 subunits of IL-12 and a ScFv and use thereof |
| US20130149337A1 (en) | 2003-03-11 | 2013-06-13 | City Of Hope | Method of controlling administration of cancer antigen |
| US8188220B2 (en) | 2006-12-06 | 2012-05-29 | Sanford-Burnham Medical Research Institute | Methods and compositions related to targeting wounds, regenerating tissue, and tumors |
| EP2537416A1 (en) | 2007-03-30 | 2012-12-26 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| US20100178276A1 (en) | 2007-03-30 | 2010-07-15 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred t lymphocytes |
| WO2009072003A2 (en) | 2007-12-07 | 2009-06-11 | Miltenyi Biotec Gmbh | Sample processing system and methods |
| US20110003380A1 (en) | 2007-12-07 | 2011-01-06 | Stefan Miltenyi | Sample Processing System and Methods |
| US8479118B2 (en) | 2007-12-10 | 2013-07-02 | Microsoft Corporation | Switching search providers within a browser search box |
| WO2010033140A2 (en) | 2008-05-06 | 2010-03-25 | Innovative Micro Technology | Removable/disposable apparatus for mems particle sorting device |
| US8339645B2 (en) | 2008-05-27 | 2012-12-25 | Canon Kabushiki Kaisha | Managing apparatus, image processing apparatus, and processing method for the same, wherein a first user stores a temporary object having attribute information specified but not partial-area data, at a later time an object is received from a second user that includes both partial-area data and attribute information, the storage unit is searched for the temporary object that matches attribute information of the received object, and the first user is notified in response to a match |
| WO2011112935A2 (en) * | 2010-03-12 | 2011-09-15 | The Regents Of The University Of California | Antibody fusion proteins with disrupted heparin-binding activity |
| US20130287748A1 (en) | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| US8911993B2 (en) | 2010-12-09 | 2014-12-16 | The Trustees Of The University Of Pennsylvania | Compositions for treatment of cancer |
| WO2012129514A1 (en) | 2011-03-23 | 2012-09-27 | Fred Hutchinson Cancer Research Center | Method and compositions for cellular immunotherapy |
| US20140294841A1 (en) | 2011-04-01 | 2014-10-02 | Eureka Therapeutics, Inc. | T cell receptor-like antibodies specific for a wti peptide presented by hla-a2 |
| US8398282B2 (en) | 2011-05-12 | 2013-03-19 | Delphi Technologies, Inc. | Vehicle front lighting assembly and systems having a variable tint electrowetting element |
| WO2013071154A1 (en) | 2011-11-11 | 2013-05-16 | Fred Hutchinson Cancer Research Center | Cyclin a1-targeted t-cell immunotherapy for cancer |
| WO2013123061A1 (en) | 2012-02-13 | 2013-08-22 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | Bispecific chimeric antigen receptors and therapeutic uses thereof |
| WO2013126726A1 (en) | 2012-02-22 | 2013-08-29 | The Trustees Of The University Of Pennsylvania | Double transgenic t cells comprising a car and a tcr and their methods of use |
| WO2013166321A1 (en) | 2012-05-03 | 2013-11-07 | Fred Hutchinson Cancer Research Center | Enhanced affinity t cell receptors and methods for making the same |
| WO2014031687A1 (en) | 2012-08-20 | 2014-02-27 | Jensen, Michael | Method and compositions for cellular immunotherapy |
| WO2014055668A1 (en) | 2012-10-02 | 2014-04-10 | Memorial Sloan-Kettering Cancer Center | Compositions and methods for immunotherapy |
| US9405601B2 (en) | 2012-12-20 | 2016-08-02 | Mitsubishi Electric Corporation | In-vehicle apparatus and program |
| US20160045551A1 (en) | 2013-02-26 | 2016-02-18 | Memorial Sloan-Kettering Cancer Center | Compositions and methods for immunotherapy |
| WO2014139468A1 (en) * | 2013-03-15 | 2014-09-18 | Admark Healthcare, Llc | Fusion protein molecules and method of use |
| US9108442B2 (en) | 2013-08-20 | 2015-08-18 | Ricoh Company, Ltd. | Image forming apparatus |
Non-Patent Citations (79)
| Title |
|---|
| "Current Protocols in Molecular Biology", JOHN WILEY & SONS |
| "Methods in Molecular Medicine", METASTASIS RESEARCH PROTOCOLS, vol. 58 |
| "Remington: The Science and Practice of Pharmacy, 21st ed.", 1 May 2005, LIPPINCOTT WILLIAMS & WILKINS |
| AHSAN ET AL., NEOPLASIA, vol. 16, 2014, pages 105 - 14 |
| ALONSO-CAMINO ET AL., MOL THER NUCL ACIDS, vol. 2, 2013, pages e93 |
| ANDERSSON ET AL., FEBS J., vol. 271, 2004, pages 1219 - 1226 |
| BARRETT ET AL., CHIMERIC ANTIGEN RECEPTOR THERAPY FOR CANCER ANNUAL REVIEW OF MEDICINE, vol. 65, 2014, pages 333 - 347 |
| BAUM ET AL., MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 13, 2006, pages 1050 - 1063 |
| BINETRUY-TOURNAIRE ET AL., EMBO J., vol. 19, 2000, pages 1525 - 1533 |
| BORIS-LAWRIE; TEMIN, CUR. OPIN. GENET. DEVELOP., vol. 3, 1993, pages 102 - 109 |
| BRASH ET AL., MOL. CELL BIOL., vol. 7, 1987, pages 2031 - 2034 |
| BURNS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 8033 - 8037 |
| CARLENS ET AL., EXP HEMATOL, vol. 28, no. 10, 2000, pages 1137 - 46 |
| CAVALIERI ET AL., BLOOD, vol. 102, no. 2, 2003, pages 497 - 505 |
| CHEADLE ET AL.: "Chimeric antigen receptors for T-cell based therapy", METHODS MOL BIOL., vol. 907, 2012, pages 645 - 66, XP009179541, DOI: doi:10.1007/978-1-61779-974-7_36 |
| CHEN ET AL., BIOMED RESEARCH INTERNATIONAL, 2015 |
| CHICAYBAM ET AL., PLOS ONE, vol. 8, no. 3, 2013, pages e60298 |
| CHO ET AL., LAB CHIP, vol. 10, 2010, pages 1567 - 1573 |
| CHOTHIA ET AL., EMBO J., vol. 7, 1988, pages 3745 |
| CLARKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| COHEN CJ. ET AL., J MOL. RECOGN., vol. 16, 2003, pages 324 - 332 |
| COHEN ET AL., J IMMUNOL., vol. 175, 2005, pages 5799 - 5808 |
| COOPER ET AL., BLOOD, vol. 101, 2003, pages 1637 - 1644 |
| CREEKMORE ET AL.: "Biologic Therapy of Cancer", 1991, LIPPINCOTT, pages: 76 |
| DAVILA ET AL., PLOS ONE, vol. 8, no. 4, 2013, pages e61338 |
| DE FELIPE, GENETIC VACCINES AND THER., vol. 2, 2004, pages 13 |
| DEFELIPE ET AL., TRAFFIC, vol. 5, 2004, pages 616 - 626 |
| EMILUSEN ET AL., UROL INT., vol. 67, no. 3, 2001, pages 216 - 223 |
| FRECHA ET AL., MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 18, 2010, pages 1748 - 1757 |
| GILLIES S ET AL: "Antibody-IL-12 fusion proteins are effective in SCID mouse models of prostate and colon carcinoma metastases", THE JOURNAL OF IMMUNOLOGY, THE AMERICAN ASSOCIATION OF IMMUNOLOGISTS, US, vol. 160, no. 12, 15 June 1998 (1998-06-15), pages 6195 - 6203, XP002106576, ISSN: 0022-1767 * |
| GODIN ET AL., J BIOPHOTON., vol. 1, no. 5, 2008, pages 355 - 376 |
| HACKETT ET AL., MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 18, 2010, pages 674 - 683 |
| HERMAN ET AL., J. IMMUNOLOGICAL METHODS, vol. 285, no. 1, 2004, pages 25 - 40 |
| HUANG ET AL., METHODS MOL BIOL, vol. 506, 2009, pages 115 - 126 |
| HUDECEK ET AL., CLIN. CANCER RES., vol. 19, 2013, pages 3153 |
| JANEWAY ET AL.: "Immunobiology: The Immune System in Health and Disease, 3rd ed.", 1997, CURRENT BIOLOGY PUBLICATIONS, pages: 4:33 |
| JOHNSTON, NATURE, vol. 346, 1990, pages 776 - 777 |
| JORES ET AL., PROC. NAT'L ACAD. SCI. U.S.A., vol. 87, 1990, pages 9138 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1991, PUBLIC HEALTH SERVICE NATIONAL INSTITUTES OF HEALTH |
| KINDT ET AL.: "Kuby Immunology, 6th ed.", 2007, W.H. FREEMAN AND CO., pages: 91 |
| KLEBANOFF ET AL., J IMMUNOTHER., vol. 35, no. 9, 2012, pages 651 - 660 |
| KOCHENDERFER ET AL., J. IMMUNOTHERAPY, vol. 32, no. 7, 2009, pages 689 - 702 |
| KOSTE ET AL., GENE THERAPY, 3 April 2014 (2014-04-03) |
| LASEK ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 63, 2014, pages 419 - 435 |
| LEFRANC ET AL., DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55 |
| LEONARD ET AL., BLOOD, vol. 90, 1997, pages 2541 - 2548 |
| LI, NAT BIOTECHNOL., vol. 23, 2005, pages 349 - 354 |
| LUPTON S. D. ET AL., MOL. AND CELL BIOL., vol. 11, 1991, pages 6 |
| MAEMUNAH HASAN ET AL: "IL-12 Is a Heparin-Binding Cytokine", THE JOURNAL OF IMMUNOLOGY, 15 January 1999 (1999-01-15), UNITED STATES, pages 1064, XP055406302, Retrieved from the Internet <URL:http://www.jimmunol.org/content/162/2/1064.full.pdf> [retrieved on 20170913] * |
| MANURI ET AL., HUM GENE THER, vol. 21, no. 4, 2010, pages 427 - 437 |
| MILLER, A. D., HUMAN GENE THERAPY, vol. 1, 1990, pages 5 - 14 |
| MILLER; ROSMAN, BIOTECHNIQUES, vol. 7, 1989, pages 980 - 990 |
| MULLEN ET AL., PROC. NATL. ACAD. SCI. USA., vol. 89, 1992, pages 33 |
| OSOL A.: "Remington's Pharmaceutical Sciences, 16th ed.", 1980 |
| PARK ET AL., TRENDS BIOTECHNOL., vol. 29, no. 11, November 2011 (2011-11-01), pages 550 - 557 |
| PARKHURST ET AL., CLIN CANCER RES., vol. 15, 2009, pages 169 - 180 |
| PEGRAM ET AL., BLOOD, vol. 119, 2012, pages 4133 - 4141 |
| PORTOLANO ET AL., J. IMMUNOL., vol. 150, 1993, pages 880 - 887 |
| RIDDELL ET AL., HUMAN GENE THERAPY, vol. 3, 1992, pages 319 - 338 |
| ROSENBERG, NAT REV CLIN ONCOL., vol. 8, no. 10, 2011, pages 577 - 85 |
| S. A. BROOKS AND U. SCHUMACHER: "Cell Behavior In Vitro and In Vivo", vol. 2, HUMANA PRESS INC., pages: 17 - 25 |
| SADELAIN ET AL., CANCER DISCOV., vol. 3, no. 4, April 2013 (2013-04-01), pages 388 - 398 |
| SCARPA ET AL., VIROLOGY, vol. 180, 1991, pages 849 - 852 |
| SHARMA ET AL., MOLEC THER NUCL ACIDS, vol. 2, 2013, pages e74 |
| SZOKA ET AL., ANN. REV. BIOPHYS. BIOENG., vol. 9, 1980, pages 467 |
| TAM ET AL., JOURNAL OF MOLECULAR BIOLOGY, vol. 385, 2009, pages 79 - 90 |
| TERAKURA ET AL., BLOOD, vol. 1, 2012, pages 72 - 82 |
| THEMELI ET AL., NAT BIOTECHNOL., vol. 31, no. 10, 2013, pages 928 - 933 |
| TSUKAHARA ET AL., BIOCHEM BIOPHYS RES COMMUN, vol. 438, no. 1, 2013, pages 84 - 9 |
| TURTLE ET AL., CURR. OPIN. IMMUNOL., vol. 24, no. 5, October 2012 (2012-10-01), pages 633 - 39 |
| VAN TEDELOO ET AL., GENE THERAPY, vol. 7, no. 16, 2000, pages 1431 - 1437 |
| VARELA-ROHENA ET AL., NAT MED., vol. 14, 2008, pages 1390 - 1395 |
| VERHOEYEN ET AL., METHODS MOL BIOL., vol. 506, 2009, pages 97 - 114 |
| VICARI ET AL., J. BIOL. CHEM., vol. 286, 2011, pages 13612 - 25 |
| WADWA ET AL., J. DRUG TARGETING, vol. 3, 1995, pages 1 1 1 |
| WANG ET AL., J IMMUNOTHER., vol. 35, no. 9, 2012, pages 689 - 701 |
| WANG ET AL., J. IMMUNOTHER., vol. 35, no. 9, 2012, pages 689 - 701 |
| WIGLER ET AL., CELL, vol. 2, 1977, pages 223 |
| WU ET AL., CANCER, vol. 18, no. 2, March 2012 (2012-03-01), pages 160 - 75 |
Cited By (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11446398B2 (en) | 2016-04-11 | 2022-09-20 | Obsidian Therapeutics, Inc. | Regulated biocircuit systems |
| US12304935B2 (en) | 2016-07-29 | 2025-05-20 | Juno Therapeutics, Inc. | Immunomodulatory polypeptides and related compositions and methods |
| US12606603B2 (en) | 2018-03-14 | 2026-04-21 | Seattle Children's Hospital | IL-13 receptor alpha 2 targeted, zetakine directed T cell immunotherapy |
| EP4491718A3 (en) * | 2018-03-14 | 2025-03-26 | Seattle Children's Hospital (DBA Seattle Children's Research Institute) | Il-13 receptor alpha 2 targeted, zetakine directed t cell immunotherapy |
| US12152079B2 (en) | 2018-03-14 | 2024-11-26 | Seattle Children's Research Institute | Nucleic acids encoding IL-13 receptor alpha 2 (IL13Ra2) chimeric antigen receptor for tumor specific T cell immunotherapy |
| EP3765487A4 (en) * | 2018-03-14 | 2022-01-05 | Seattle Children's Hospital (DBA Seattle Children's Research Institute) | IL-13REZEPTOR-ALPHA 2 T-CELL IMMUNOTHERAPY TARGETED AGAINST ZETAKIN |
| US11981746B2 (en) | 2018-06-04 | 2024-05-14 | Precigen, Inc. | MUC16 specific chimeric antigen receptors and uses thereof |
| US11976134B2 (en) | 2018-06-04 | 2024-05-07 | Precigen, Inc. | MUC16 specific chimeric antigen receptors and uses thereof |
| US11319380B2 (en) | 2018-06-04 | 2022-05-03 | Precigen, Inc. | MUC16 specific chimeric antigen receptors and uses thereof |
| CN109306016A (zh) * | 2018-08-15 | 2019-02-05 | 华东师范大学 | 共表达细胞因子il-7的nkg2d-car-t细胞及其用途 |
| CN109306016B (zh) * | 2018-08-15 | 2021-10-22 | 华东师范大学 | 共表达细胞因子il-7的nkg2d-car-t细胞及其用途 |
| CN112888786A (zh) * | 2018-09-07 | 2021-06-01 | Sotio有限责任公司 | 与调节细胞内乳酸浓度的反式代谢分子组合的嵌合受体多肽及其治疗用途 |
| JP7391984B2 (ja) | 2019-03-12 | 2023-12-05 | 重▲慶▼精准生物技▲術▼有限公司 | 低酸素調節プロモーター及びその応用 |
| JP2022524461A (ja) * | 2019-03-12 | 2022-05-02 | 重▲慶▼精准生物技▲術▼有限公司 | 低酸素調節プロモーター及びその応用 |
| EP3922721A4 (en) * | 2019-03-12 | 2023-01-11 | Chongqing Precision Biotech Company Limited | PROMOTER REGULATED BY HYPOXIA AND ITS APPLICATION |
| EP3964533A4 (en) * | 2019-04-27 | 2023-08-09 | Jinyu Zhang | PROTEIN HETERODIMER AND USE THEREOF |
| US11512122B2 (en) | 2019-05-17 | 2022-11-29 | Xencor, Inc. | IL-7-FC-fusion proteins |
| CN112294760A (zh) * | 2019-07-26 | 2021-02-02 | 张晋宇 | 一种液体制剂及其应用 |
| CN112294760B (zh) * | 2019-07-26 | 2025-12-12 | 宁波新致生物科技有限公司 | 一种液体制剂及其应用 |
| CN114144193A (zh) * | 2019-07-26 | 2022-03-04 | 张晋宇 | 一种液体制剂及其应用 |
| WO2021018026A1 (zh) * | 2019-07-26 | 2021-02-04 | 张晋宇 | 一种液体制剂及其应用 |
| WO2021081345A1 (en) * | 2019-10-25 | 2021-04-29 | Mayo Foundation For Medical Education And Research | Bi-peptide with affinity to extracellular matrix proteins or cells and to growth factors for tissue healing and regeneration |
| US12275796B2 (en) | 2019-12-03 | 2025-04-15 | Evotec International Gmbh | Interferon-associated antigen binding proteins and uses thereof |
| WO2021115333A1 (zh) * | 2019-12-10 | 2021-06-17 | 苏州克睿基因生物科技有限公司 | 一种融合蛋白及表达此蛋白的工程化免疫细胞及其应用 |
| US12215131B2 (en) | 2019-12-20 | 2025-02-04 | Regeneron Pharmaceuticals, Inc. | IgG Fc-IL2-Rα-IL2 fusions and methods of use thereof |
| US12091440B2 (en) | 2019-12-20 | 2024-09-17 | Regeneron Pharmaceuticals, Inc. | IL2 and peptide-MHC complex fusion proteins and methods of use thereof |
| US12319724B2 (en) | 2019-12-20 | 2025-06-03 | Regeneron Pharmaceuticals, Inc. | IL2 agonists and methods of use thereof |
| EP4096670A4 (en) * | 2020-01-30 | 2024-02-28 | Purdue Research Foundation | LIGAND-MEDIATED DELIVERY OF THERAPEUTIC PROTEINS AND THEIR USES |
| US12522638B2 (en) | 2021-07-19 | 2026-01-13 | Regeneron Pharmaceuticals, Inc. | IL12 receptor agonists and methods of use thereof |
| WO2023086772A1 (en) | 2021-11-12 | 2023-05-19 | Xencor, Inc. | Bispecific antibodies that bind to b7h3 and nkg2d |
| WO2024102636A1 (en) | 2022-11-07 | 2024-05-16 | Xencor, Inc. | Bispecific antibodies that bind to b7h3 and mica/b |
| WO2025085672A1 (en) | 2023-10-17 | 2025-04-24 | Xencor, Inc. | Bispecific antibodies that bind to nkp46 and mica/b |
| WO2025129120A3 (en) * | 2023-12-15 | 2025-07-24 | Port Therapeutics, Inc. | Use of thermal bioswitches for treating autoimmune diseases |
| WO2025176860A1 (en) | 2024-02-23 | 2025-08-28 | Charité - Universitätsmedizin Berlin Körperschaft des öffentlichen Rechts | Dual chimeric antigen receptor construct targeting cea and epcam |
Also Published As
| Publication number | Publication date |
|---|---|
| CN110087672A (zh) | 2019-08-02 |
| EP3490585A1 (en) | 2019-06-05 |
| JP7295795B2 (ja) | 2023-06-21 |
| JP2023062104A (ja) | 2023-05-02 |
| US12304935B2 (en) | 2025-05-20 |
| AU2017301880C1 (en) | 2022-04-21 |
| AU2017301880B2 (en) | 2021-11-04 |
| MX2019001185A (es) | 2019-10-21 |
| US20190194283A1 (en) | 2019-06-27 |
| JP2019531704A (ja) | 2019-11-07 |
| CA3031955A1 (en) | 2018-02-01 |
| AU2017301880A1 (en) | 2019-02-07 |
| MA45779A (fr) | 2019-06-05 |
| ES2951552T3 (es) | 2023-10-23 |
| EP3490585B1 (en) | 2023-05-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12304935B2 (en) | Immunomodulatory polypeptides and related compositions and methods | |
| US20250034217A1 (en) | Nucleic acid constructs for co-expression of chimeric antigen receptor and transcription factor, cells containing and therapeutic use thereof | |
| US20240368625A1 (en) | Methods and compositions for preparing genetically engineered cells | |
| AU2016349724B2 (en) | Chimeric receptors containing TRAF-inducing domains and related compositions and methods | |
| US11020429B2 (en) | Vectors and genetically engineered immune cells expressing metabolic pathway modulators and uses in adoptive cell therapy | |
| EP2884999B2 (en) | Method and compositions for cellular immunotherapy | |
| WO2022016119A1 (en) | Chimeric myd88 receptors for redirecting immunosuppressive signaling and related compositions and methods | |
| RU2795454C2 (ru) | Способы и композиции для получения генно-инженерных клеток | |
| US20230019849A1 (en) | Method for Preparing CD7-Negative, CD3-Positive T Cells | |
| RU2773159C2 (ru) | Химерные рецепторы, содержащие traf-6-индуцирующие домены, и связанные с ними композиции и способы | |
| HK40051816A (en) | Method and compositions for cellular immunotherapy | |
| HK1212205B (en) | Method and compositions for cellular immunotherapy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17752521 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3031955 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019504812 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017301880 Country of ref document: AU Date of ref document: 20170728 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017752521 Country of ref document: EP Effective date: 20190228 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 16320075 Country of ref document: US |