WO2018022936A1 - Fractions de ciblage de clostridium difficile et constructions comprenant lesdites fractions - Google Patents

Fractions de ciblage de clostridium difficile et constructions comprenant lesdites fractions Download PDF

Info

Publication number
WO2018022936A1
WO2018022936A1 PCT/US2017/044248 US2017044248W WO2018022936A1 WO 2018022936 A1 WO2018022936 A1 WO 2018022936A1 US 2017044248 W US2017044248 W US 2017044248W WO 2018022936 A1 WO2018022936 A1 WO 2018022936A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
peptide
amino acids
construct
amino acid
Prior art date
Application number
PCT/US2017/044248
Other languages
English (en)
Inventor
Shaoying LEE
Miroslav Baudys
Randal H. Eckert
Brian C. Varnum
Original Assignee
C3 Jian, Llc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by C3 Jian, Llc filed Critical C3 Jian, Llc
Publication of WO2018022936A1 publication Critical patent/WO2018022936A1/fr

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/33Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/37Digestive system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif

Definitions

  • Clostridium difficile is an anaerobic, spore-forming bacterium that is able to colonize the human gut, with the resultant infection causing a wide range of symptoms including, but not limited to mild to severe diarrhea, blood-stained stools, abdominal cramps, and fever that in severe cases can be fatal (Johnson (2009) J. Infection, 58: 403-410). It is the major cause of antibiotic-associated pseudo-membranous colitis and diarrhea in human.
  • Clostridium difficile is an emerging pathogen of opportunistic infection in hospitals worldwide. The incidence and severity of infection are strongly correlated with the extent and duration of antibiotic therapy that patients receive. This is because most antibiotics used to treat the gut are broad-spectrum and kill both pathogenic and nonpathogenic bacteria alike. The effect of this sterilization is that, with reduced competition by other bacterial species, dormant spores of the commensal C difficile are able to germinate and rapidly colonize the gut.
  • Toxin A and Toxin B which disrupt intestinal epithelial cells.
  • Toxin A and Toxin B are believed to enter the cells through receptor-mediated endocytosis and disrupt normal signaling pathways necessary for maintaining the cells' cytoskeleton, ultimately leading to inflammation and diarrhea.
  • PMC Pseudomembranous colitis
  • the bacteria In the later stages of the infection, the bacteria once again produce endospores that are shed, along with live bacteria, in the feces and greatly increase the chance of re- infection of the patient or spread to fellow patients. Hence, the recurrence rate of the disease is estimated to be between 20 and 45% following resolution of initial treatment (Aslam et al. (2005) Lancet Infect. Dis. 5: 549-557; McFarland et al. (2002) Am. J. Gasteroenterol. 97: 1769-1775).
  • C. difficile occurs naturally in the gut microflora of newborns, a minority of the adult population below 65, and the majority of those over 65.
  • CD AD C. difficile-associated disease
  • PCR-ribotypes causing infections can differ between hospitals in the same country and change quickly.
  • PCR-ribotype 027 As the incidence of the hyper-virulent strain wanes (PCR-ribotype 027) another one waxes (PCR-ribotype 078) (O'Donoghue & Kyne (2011) Curr. Opin.
  • novel constructs comprising peptides that preferentially or specifically bind Clostridium difficile attached to an
  • Various embodiments contemplated herein may include, but need not be limited to, one or more of the following:
  • Embodiment 1 A construct that binds to and kills or inhibits C. difficile said construct comprising:
  • a targeting peptide that binds to C. difficile and an antimicrobial peptide wherein said targeting peptide is attached directly to said antimicrobial peptide or is attached to said antimicrobial peptide by a peptide or amino acid linker that ranges in length from 1 amino acid up to about 15 amino acids, or up to about 10 amino acids; and
  • amino acid sequence of said targeting peptide comprises or consists of the amino acid sequence L-A-T-X 4 -X 5 -K-Y-X 8 -K-X 10 -H-K-K-X 14 (SEQ ID NO: 136) wherein:
  • X 4 is K or L, or conservative substitutions thereof;
  • X 5 is K or L, or conservative substitutions thereof;
  • X 8 is E or L, or conservative substitutions thereof;
  • X 10 is E, L, or K, or conservative substitutions thereof.
  • X 14 is M or K, or conservative substitutions thereof.
  • Embodiment 2 The construct of embodiment 1, wherein X 4 is K.
  • Embodiment 3 The construct embodiment 1, wherein X 4 is L.
  • Embodiment 4 The construct according to any one of embodiments 1-3, wherein X 5 is K.
  • Embodiment 5 The construct according to any one of embodiments 1-3, wherein X 5 is L.
  • Embodiment 6 The construct according to any one of embodiments 1-5, wherein X 8 is E.
  • Embodiment 7 The construct according to any one of embodiments 1-5, wherein X 8 is L.
  • Embodiment 8 The construct according to any one of embodiments 1-7, wherein X 10 is E.
  • Embodiment 9 The construct according to any one of embodiments 1-7, wherein X 10 is L.
  • Embodiment 10 The construct according to any one of embodiments 1-7, wherein X 10 is K.
  • Embodiment 11 The construct according to any one of embodiments 1-10, wherein X 14 is M.
  • Embodiment 12 The construct according to any one of embodiments 1-10, wherein X 14 is K.
  • Embodiment 13 The construct embodiment 1, wherein the amino acid sequence of said targeting peptide comprises a sequence selected from the group consisting of LATKLKYEKEHKKM (SEQ ID NO: 1), LATKLKYEKLHKKM (SEQ ID NO:2), LATLKKYEKLHKKM (SEQ ID NO:3), LATLKKYLKEHKKM (SEQ ID NO:4),
  • LATLKKYLKKHKKM (SEQ ID NO: 5), LATLKKYLKLHKKM (SEQ ID NO: 6), LATLKKYEKLHKKK (SEQ ID NO: 7), LATKLKYEKLHKKK (SEQ ID NO: 8),
  • LATLKKYLKEHKKK (SEQ ID NO: 9), LATKLKYLKEHKKM (SEQ ID NO: 10), LATKLKYLKELKKM (SEQ ID NO: 11), and LATKLKYEKELKKM (SEQ ID NO: 12).
  • Embodiment 14 The construct embodiment 1, wherein the amino acid sequence of said targeting peptide comprises the sequence LATKLKYEKEHKKM (SEQ ID NO: l).
  • Embodiment 15 The according to any one of embodiments 1-14, wherein amino acid sequence of said targeting moiety ranges in length up to about 40 amino acids, or up to about 35 amino acids, or up to about 25 amino acids, or up to about 20 amino acids.
  • Embodiment 16 The construct according to any one of embodiments 1-15, wherein said targeting peptide is attached to the amino terminus of said antimicrobial peptide.
  • Embodiment 17 The construct according to any one of embodiments 1-15, wherein said targeting peptide is attached to the carboxyl terminus of said antimicrobial peptide.
  • Embodiment 18 The construct according to any one of embodiments 1-17, wherein said targeting peptide is attached to an antimicrobial peptide comprising the amino acid sequence
  • Xi 1 is I or F, or conservative substitutions thereof;
  • Xi 2 is F, L, or I, or conservative substitutions thereof;
  • Xi 4 is A or P, or conservative substitutions thereof;
  • Xi 5 is I or V, or conservative substitutions thereof;
  • Xi 6 is W or L, or conservative substitutions thereof;
  • I Xi 7 is P, S, or G, or conservative substitutions thereof;
  • Xi 8 is L or A, or conservative substitutions thereof;
  • Xi 9 is A, I, or V, or conservative substitutions thereof;
  • Xi 10 is L, A, S, or G, or conservative substitutions thereof;
  • Xi 11 is G, S, or N, or conservative substitutions thereof;
  • Xi 12 is A or L, or conservative substitutions thereof;
  • Xi 13 is V or L, or conservative substitutions thereof;
  • Xi 14 is K, G, or H, or conservative substitutions thereof;
  • Xi 15 is N or G, or conservative substitutions thereof;
  • Xi 17 is I or L, or conservative substitutions thereof.
  • Xi 18 is K or N, or conservative substitutions thereof.
  • Embodiment 19 The construct of embodiment 18, wherein said antimicrobial peptide comprises the amino acid sequence
  • Xi 1 , Xi 5 and Xi 17 are independently I or L;
  • Xi 18 is K or N; and when Xi 18 is K at least one of Xi 1 , Xi 5 or Xi 17 is L.
  • Embodiment 20 The construct of embodiment 19, wherein at least one of
  • Xi 1 , Xi 5 or Xi 17 is L.
  • Embodiment 21 The construct according to any one of embodiments 19-20, wherein Xi 18 is N.
  • Embodiment 22 The construct according to any one of embodiments 19-20, wherein Xi 18 is K.
  • Embodiment 23 The construct according to any one of embodiments 19-22, wherein Xi 1 is L, Xi 5 is I, and Xi 17 is I.
  • Embodiment 24 The construct according to any one of embodiments 19-22, wherein Xi 1 is I, Xi 5 is L, and Xi 17 is I.
  • Embodiment 25 The construct according to any one of embodiments 19-22, wherein Xi 1 is I, Xi 5 is I, and Xi 17 is L.
  • Embodiment 26 The construct according to any one of embodiments 19-22, wherein Xi 1 is L, Xi 5 is L, and Xi 17 is I.
  • Embodiment 27 The construct according to any one of embodiments 19-22, wherein Xi 1 is L, Xi 5 is I, and Xi 17 is L.
  • Embodiment 28 The construct according to any one of embodiments 19-22, wherein Xi 1 is I, Xi 5 is L, and Xi 17 is L.
  • Embodiment 29 The construct according to any one of embodiments 19-22, wherein Xi 1 is L, Xi 5 is L, and Xi 17 is L.
  • Embodiment 30 The construct according to any one of embodiments 18-29, wherein the amino acid sequence of said antimicrobial peptide comprises the sequence
  • Embodiment 31 The construct of embodiment 30, wherein Xi° is K.
  • Embodiment 32 The construct of embodiment 30, wherein Xi° is D.
  • Embodiment 33 The construct according to any one of embodiments 18-32, wherein the amino acid sequence of said antimicrobial peptide comprises the sequence
  • X 1 19 is K, N, or R.
  • Embodiment 34 The construct of embodiment 33, wherein Xi 19 is K.
  • Embodiment 35 The construct of embodiment 33, wherein Xi 19 is R.
  • Embodiment 36 The construct of embodiment 33, wherein Xi 19 is N.
  • Embodiment 37 The construct according to any one of embodiments 18-36, wherein the amino acid sequence of said antimicrobial peptide comprises the sequence
  • Embodiment 38 The construct of embodiment 37, wherein Xi 20 is I.
  • Embodiment 39 The construct of embodiment 37, wherein Xi 20 is L.
  • Embodiment 40 The construct of embodiment 18, wherein the amino acid sequence of said antimicrobial peptide comprises a sequence selected from the group consisting of KLFGALWPLALGALKNLLK (SEQ ID NO:47), IFGAILPLALGALKNLIK (SEQ ID NO:48), ILGPVLSLVGSALGGLIKKI (SEQ ID NO:49),
  • ILGPVLSLVGNALGGLIKKI SEQ ID NO:50
  • ILGPVLGLVGNALGGLLKNL SEQ ID NO: 51
  • ILGPVLGLVSNALGGLLKNL SEQ ID NO: 52
  • FIGAILPAIAGLVHGLINR SEQ ID NO:53
  • FIGAILPAIAGLVGGLINR SEQ ID NO:54
  • DIFGAILPLALGALKNLIK (SEQ ID NO: 55), KIFGAILPLALGALKNLIK (SEQ ID NO:56), DIFGAIWPLALGALKNLIK (SEQ ID NO:57), KIFGAIWPLALGALKNLIK (SEQ ID NO:58), and IF GAIWPL ALGALKNLIK (SEQ ID NO:59).
  • Embodiment 41 The construct of embodiment 18, wherein the amino acid sequence of said antimicrobial peptide consists of a sequence selected from the group consisting of KLFGALWPLALGALKNLLK (SEQ ID NO:47), IFGAILPLALGALKNLIK (SEQ ID NO:48), ILGPVLSLVGSALGGLIKKI (SEQ ID NO:49),
  • ILGPVLSLVGNALGGLIKKI SEQ ID NO:50
  • ILGPVLGLVGNALGGLLKNL SEQ ID NO: 51
  • ILGPVLGLVSNALGGLLKNL SEQ ID NO: 52
  • FIGAILPAIAGLVHGLINR SEQ ID NO:53
  • FIGAILPAIAGLVGGLINR SEQ ID NO:54
  • DIFGAILPLALGALKNLIK (SEQ ID NO: 55), KIFGAILPLALGALKNLIK (SEQ ID NO:56), DIFGAIWPLALGALKNLIK (SEQ ID NO:57), KIFGAIWPLALGALKNLIK (SEQ ID NO:58), and IF GAIWPL ALGALKNLIK (SEQ ID NO:59).
  • Embodiment 42 The construct according to any one of embodiments 1-17, wherein said targeting peptide is attached to an antimicrobial peptide comprising the amino acid sequence KX 2 2 F X 2 4 A X 2 6 X 7 PL X 2 10 X 2 U GALKNL X 2 18 K wherein: X 2 2 is I, L, K, V, or Nle, or conservative substitutions thereof; X 2 4 is G, K, or conservative substitutions thereof; X 2 6 is I, L, K, V, or Nle, or conservative substitutions thereof; X 2 7 is W or K, or conservative substitutions thereof; X 2 10 is A, W, or P, or conservative substitutions thereof; X 2 U is L or K, or conservative substitutions thereof; and X 2 18 is I, L, V, or Nle, or conservative substitutions thereof; or wherein said antimicrobial peptide comprises the amino acid sequence KX 2 2 F X 2 4 A X 2 6 X 7 PL X 2 10 X 2 U GALKNL
  • FLKFLKKFFKKLKYY (SEQ ID NO: 66) or FLKFLKKFFKKLKKY (SEQ ID NO: 67).
  • Embodiment 43 The construct of embodiment 42, wherein X 2 is I.
  • Embodiment 44 The construct of embodiment 42, wherein X 2 is L.
  • Embodiment 45 The construct of embodiment 42, wherein X 2 is K.
  • Embodiment 46 The construct of embodiment 42, wherein X 2 is V.
  • Embodiment 47 The construct of embodiment 42, wherein X 2 is Nle.
  • Embodiment 48 The construct according to any one of embodiments 42-47, wherein X 2 4 is G.
  • Embodiment 49 The construct according to any one of embodiments 42-47, wherein X 2 4 is K.
  • Embodiment 50 The construct according to any one of embodiments 42-49, wherein X 2 6 is I.
  • Embodiment 51 The construct according to any one of embodiments 42-49, wherein X 2 6 is L.
  • Embodiment 52 The construct according to any one of embodiments 42-49, wherein X 2 6 is K.
  • Embodiment 53 The construct according to any one of embodiments 42-49, wherein X 2 6 is V.
  • Embodiment 54 The construct according to any one of embodiments 42-49, wherein X 2 6 is Nle.
  • Embodiment 55 The construct according to any one of embodiments 42-54, wherein X 2 7 is W.
  • Embodiment 56 The construct according to any one of embodiments 42-54, wherein X 2 7 is K.
  • Embodiment 57 The construct according to any one of embodiments 42-56, wherein X 2 10 is A.
  • Embodiment 58 The construct according to any one of embodiments 42-56, wherein X 2 10 is W.
  • Embodiment 59 The construct according to any one of embodiments 42-56, wherein X 2 10 is P.
  • Embodiment 60 The construct according to any one of embodiments 42-59, wherein X 2 U is L.
  • Embodiment 61 The construct according to any one of embodiments 42-59, wherein X 2 U is K.
  • Embodiment 62 The construct according to any one of embodiments 42-61, wherein X 2 18 is I.
  • Embodiment 63 The construct according to any one of embodiments 42-61, wherein X 2 18 is L.
  • Embodiment 64 The construct according to any one of embodiments 42-61, wherein X 2 18 is V.
  • Embodiment 65 The construct according to any one of embodiments 42-61, wherein X 2 18 is Nle.
  • Embodiment 66 The construct of embodiment 42, wherein the amino acid sequence of said antimicrobial peptide comprises a sequence selected from the group consisting of KLFGALWPLALGALKNLLK (SEQ ID NO:47),
  • KIFKAIWPLALGALKNLIK (SEQ ID NO: 51), KIFKAIKPLALGALKNLIK (SEQ ID NO:52), KIFKAIKPLAKGALKNLIK (SEQ ID NO:53), KIFKAIKPLWKGALKNLIK (SEQ ID NO: 54), KIFKAKKPLWKGALKNLIK (SEQ ID NO: 55), KIFKAIKPLWLGALKNLIK (SEQ ID NO:56), KKFGAIWPLALGALK LIK (SEQ ID NO:57),
  • KIFGAIWALPLGALK LIK (SEQ ID NO: 58), KIFGAIWKLPLGALKNLIK (SEQ ID NO:59), FLKFLKKFFKKLKYY (SEQ ID NO:66), and FLKFLKKFFKKLKKY (SEQ ID NO:67.
  • Embodiment 67 The construct according to any one of embodiments 1-66, wherein said construct ranges in length up to 50 amino acids, or up to 40 amino acids, or up to 30 amino acids.
  • Embodiment 68 The construct according to any one of embodiments 1-67, wherein said construct comprises all "D" amino acids.
  • Embodiment 69 The construct according to any one of embodiments 1-67, wherein said construct comprises all "L" amino acids.
  • Embodiment 70 The construct according to any one of embodiments 1-67, wherein said construct comprises a mixture of "D" amino acids and "L" amino acids.
  • Embodiment 71 The construct according to any one of embodiments 1-70, wherein said construct bears one or more protecting groups.
  • Embodiment 72 The construct of embodiment 71, wherein said construct bears one or more protecting groups independently selected from the group consisting of acetyl, amide, 3 to 20 carbon alkyl groups, Fmoc, t-Boc, 9-fluoreneacetyl group, 1- fluorenecarboxylic group, 9-florenecarboxylic group, 9-fluorenone-l-carboxylic group, benzyloxycarbonyl, Xanthyl (Xan), Trityl (Trt), 4-methyltrityl (Mtt), 4-methoxytrityl (Mmt), 4-methoxy-2,3,6-trimethyl-benzenesulphonyl (Mtr), Mesitylene-2-sulphonyl (Mts), 4,4- dimethoxybenzhydryl (Mbh),Tosyl (Tos), 2,2,5, 7,8-pentamethyl chroman-6-sulphonyl (Pmc),
  • Embodiment 73 The construct according to any one of embodiments 71-72, wherein the carboxyl terminus of said construct is amidated.
  • Embodiment 74 The construct according to any one of embodiments 71-73, wherein the amino terminus of said peptide is acetylated.
  • Embodiment 75 The construct according to any one of embodiments 1-74, wherein said antimicrobial peptide is attached directly to said targeting peptide.
  • Embodiment 76 The construct according to any one of embodiments 1-74, wherein said antimicrobial peptide is attached to said targeting peptide by a peptide or amino acid linker that ranges in length from 1 amino acid up to about 15 amino acids, or up to about 10 amino acids.
  • Embodiment 77 The construct according to any one of embodiments 1-74, wherein said antimicrobial peptide is attached to said targeting peptide by a single amino acid.
  • Embodiment 78 The construct of embodiment 77, wherein said wherein said antimicrobial peptide is attached to said targeting peptide by a single amino acid selected from the group consisting of Gly, Ala, and Ser.
  • Embodiment 79 The construct of embodiment 77, wherein said wherein said antimicrobial peptide is attached to said targeting peptide by the amino acid Gly.
  • Embodiment 80 The construct according to any one of embodiments 1-74, wherein said antimicrobial peptide is attached to said targeting peptide by a peptide linker comprising 2 amino acids, or a peptide linker comprising 3 amino acids, , or a peptide linker comprising 4 amino acids, or a peptide linker comprising 5 amino acids, or a peptide linker comprising 6 amino acids, or a peptide linker comprising 7 amino acids, or a peptide linker comprising 8 amino acids, or a peptide linker comprising 9 amino acids, or a peptide linker comprising 10 amino acids.
  • Embodiment 81 The construct of embodiment 80, wherein said linker comprises or consists of an amino acid sequence shown in Table 5.
  • Embodiment 82 The construct of embodiment 80, wherein said linker comprises or consists of an amino acid sequence selected from the group consisting of GG, GGG, GGGG (SEQ ID NO: 74), GGGGG (SEQ ID NO: 75), GS, GGS, GGGS (SEQ ID NO:68), GGGGS (SEQ ID NO:69), SS, SSS, SSSS (SEQ ID NO:70), KGGK (SEQ ID NO:72), and GGGK (SEQ ID NO:73).
  • said linker comprises or consists of an amino acid sequence selected from the group consisting of GG, GGG, GGGG (SEQ ID NO: 74), GGGGG (SEQ ID NO: 75), GS, GGS, GGGS (SEQ ID NO:68), GGGGS (SEQ ID NO:69), SS, SSS, SSSS (SEQ ID NO:70), KGGK (SEQ ID NO:72), and GGGK (SEQ ID NO:73).
  • Embodiment 83 The constmct of embodiment 1, wherein the amino acid sequence of said construct comprises a sequence selected from them group consisting of LATKLKYEKEHKKMGKIFGAIWPLALGALKNLIK (SEQ ID NO: 99),
  • LATKLKYEKEHKKMGKIFKAIWPLALGALKNLIK (SEQ ID NO: 106),
  • LATKLKYEKEHKKMGKIFKAIKPLALGALKNLIK (SEQ ID NO: 107),
  • LATKLKYEKEHKKMGKIFKAIKPLAKGALKNLIK (SEQ ID NO: 108),
  • LATKLKYEKEHKKMGKIFKAIKPLWKGALKNLIK (SEQ ID NO: 109),
  • LATKLKYEKEHKKMGKIFGAIWALPLGALKNLIK (SEQ ID NO: 119),
  • Embodiment 84 The construct of embodiment 83, wherein the amino acid sequence of said construct consists of the sequence
  • Embodiment 85 The construct of embodiment 84, wherein the amino acids comprising said construct are D amino acids.
  • Embodiment 86 The construct of embodiment 85, wherein said construct is amidated at the carboxyl terminus.
  • Embodiment 87 A pharmaceutical formulation comprising a construct according to any of embodiments 1-86 in a pharmaceutically acceptable carrier.
  • Embodiment 88 The pharmaceutical formulation of embodiment 87, wherein said composition is formulated as a unit dosage formulation.
  • Embodiment 89 The pharmaceutical formulation of embodiment 87, wherein said composition is formulated for administration by a modality selected from the group consisting of intraperitoneal administration, topical administration, oral administration, inhalation administration, transdermal administration, subdermal depot administration, and rectal administration.
  • Embodiment 90 The pharmaceutical formulation of embodiment 87, wherein said composition is formulated for specific or preferential delivery to the colon, esophagus, stomach, large intestine, or small intestine in a mammal.
  • Embodiment 91 The pharmaceutical formulation of embodiment 90, wherein said composition is formulated for specific or preferential delivery to the colon in a mammal using a formulation form selected from the group consisting of pH sensitive coating, delayed time-controlled release system, microbially triggered drug delivery, pressure controlled drug delivery, Colon Targeted Delivery System (CODESTM), and Osmotic Controlled Drug Delivery (ORDS-CT).
  • Embodiment 92 The pharmaceutical formulation of embodiment 91, wherein said composition is formulated with a pH sensitive coating based on different classes of polymers such as polyacrylates, polymethacrylates, hypromellose acetate succinate, hypromellose phthalate and the like.
  • Embodiment 93 The pharmaceutical formulation of embodiment 91, wherein said composition is formulated with a delayed time-controlled release system.
  • examples include, but are not limited to water soluble, erodible polymer based coatings based on pharmaceutically acceptable polysaccharides such as hydroxypropyl or hydroxyethyl cellulose and the like, and/or water insoluble, but capable of swelling (swellable), polymer coatings based on polymethacrylates (e.g., copolymers of ethyl acrylate, methyl methaciylate and a low content of methacrylic acid ester with quaternary ammonium groups (such as EUDRAGIT®RS, EUDRAGIT®RL (see, e.g., Evonic Industries) and the like) that delay drug release through, e.g. diffusional constrains, and the like.
  • polymethacrylates e.g., copolymers of ethyl acrylate, methyl methaciylate and a
  • Embodiment 94 The pharmaceutical formulation of embodiments 90 or 91, wherein said composition comprises a capsule filled with or tablet comprising a construct according to any of embodiments 1-86, a pharmaceutically acceptable water soluble matrix or filler/osmotic agent such as mannitol or equivalent pharmaceutical excipient, and water swellable polymer such as hypromellose or the like.
  • a pharmaceutically acceptable water soluble matrix or filler/osmotic agent such as mannitol or equivalent pharmaceutical excipient
  • water swellable polymer such as hypromellose or the like.
  • Embodiment 95 The pharmaceutical formulation of embodiment 94, wherein the construct or AMP component is preformulated with a pharmaceutically acceptable buffer, bulking agent and/or lyoprotectant (e.g., mannitol and/or trehalose or other equivalent excipient), lyophilized, and processed by milling and sieving into lyo-powder.
  • a pharmaceutically acceptable buffer e.g., mannitol and/or trehalose or other equivalent excipient
  • lyophilized e.g., mannitol and/or trehalose or other equivalent excipient
  • Embodiment 96 The pharmaceutical formulation of embodiment 94, wherein the construct or AMP component is preformulated with a pharmaceutically acceptable buffer, bulking agent and/or lyoprotectant (e.g., mannitol and/or trehalose or other equivalent excipient),and spray drying processing is used for re-formulated API powder
  • a pharmaceutically acceptable buffer, bulking agent and/or lyoprotectant e.g., mannitol and/or trehalose or other equivalent excipient
  • Embodiment 97 The pharmaceutical formulation of embodiment 96, wherein said powder is a dry powder having a mean particle size ranging from about 0.1 ⁇ to about 50 ⁇ , or from 0.5 ⁇ to about 25 ⁇ .
  • Embodiment 98 The pharmaceutical formulation of embodiment 91, wherein said composition is formulated using a microbial triggered drug delivery system.
  • Embodiment 99 The pharmaceutical formulation of embodiment 98, wherein said composition is formulated using a microbial-triggered drug delivery system that comprises a prodrug formulation.
  • Embodiment 100 The pharmaceutical formulation of embodiment 98, wherein said composition is formulated as a prodrug selected from the group consisting of an azo conjugate, a saccharide conjugate or carrier, a hydrophobic amino acid conjugate, a sulphapyridine conjugate, and a glucuronic acid conjugate.
  • a prodrug selected from the group consisting of an azo conjugate, a saccharide conjugate or carrier, a hydrophobic amino acid conjugate, a sulphapyridine conjugate, and a glucuronic acid conjugate.
  • Embodiment 101 The pharmaceutical formulation of embodiment 98, wherein said composition is formulated using a polysaccharide delivery system.
  • Embodiment 102 The pharmaceutical formulation of embodiment 101 wherein said polysaccharide delivery system comprises a polysaccharide selected from the group consisting of chitosan, a chitosan derivative (e.g., chitosan succinate), pectin, a pectin derivative (e.g., amidated pectin, calcium pectinate), chondroitin, and an alginate.
  • a polysaccharide selected from the group consisting of chitosan, a chitosan derivative (e.g., chitosan succinate), pectin, a pectin derivative (e.g., amidated pectin, calcium pectinate), chondroitin, and an alginate.
  • Embodiment 103 The pharmaceutical formulation of embodiment 91, wherein said composition is formulated using a pressure controlled drug delivery system.
  • Embodiment 104 The pharmaceutical formulation of embodiment 103, wherein said delivery system comprises a colon-delivery capsules comprising ethylcellulose.
  • Embodiment 105 The pharmaceutical formulation of embodiment 91, wherein said composition is formulated using a Colon Targeted Delivery System
  • Embodiment 106 The pharmaceutical formulation of embodiment 105, wherein said composition is as core containing lactulose which is overcoated with an acid soluble material.
  • Embodiment 107 The pharmaceutical formulation of embodiment 91, wherein said composition is formulated using an Osmotic Controlled Drug Delivery (ORDS- CT) system.
  • Osmotic Controlled Drug Delivery (ORDS- CT) system.
  • Embodiment 108 The pharmaceutical formulation of embodiment 107, wherein said composition is formulated using bilayer push pull unit(s) containing an osmotic push layer and a drug layer, both surrounded by a semipermeable membrane.
  • Embodiment 109 A method of killing or inhibiting the growth or
  • Clostridium difficile said method comprising: contacting said C. difficile with a composition comprising a construct according to any one of embodiments 1-86 and/or administering a pharmaceutical formulation according to any one of embodiments 87-108, in an amount effective to kill or inhibit the growth or proliferation of C. difficile.
  • Embodiment 110 The method of embodiment 109, wherein said method comprises contacting said C. difficile with a composition comprising a construct according to any one of embodiments 1-86.
  • Embodiment 111 The method of embodiment 109, wherein said method comprises administering a pharmaceutical formulation according to any one of embodiments 87-108.
  • Embodiment 112 The method according to any one of embodiments 109-
  • said contacting or administering comprises administering said construct or said pharmaceutical formulation to a mammal determined to have a C. difficile infection.
  • Embodiment 113 The method according to any one of embodiments 109-
  • said contacting or administering comprises prophylactic administration of said construct or said pharmaceutical formulation to a mammal to prevent or to reduce the severity of a C. difficile infection.
  • Embodiment 114 The method according to any one of embodiments 112-
  • said mammal is a non-human mammal.
  • Embodiment 115 The method according to any one of embodiments 112-
  • Embodiment 116 A composition comprising fecal matter for fecal transplantation, said composition comprising fecal matter combined with a construct according to any one of embodiments 1-86.
  • Embodiment 117 The composition of embodiment 116, wherein viable
  • Clostridium difficile in said fecal matter is preferentially reduced as compared to other bacteria in said fecal matter.
  • Embodiment 118 The composition according to any one of embodiments
  • Embodiment 119 The composition according to any one of embodiments
  • Embodiment 120 The composition of embodiment 119 wherein said fecal matter comprises stool from a non-human mammal selected from the group consisting of a feline, a canine, a porcine, a bovine, an equine, and a non-human primate.
  • Embodiment 121 A method of preparing material for fecal transplantation, said method comprising combining material comprising stool from a mammal with a construct according to any one of embodiments 1-86 in an amount sufficient to preferentially reduce or eliminate viable C. difficile in said stool.
  • Embodiment 122 A method of treating a gasteroenterologic disease, in a subject in need thereof, said method comprising performing a fecal matter transplant into said subject using a composition according to any one of embodiments 116-120.
  • Embodiment 123 The method of embodiment 122, wherein said
  • gasteroenterologic disease is selected from the group consisting of a C. difficile infection, ulcerative colitis, Chohn's disease, irritable bowel syndrome, and idiopathic constipation.
  • Embodiment 124 The method according of embodiment 123, wherein said gasteroenterologic disease comprises a C. difficile infection.
  • Embodiment 125 The method according to any one of embodiments 122-124 wherein said subject is a subject under transitory or chronic treatment with one or more antibiotics.
  • Embodiment 126 The method according to any one of embodiments 124-
  • said subject is a subject that has had at least three recurrences of C. difficile infection.
  • Embodiment 127 The method according to any one of embodiments 124-
  • Embodiment 128 The method according to any one of embodiments 122-127 wherein said subject has failed antibiotic therapies.
  • Embodiment 129 The method of embodiment 128, wherein said subject has failed a pulsed, tapered regimen of vancomycin.
  • Embodiment 130 The method according to any one of embodiments 122-
  • Embodiment 131 The method according to any one of embodiments 122-
  • Embodiment 132 The method of embodiment 131, wherein said subject is a non-human mammal selected from the group consisting of a feline, a canine, a porcine, a bovine, an equine, and a non-human primate.
  • Embodiment 133 The method according to any one of embodiments 122-
  • Embodiment 134 The method of embodiment 133, wherein said subject is coadministered vancomycin.
  • Embodiment 135 The method according to any one of embodiments 122-
  • fecal matter transplantation is performed by introducing the fecal matter in an enema.
  • Embodiment 136 The method according to any one of embodiments 122-
  • fecal matter transplantation is performed by introducing the fecal matter in a colonoscopy.
  • Embodiment 137 The method according to any one of embodiments 122-
  • fecal matter transplantation is performed by orally administering the fecal matter in capsules.
  • Embodiment 138 The method according to any one of embodiments 122-
  • fecal matter transplantation is performed by administering the fecal matter as rectal suppositories.
  • Embodiment 139 An antimicrobial peptide, said peptide comprising the amino acid sequence
  • X 1 , X 5 and X 17 are independently I or L;
  • X 18 is K or N; and when X 18 is K at least one of X 1 , X 5 or X 17 is L.
  • Embodiment 140 The antimicrobial peptide of embodiment 139, wherein at least one of X 1 , X 5 or X 17 is L.
  • Embodiment 141 The antimicrobial peptide according to any one of embodiments 139-140, wherein X 18 is N.
  • Embodiment 142 The antimicrobial peptide according to any one of embodiments 139-140, wherein X 18 is K.
  • Embodiment 143 The antimicrobial peptide according to any one of embodiments 139-142, wherein X 1 is L, X 5 is I, and X 17 is I.
  • Embodiment 144 The antimicrobial peptide according to any one of embodiments 139-142, wherein X 1 is I, X 5 is L, and X 17 is I.
  • Embodiment 145 The antimicrobial peptide according to any one of embodiments 139-142, wherein X 1 is I, X 5 is I, and X 17 is L.
  • Embodiment 146 The antimicrobial peptide according to any one of embodiments 139-142, wherein X 1 is L, X 5 is L, and X 17 is I.
  • Embodiment 147 The antimicrobial peptide according to any one of embodiments 139-142, wherein X 1 is L, X 5 is I, and X 17 is L.
  • Embodiment 148 The antimicrobial peptide according to any one of embodiments 139-142, wherein X 1 is I, X 5 is L, and X 17 is L.
  • Embodiment 149 The antimicrobial peptide according to any one of embodiments 139-142, wherein X 1 is L, X 5 is L, and X 17 is L.
  • Embodiment 150 The antimicrobial peptide according to any one of embodiments 139-149, wherein said peptide comprises the amino acid sequence
  • Embodiment 151 The antimicrobial peptide of embodiment 150, wherein X 1 is K.
  • Embodiment 152 The antimicrobial peptide of embodiment 150, wherein X 1 is D.
  • Embodiment 153 The antimicrobial peptide according to any one of embodiments 139-152, wherein the amino acid sequence of said peptide comprises the sequence
  • Embodiment 154 The antimicrobial peptide of embodiment 153, wherein X 19 is K.
  • Embodiment 155 The antimicrobial peptide of embodiment 153, wherein X 19 is R.
  • Embodiment 156 The antimicrobial peptide of embodiment 153, wherein X 19 is N.
  • Embodiment 157 The antimicrobial peptide according to any one of embodiments 139-156, wherein the amino acid sequence of said peptide comprises the sequence
  • Embodiment 158 The antimicrobial peptide of embodiment 157, wherein X 20 is I.
  • Embodiment 159 The antimicrobial peptide of embodiment 157, wherein X 20 is L.
  • Embodiment 160 The antimicrobial peptide of embodiment 139, wherein said peptide comprises the amino acid sequence KLFGALWPLALGALKNLLK (SEQ ID NO:47).
  • Embodiment 161 The antimicrobial peptide according to any one of embodiments 139-160, wherein said peptide ranges in length up to 50 amino acids, or up to 40 amino acids, or up to 30 amino acids, or up to 25 amino acids, or up to 20 amino acids, or up to 19 amino acids.
  • Embodiment 162 The antimicrobial peptide of embodiment 139, wherein the amino acid sequence of said peptide consists of the sequence KLFGALWPLALGALKNLLK (SEQ ID NO:47).
  • Embodiment 163 The antimicrobial peptide according to any one of embodiments 139-162, wherein said peptide comprises all "D" amino acids.
  • Embodiment 164 The antimicrobial peptide according to any one of embodiments 139-162, wherein said peptide comprises all "L" amino acids.
  • Embodiment 165 The antimicrobial peptide according to any one of embodiments 139-162, wherein said peptide comprises a mixture of "D" amino acids and "L” amino acids.
  • Embodiment 166 The antimicrobial peptide according to any one of embodiments 139-165, wherein said peptide bears one or more protecting groups.
  • Embodiment 167 The antimicrobial peptide of embodiment 166, wherein said peptide bears one or more protecting groups independently selected from the group consisting of acetyl, amide, 3 to 20 carbon alkyl groups, Fmoc, t-Boc, 9-fluoreneacetyl group, 1-fluorenecarboxylic group, 9-florenecarboxylic group, 9-fluorenone-l-carboxylic group, benzyloxycarbonyl, Xanthyl (Xan), Trityl (Trt), 4-methyltrityl (Mtt), 4-methoxytrityl (Mmt), 4-methoxy-2,3,6-trimethyl-benzenesulphonyl (Mtr), Mesitylene-2-sulphonyl (Mts), 4,4- dimethoxybenzhydryl (Mbh),Tosyl (Tos), 2,2,5, 7,8-pentamethyl chroman-6-sul
  • protecting groups
  • Embodiment 168 The antimicrobial peptide of embodiment 166, wherein the carboxyl terminus of said peptide is amidated.
  • Embodiment 169 The antimicrobial peptide according to any one of embodiments 166-168, wherein the amino terminus of said peptide is acetylated.
  • Embodiment 170 The antimicrobial peptide according to any one of embodiments 139-169, wherein said antimicrobial peptide is attached to a targeting peptide that binds to C. difficile.
  • Embodiment 171 The antimicrobial peptide of embodiment 170, wherein the amino acid sequence of said targeting peptide that binds to C. difficile comprises or consists of an amino acid sequence in Tables 2 or 3.
  • Embodiment 172 The antimicrobial peptide of embodiment 170, wherein the amino acid sequence of said targeting peptide that binds to C. difficile comprises or consists of the sequence LATKLKYEKEHKKM (SEQ ID NO: 1).
  • Embodiment 173 The antimicrobial peptide according to any one of embodiments 170-172, wherein said antimicrobial peptide is attached directly to said targeting peptide or is attached to said targeting peptide by a peptide or amino acid linker that ranges in length from 1 amino acid up to about 15 amino acids, or up to about 10 amino acids.
  • Embodiment 174 The antimicrobial peptide of embodiment 173, wherein said antimicrobial peptide is attached to said targeting peptide by a single amino acid.
  • Embodiment 175 The antimicrobial peptide of embodiment 174, wherein said wherein said antimicrobial peptide is attached to said targeting peptide by a single amino acid selected from the group consisting of Gly, Ala, and Ser.
  • Embodiment 176 The antimicrobial peptide of embodiment 174, wherein said wherein said antimicrobial peptide is attached to said targeting peptide by the single amino acid Gly.
  • Embodiment 177 The antimicrobial peptide of embodiment 173, wherein said antimicrobial peptide is attached to said targeting peptide by a peptide linker comprising 2 amino acids, or a peptide linker comprising 3 amino acids, , or a peptide linker comprising 4 amino acids, or a peptide linker comprising 5 amino acids, or a peptide linker comprising 6 amino acids, or a peptide linker comprising 7 amino acids, or a peptide linker comprising 8 amino acids, or a peptide linker comprising 9 amino acids, or a peptide linker comprising 10 amino acids.
  • Embodiment 178 The antimicrobial peptide of embodiment 177, wherein said linker comprises or consists of an amino acid sequence shown in Table 5.
  • Embodiment 179 The antimicrobial peptide of embodiment 177, wherein said linker comprises or consists of an amino acid sequence selected from the group consisting of GG, GGG, GGGG (SEQ ID NO:74), GGGGG (SEQ ID NO:75), GS, GGS, GGGS (SEQ ID NO:68), GGGGS (SEQ ID NO:69), SS, SSS, SSSS (SEQ ID NO:70), KGGK (SEQ ID NO:72), and GGGK (SEQ ID NO:73).
  • said linker comprises or consists of an amino acid sequence selected from the group consisting of GG, GGG, GGGG (SEQ ID NO:74), GGGGG (SEQ ID NO:75), GS, GGS, GGGS (SEQ ID NO:68), GGGGS (SEQ ID NO:69), SS, SSS, SSSS (SEQ ID NO:70), KGGK (SEQ ID NO:72), and GGGK (SEQ ID NO:73).
  • Embodiment 180 The antimicrobial peptide of embodiment 174, wherein the amino acid sequence of said antimicrobial peptide attached to a targeting peptide construct consists of the sequence L ATKLK YEKEHKKMGKLF GAL WPL ALGALK LLK (SEQ ID NO: 100).
  • Embodiment 181 The antimicrobial peptide of embodiment 180, wherein the amino acids comprising said antimicrobial peptide attached to a targeting peptide are "D" amino acids.
  • Embodiment 182 The antimicrobial peptide of embodiment 181, wherein said antimicrobial peptide attached to a targeting peptide is amidated at the carboxyl terminus.
  • peptide refers to a polymer of amino acid residues typically ranging in length from 2 to about 30, or to about 40, or to about 50, or to about 60, or to about 70 residues. In certain embodiments the peptide ranges in length from about 2, 3, 4, 5, 7, 9, 10, or 11 residues to about 60, 50, 45, 40, 45, 30, 25, 20, or 15 residues. In certain embodiments the peptide ranges in length from about 8, 9, 10, 11, or 12 residues to about 15, 20 or 25 residues.
  • amino acid residues comprising the peptide are "L-form” amino acid residues, however, it is recognized that in various embodiments, "D" amino acids can be incorporated into the peptide or the peptide can comprise all "D” amino acids.
  • Peptides also include amino acid polymers in which one or more amino acid residues is an artificial chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers.
  • the term applies to amino acids joined by a peptide linkage or by other, "modified linkages" (e.g., where the peptide bond is replaced by an a-ester, a ⁇ -ester, a thioamide, phosphonamide, carbomate, hydroxylate, and the like (see, e.g., Spatola, (1983) Chem. Biochem. Amino Acids and Proteins 7: 267-357), where the amide is replaced with a saturated amine (see, e.g., Skiles et al, U.S. Pat. No. 4,496,542, which is incorporated herein by reference, and Kaltenbronn et al., (1990) Pp. 969- 970 in Proc. 11th American Peptide Symposium, ESCOM Science Publishers, The
  • amino acid analogues include, but are not limited to 2-aminoadipic acid, 3-aminoadipic acid, beta-alanine (beta-aminopropionic acid), 2-aminobutyric acid, 4- aminobutyric acid, piperidinic acid, 6-aminocaproic acid, 2-aminoheptanoic acid, 2- aminoisobutyric acid, 3-aminoisobutyric acid, 2-aminopimelic acid, 2,4 diaminobutyric acid, desmosine, 2,2'-diaminopimelic acid, 2,3-diaminopropionic acid, N-ethylglycine, N- ethylasparagine, hydroxylysine, allo-hydroxylysine, 3-hydroxyproline, 4-hydroxyproline, isodesmosine, allo-isoleucine, N-methylgly
  • STAMP refers to Specifically Targeted Anti-Microbial Peptides.
  • a STAMP comprises one or more targeting peptides (e.g., peptides that bind preferentially or specifically to C. difficile) attached to one or more antimicrobial moieties (e.g., antimicrobial peptides (AMPs)).
  • An MH-STAMP is a STAMP bearing two or more targeting domains (i.e., a multi -headed STAMP).
  • ⁇ -peptides contain one or more or comprises all “ ⁇ amino acids”, which have their amino group bonded to the ⁇ carbon rather than the a-carbon as in the 20 standard biological amino acids.
  • the only commonly naturally occurring ⁇ amino acid is ⁇ -alanine.
  • Peptoids or N-substituted glycines, are a specific subclass of peptidomimetics.
  • non-natural compounds that correspond to the peptides described herein comprising all naturally-occuring amino acids.
  • a compound “corresponds" to a natural peptide if it elicits a biological activity (e.g., antimicrobial activity and/or C. difficile binding) related to the biological activity and/or specificity of the
  • the elicited activity may be the same as, greater than or less than that of the natural peptide.
  • non-natural compounds contemplated herein comprises peptoids.
  • a peptoid has an essentially corresponding monomer sequence as the "conventional" peptide, where a natural amino acid is replaced by an N-substituted glycine derivative, if the N-substituted glycine derivative resembles the original amino acid in hydrophilicity, hydrophobicity, polarity, etc.
  • substitutions need not be "exact”.
  • N-(2- hydroxyethyl)glycine may substitute for S, T, C, and/or M.
  • N-hydroxyalkyl-substituted glycine to substitute for any polar amino acid
  • an N-benzyl- or N- aralkyl-substituted glycine to replace any aromatic amino acid
  • an N-alkyl-substituted glycine such as N-butylglycine to replace any nonpolar amino acid (e.g., L, V, I, etc.)
  • an N-(aminoalkyl)glycine to replace any basic polar amino acid (e.g., K and R).
  • L-, D-, or beta amino acid versions of the sequence are also contemplated as well as retro, inversion (inverso), and retro- inversion (retroinverso) isoforms.
  • conservative substitutions e.g., in the targeting peptide, and/or antimicrobial peptide, and/or linker peptide (when present)
  • Non-protein backbones such as PEG, alkane, ethylene bridged, ester backbones, and other backbones are also contemplated.
  • fragments ranging in length from about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids up to the full length minus one amino acid of the peptide are contemplated where the fragment retains at least 50%, preferably at least 60% 70% or 80%, more preferably at least 90%, 95%, 98%, 99%, or at least 100% of the activity (e.g., binding specificity and/or avidity, antimicrobial activity, etc.) of the full length peptide are contemplated.
  • activity e.g., binding specificity and/or avidity, antimicrobial activity, etc.
  • conservative substitutions of the amino acids comprising any of the sequences described herein are contemplated. In various embodiments one, two, three, four, or five different residues are substituted.
  • the term "conservative substitution” is used to reflect amino acid substitutions that do not substantially alter the activity (e.g., antimicrobial activity and/or specificity) of the molecule.
  • conservative amino acid substitutions involve substitution one amino acid for another amino acid with similar chemical properties (e.g. charge or hydrophobicity).
  • Certain conservative substitutions include "analog substitutions" where a standard amino acid is replaced by a nonstandard (e.g., rare, synthetic, etc) amino acid differing minimally from the parental residue.
  • Amino acid analogs are considered to be derived synthetically from the standard amino acids without sufficient change to the structure of the parent, are isomers, or are metabolite precursors.
  • Examples of such "analog substitutions” include, but are not limited to, 1) Lys- Orn, 2) Leu-Norleucine, 3) Lys-Lys[TFA], 4) Phe-Phe[Gly], and 5) ⁇ -amino butylglycine- ⁇ - amino hexylglycine, where Phe[gly] refers to phenylglycine(a Phe derivative with a H rather than CH 3 component in the R group), and Lys[TFA] refers to a Lys where a negatively charged ion (e.g., TFA) is attached to the amine R group.
  • a negatively charged ion e.g., TFA
  • substitutions where amino acids replace other amino acids from the same biochemical or biophysical grouping. This is similarity at a basic level and stems from efforts to classify the original 20 natural amino acids.
  • substitutions include 1) nonpolar side chains:
  • any hydrophilic neutral pair [Ser, Thr, Gin, Asn, Tyr, Cys] + [Ser, Thr, Gin, Asn, Tyr, Cys] can may be replaced by a charge-neutral charged pair [Arg, Lys, His] + [Asp, Glu].
  • the following six groups each contain amino acids that, in certain embodiments, are typical conservative substitutions for one another: 1) Alanine (A), Serine (S), Threonine (T); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K), Histidine (H); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).
  • amino acid sequences are disclosed herein, amino acid sequences comprising, one or more of the above-identified conservative substitutions are also contemplated.
  • STAMPs compromising at least 80%, preferably at least 85% or 90%, and more preferably at least 95%) or 98%> sequence identity with any of the sequences described herein are also contemplated.
  • the terms "identical” or percent “identity,” refer to two or more sequences that are the same or have a specified percentage of amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
  • sequence identity is determined over the full length of the peptide. For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
  • sequence comparison algorithm calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman (1981) Adv. Appl. Math. 2: 482, by the homology alignment algorithm of Needleman & Wunsch (1970) J. Mol. Biol. 48: 443, by the search for similarity method of Pearson & Lipman (1988) Proc. Natl. Acad. Sci., USA, 85: 2444, by computerized implementations of these algorithms (GAP, BESTFIT, FAST A, and TFASTA in the
  • the term "specificity" when used with respect to the antimicrobial activity of a peptide indicates that the peptide preferentially binds to and/or inhibits growth and/or proliferation and/or kills a particular microbial species as compared to other related and/or unrelated microbes.
  • the preferential inhibition or killing is at least 10% greater (e.g., LD 50 is 10% lower), preferably at least 20%, 30%, 40%, or 50%, more preferably at least 2-fold, at least 5-fold, or at least 10-fold greater for the target species.
  • Treating" or “treatment” of a condition as used herein may refer to preventing the condition, slowing the onset or rate of development of the condition, reducing the risk of developing the condition, preventing or delaying the development of symptoms associated with the condition, reducing or ending symptoms associated with the condition, generating a complete or partial regression of the condition, or some combination thereof.
  • antimicrobial peptide (AMP) or STAMP indicates that the peptide, or variants, analogues, or derivatives thereof possess substantially the same or greater antimicrobial activity and/or specificity as the referenced peptide or STAMP.
  • substantially the same or greater antimicrobial activity indicates at least 80%>, preferably at least 90%, more preferably at least 95%, and most preferably at least 98%, or at least 99%), or at least 100% of the antimicrobial activity of the referenced peptide(s) or STAMPs against a particular bacterial species (e.g., Clostridium difficile).
  • isolated refers to material that is substantially or essentially free from components that normally accompany it as found in its native state.
  • an isolated (naturally occurring) peptide is typically substantially free of components with which it is associated in the cell, tissue, or organism.
  • isolated also indicates that the peptide is not present in a phage display, yeast display, or other peptide library.
  • amino acid abbreviations shown in Table 1 are used herein.
  • Figure 1 shows activity of STAMPs against C. difficile spores.
  • Figure 2 shows anti-C. difficile activity of STAMPs in a hamster
  • Figure 3 shows anti-C. difficile activity of STAMPs in mouse pharmacology model with prevention of recurrence. Improvement is seen over the standard of care (Vancomycin).
  • antimicrobial peptides and constructs comprising targeting peptides that bind ⁇ e.g., that preferentially and/or specifically bind to Clostridium difficile) attached to antimicrobial peptides are provided.
  • STAMPs antimicrobial peptides and constructs
  • the antimicrobial peptides can be used alone to kill various microorganisms.
  • the STAMPs are effective to target and kill C. difficile.
  • constructs that comprise a targeting peptide that binds C. difficile attached to an antimicrobial peptide.
  • the targeting peptide comprises an amino acid sequence based on OR CD0126 (CD17) for the targeting peptide.
  • Suitable targeting peptides include, but are not limited to one or more of the peptides shown in Table 2.
  • the targeting peptide comprises or consists of the amino acid sequence
  • X 4 is K or L, or conservative substitutions thereof
  • X 5 is K or L, or conservative substitutions thereof
  • X 8 is E or L, or conservative substitutions thereof
  • X 10 is E, L, or K, or conservative substitutions thereof
  • X 14 is M or K, or conservative substitutions thereof.
  • X 5 is K.
  • X 5 is L.
  • X' is E.
  • X 8 is L.
  • X 10 is E.
  • X 10 is L.
  • X 10 is K.
  • X 14 is M, and in certain embodiments, X 14 is K.
  • C. difficile peptides need not be limited to those described above.
  • other illustrative targeting peptides that bind C. difficile are shown in Table 3 and the use of any one or more of these peptides in the constructs described herein is also contemplated.
  • the targeting peptide(s) are attached (directly or through a linker (e.g., an amino acid, a peptide linker, a heterobifunctional linker, etc.)) to one or more antimicrobial peptide(s) (AMP(s)) thereby affording specificity/selectivity to the antimicrobial peptide.
  • a linker e.g., an amino acid, a peptide linker, a heterobifunctional linker, etc.
  • STAMPs antimicrobial peptides or "STAMPs”.
  • the targeting peptide may comprise any one or more of the amino acids sequences shown in Tables 2 or 3.
  • the targeting peptide(s) may range in length up to about 100 amino acids or up to about 80 amino acids, or up to about 60 amino acids, or up to about 50 amino acids, or up to about 45 amino acids, or up to about 40 amino acids, or up to about 35 amino acids, or up to about 30 amino acids, or up to about 25 amino acids, or up to about 20 amino acids, or up to about 15 amino acids.
  • the targeting peptide comprises one copy of an amino acid sequence shown in Tables 2 or 3.
  • the targeting peptide comprises at least two copies, or at least 3 copies, or at least 4 copies, or at least 5 copies of a targeting peptide sequence shown in Tables 2 or 3. In certain embodiments the targeting peptide comprises at least two different sequence, or at least 3 different sequences, or at least 4 different sequences, or at least 5 different amino acid sequences shown in Tables 2 or 3. In certain embodiments the targeting peptide consists of one of the amino acid sequences shown in Tables 2 or 3. [0262] In certain embodiments any of the amino acid sequences shown in Tables 2 or
  • any of the amino acid sequences shown in Tables 2 or 3 comprise all beta amino acids or all "D" amino acids.
  • any of the foregoing peptides can comprise at least one conservative substitution, or at least two conservative substitutions, or at least 3 conservative substitutions, or at least 4 conservative substitutions, or at least 5 conservative substitutions. In certain embodiments any of the foregoing peptides can comprise at least 1 internal deletion, at least 2 internal deletions, at least 3 internal deletions, or at least 4 internal deletions.
  • any of the foregoing peptides can comprise at least 1 carboxyl and/or amino terminal truncation, or at least 2 carboxyl and/or amino terminal truncations, or at least 3 carboxyl and/or amino terminal truncations, or at least 4 carboxyl and/or amino terminal truncations, or at least 5 carboxyl and/or amino terminal truncations.
  • C. difficile targeting peptides are illustrative and non-limiting.
  • STAMPs selectively targeted antimicrobial peptides
  • the antimicrobial peptide comprises an antimicrobial peptide derived from a tree frog ⁇ e.g., hylin al) or a variant thereof.
  • a tree frog e.g., hylin al
  • antimicrobial peptides derived from or related to hylin al are shown in below in Table 4. (SEQ ID NO:46)
  • Table 4 Illustrative tree frog antimicrobial peptides and variants thereof. Arrows show sites of mutation from I to L.
  • the tree frog antimicrobial peptide or analog thereof comprises the amino acid sequence:
  • Xi 1 is I or F, or conservative substitutions thereof
  • Xi 2 is F, L, or I, or conservative substitutions thereof
  • Xi 4 is A or P, or conservative substitutions thereof
  • Xi 5 is I or V, or conservative substitutions thereof
  • Xi 6 is W or L, or conservative substitutions thereof
  • Xi 7 is P, S, or G, or conservative substitutions thereof
  • Xi 8 is L or A, or conservative substitutions thereof
  • Xi 9 is A, I, or V, or conservative substitutions thereof
  • Xi 10 is L, A, S, or G, or conservative substitutions thereof
  • Xi 11 is G, S, or N, or conservative substitutions thereof
  • Xi 12 is A or L, or conservative substitutions thereof
  • X U is V or L, or conservative substitutions thereof
  • Xi 14 is K, G, or H, or conservative substitutions thereof
  • Xi 15 is N or G, or conservative substitutions thereof
  • Xi 17 is I or L, or conservative
  • X 1 , X 1 and X 1 are independently I or L; and X 1 is K or N; and when X 1 is K at
  • Xi , Xi or Xi is L. In certain embodiments at least one of Xi , Xi or Xi ' is L. In certain embodiments Xi 18 is N. In certain embodiments Xi 18 is K. In certain embodiments
  • Xi is L, Xi is I, and X 1 is I. In certain embodiments X 1 is I, X 1 is L, and X 1 is I. In certain embodiments Xi 1 is I, Xi 5 is I, and Xi 17 is L. In certain embodiments Xi 1 is L, Xi 5 is L, and Xi 17 is I. In certain embodiments Xi 1 is L, Xi 5 is I, and Xi 17 is L. In certain embodiments Xi 1 is I, Xi 5 is L, and Xi 17 is L. In certain embodiments Xi 1 is I, Xi 5 is L, and Xi 17 is L. In certain embodiments Xi 1 is L, Xi 5 is L, and Xi 17 is L. In certain embodiments Xi 1 is L, Xi 5 is L, and Xi 17 is L. In certain embodiments the above amino acid sequence of the antimicrobial peptide comprises or consists of the sequence:
  • Xi°Xi 1 FGAXi 5 WPLALGALKNLXi 17 Xi 18 (SEQ ID NO:62) where Xi° is K or D. In certain embodiments Xi° is K. In certain embodiments Xi° is D. In certain embodiments the above- amino acid sequence of the antimicrobial peptide comprises or consists of the sequence:
  • Xi 19 is K, N, or R. In certain embodiments Xi 19 is K. In certain embodiments Xi 19 is R. In certain embodiments Xi 19 is N. In certain embodiments the above amino acid sequence of the antimicrobial peptide comprises or consists of the sequence
  • X 1 is I or L. In certain embodiments X 1 is I. In certain embodiments X 1 is L.
  • the antimicrobial peptide comprises or consists of a sequence selected from the group consisting of KLFGALWPL ALGALKNLLK (SEQ ID NO:47), IFGAILPLALGALKNLIK(SEQ ID NO:48), ILGPVLSLVGSALGGLIKKI (SEQ ID NO:49), ILGP VL SL VGN ALGGLIKKI (SEQ ID NO:50),
  • ILGPVLGLVGNALGGLLKNL SEQ ID NO: 51
  • ILGPVLGLVSNALGGLLKNL SEQ ID NO:52
  • FIGAILPAIAGLVHGLINR SEQ ID NO:53
  • FIGAILPAIAGLVGGLINR SEQ ID NO: 54
  • DIFGAILPLALGALKNLIK SEQ ID NO: 55
  • KIFGAILPLALGALKNLIK SEQ ID NO:56
  • the above amino acid sequence of the antimicrobial peptide comprises or consists of the sequence:
  • X 2 2 is I. In certain embodiments X 2 2 is L. In certain embodiments X 2 2 is K. In certain embodiments X 2 2 is V. In certain embodiments X 2 2 is Nle. In certain embodiments X 2 4 is G. In certain embodiments X 2 4 is K. In certain embodiments X 2 6 is I. In certain embodiments X 2 6 is L. In certain embodiments X 2 6 is K. In certain embodiments X 2 6 is V. In certain embodiments X 2 6 is Nle. In certain embodiments X 2 7 is W. In certain embodiments X 2 7 is K. In certain embodiments X 2 10 is A. In certain embodiments X 2 10 is W. In certain embodiments X 2 10 is P.
  • X 2 U is L. In certain embodiments X 2 U is K. In certain embodiments X 2 18 is I. In certain embodiments X 2 18 is L. In certain embodiments X 2 18 is V. In certain embodiments X 2 18 is Nle. In certain embodiments the amino acid sequence of said antimicrobial peptide comprises a sequence selected from the group consisting of KLFGALWPLALGALKNLLK (SEQ ID NO:47), KIFGAIWPLALGALKNLIK (SEQ ID NO:48),
  • KVFGAVWPLALGALKNLVK (SEQ ID NO: 49), KXFGAXWPLALGALKNLXK (SEQ ID NO:50), KIFKAIWPLALGALKNLIK (SEQ ID NO:51), KIFKAIKPLALGALKNLIK (SEQ ID NO:52), KIFKAIKPLAKGALKNLIK (SEQ ID NO:53),
  • KIFKAIKPLWKGALKNLIK (SEQ ID NO: 54), KIFKAKKPLWKGALKNLIK (SEQ ID NO:55), KIFKAIKPLWLGALKNLIK (SEQ ID NO:56), KKF GAIWPL ALGALKNLIK (SEQ ID NO:57), KIF GAIW ALPLGALKNLIK (SEQ ID NO:58),
  • constructs are contemplated that incorporate a targeting enhancer (e.g., an opsonin) along with one or more targeting peptides.
  • Targeting enhancers include moieties that increase binding affinity, and/or binding specificity, and/or internalization of a moiety by the target cell/microorganism.
  • a targeting peptide and/or a targeted antimicrobial molecule comprise a targeting peptide described herein attached (e.g., conjugated) to an opsonin.
  • the opsonin component When bound to a target cell through the targeting peptide, the opsonin component encourages phagocytosis and destruction by resident macrophages, dendritic cells, monocytes, or PMNs.
  • Opsonins contemplated for conjugation can be of a direct or indirect type.
  • Direct opsonins include, for example, any bacterial surface antigen, PAMP
  • Opsonins can include, but are not limited to, bacterial protein, lipid, nucleic acid, carbohydrate and/or oligosaccharide moieties.
  • opsonins include, but are not limited to, N-acetyl-D- glucosamine (GlcNAc), N-acetyl-D-galactosamine (GlaNAc), N-acetylglucosamine- containing muramyl peptides, NAG-muramyl peptides, NAG-NAM, peptidoglycan, teichoic acid, lipoteichoic acid, LPS, o-antigen, mannose, fucose, ManNAc, galactose, maltose, glucose, glucosamine, sucrose, mannosamine, galactose-alpha-l,3-galactosyl-beta-l,4-N- acetyl glucosamine, or alpha- 1,3 -gal -gal, or other sugars.
  • GlcNAc N-acetyl-D- glucosamine
  • GaNAc N-acet
  • opsonins include indirect opsonins. Indirect opsonins function through binding to a direct opsonin already present.
  • the opsonin is galactose-alpha-l,3-galactosyl -beta- 1,4-
  • N-acetyl glucosamine or alpha-/, 3-gal -gal.
  • opsonin molecules include, but are not limited to antibodies
  • C3b e.g., IgG and IgA
  • components of the complement system e.g., C3b, C4b, and iC3b
  • MBL mannose-binding lectin
  • one or more C. difficile targeting peptides described herein can be attached to an antimicrobial peptide (e.g., an antimicrobial peptide described above) to provide a specifically targeted antimicrobial peptide (STAMP).
  • the targeting peptide can be attached to the amino terminus or the carboxyl terminus of the antimicrobial peptide.
  • the attachment is direct. In other embodiments, the attachment is via an amino acid or a peptide linker.
  • the peptide linker is relatively short, typically less than about 15 amino acids, or less than about 10 amino acids, preferably less than about 8 amino acids and more preferably about 2 or about 3 to about 5, or to about 6, or to about 7, or to about 8, or to about 9, or to about 10 amino acids.
  • the C. difficile targeting peptide is attached directly to an effector ⁇ e.g., an AMP).
  • the linker is a single amino acid (e.g., A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V).
  • the linker is 2 amino acids, or 3 amino acids, or 4 amino acids, or 5 amino acids, or 6 amino acids, or 7 amino acids, or 8 amino acids, or 9 amino acids, or 10 amino acids, or 11 amino acids, or 12 amino acids, or 13 amino acids, or 14 amino acids, or 15 amino acids, or 16 amino acids, or 17 amino acids, or 18 amino acids, or 19 amino acids, or 20 amino acids, or 21 amino acids, or 22 amino acids, or 23 amino acids, or 24 amino acids, or 25 amino acids in length.
  • Suitable linkers include, but are not limited to the linkers shown in Table 5.
  • one or more targeting peptides are attached to a single antimicrobial peptide.
  • one or more antimicrobial peptides are attached to a single targeting peptide.
  • multiple targeting peptides are attached to multiple antimicrobial peptides.
  • a single targeting peptide is attached to a single antimicrobial peptide.
  • Illustrative, but non-limiting, examples of anti-C. difficile STAMPs are shown in Table 6. Table 6. Illustrative stamps directed against C. difficile. Single underline: linker. Double underline: Antimicrobial peptide. No underline: targeting peptide. In certain embodiments any one of these STAMPs comprises all "D" amino acids.
  • any one of these STAMPs comprises all "L" amino acids. In certain embodiments any one of these STAMPs comprises NH 2 attached to the carboxyl terminus. In certain embodiments any one of these STAMPs comprises acetyl attached to the amino terminus.
  • X is Nleu.
  • the STAMPS described herein may comprise any one or more of the amino acids sequences shown in Table 6.
  • the amino acids sequences shown in Table 6 may comprise any one or more of the amino acids sequences shown in Table 6.
  • STAMP(s) may range in length up to about 100 amino acids or up to about 80 amino acids, or up to about 60 amino acids, or up to about 50 amino acids, or up to about 45 amino acids, or up to about 40 amino acids, or up to about 35 amino acids, or up to about 30 amino acids.
  • any of the STAMPs described herein can comprise at least one beta amino acid, or at least one "D” amino acid, or at least 2 beta amino acids, or at least two "D” amino acids, or at least 3 beta amino acids, or at least 3"D” amino acids, or at least 4 beta amino acids, or at least 4 "D” amino acids, or at least 5 beta amino acids, or at least 5 "D” amino acids, or at least 6 beta amino acids, or at least 6 "D” amino acids, or at least 7 beta amino acids, or at least 7 "D” amino acids, or at least 8 beta amino acids, or at least 8 "D” amino acids, or at least 9 beta amino acids, or at least 9 "D” amino acids, or at least 10 beta amino acids, or at least 10 "D” amino acids.
  • any of the STAMPs described herein (including, but not limited to the STAMPs shown in Table 6) comprise all beta amino acids or all "D" amino acids, or all "L” amino acids. [0283] In certain embodiments any of the STAMPs described herein (including, but not limited to the STAMPs shown in Table 6) can comprise at least one conservative substitution, or at least two conservative substitutions, or at least 3 conservative substitutions, or at least 4 conservative substitutions, or at least 5 conservative substitutions.
  • any of the in certain embodiments any of the STAMPs described herein can comprise at least 1 internal deletion, at least 2 internal deletions, at least 3 internal deletions, or at least 4 internal deletions.
  • any of the in certain embodiments any of the STAMPs described herein can comprise at least 1 carboxyl and/or amino terminal truncation, or at least 2 carboxyl and/or amino terminal truncations, or at least 3 carboxyl and/or amino terminal truncations, or at least 4 carboxyl and/or amino terminal truncations, or at least 5 carboxyl and/or amino terminal truncations.
  • the peptides described herein can be chemically synthesized using standard chemical peptide synthesis techniques or, particularly where the peptide does not comprise "D" amino acid residues, the peptide can be recombinantly expressed.
  • a host organism e.g., bacteria, plant, fungal cells, etc.
  • a host organism can be cultured in an environment where one or more of the amino acids is provided to the organism exclusively in a D form. Recombinantly expressed peptides in such a system then incorporate those D amino acids.
  • D amino acids can be incorporated in recombinantly expressed peptides using modified amino acyl-tRNA synthetases that recognize D-amino acids.
  • the peptides are chemically synthesized by any of a number of fluid or solid phase peptide synthesis techniques known to those of skill in the art.
  • Solid phase synthesis in which the C-terminal amino acid of the sequence is attached to an insoluble support followed by sequential addition of the remaining amino acids in the sequence is a preferred method for the chemical synthesis of the polypeptides of this invention.
  • Techniques for solid phase synthesis are well known to those of skill in the art and are described, for example, by Barany and Merrifield (1963) Solid-Phase Peptide Synthesis; pp. 3-284 in The Peptides: Analysis, Synthesis, Biology. Vol. 2: Special Methods in Peptide Synthesis, Part A.; Merrifield et al. (1963) J. Am. Chem. Soc, 85: 2149-2156, and Stewart et al. (1984) Solid Phase Peptide Synthesis, 2nd ed. Pierce Chem. Co., Rockford, 111.
  • the peptides can be synthesized by the solid phase peptide synthesis procedure using a benzhydrylamine resin (Beckman Bioproducts, 0.59 mmol of NH 2 /g of resin) as the solid support.
  • the COOH terminal amino acid ⁇ e.g., t-butylcarbonyl-Phe
  • peptides particularly peptides comprising D amino acids
  • the synthesis usually produces a number of truncated peptides in addition to the desired full-length product.
  • the peptides are typically purified using standard methods well known to those of skill in the art, e.g., HPLC.
  • D-amino acids, beta amino acids, non-natural amino acids, and the like can be incorporated at one or more positions in the peptide simply by using the appropriately derivatized amino acid residue in the chemical synthesis.
  • Modified residues for solid phase peptide synthesis are commercially available from a number of suppliers ⁇ see, e.g., Advanced Chem Tech, Louisville; Nova Biochem, San Diego; Sigma, St Louis; Bachem California Inc., Torrance, etc.).
  • the D-form and/or otherwise modified amino acids can be completely omitted or incorporated at any position in the peptide as desired.
  • the peptide can comprise a single modified acid, while in other embodiments, the peptide comprises at least two, generally at least three, more generally at least four, most generally at least five, preferably at least six, more preferably at least seven or even all modified amino acids. In certain embodiments, essentially every amino acid is a D-form amino acid.
  • the described antimicrobial peptides and/or constructs described herein can also be recombinantly expressed. Accordingly, in certain embodiments, the antimicrobial peptides and/or STAMPs described herein are synthesized using
  • recombinant expression systems Generally this involves creating a DNA sequence that encodes the desired peptide or fusion protein, placing the DNA in an expression cassette under the control of a particular promoter, expressing the peptide or fusion protein in a host, isolating the expressed peptide or fusion protein and, if required, renaturing the peptide or fusion protein.
  • DNA encoding the peptide(s) or fusion protein(s) described herein can be prepared by any suitable method as described above, including, for example, cloning and restriction of appropriate sequences or direct chemical synthesis.
  • This nucleic acid can be easily ligated into an appropriate vector containing appropriate expression control sequences (e.g. promoter, enhancer, etc.), and, optionally, containing one or more selectable markers (e.g. antibiotic resistance genes).
  • appropriate expression control sequences e.g. promoter, enhancer, etc.
  • selectable markers e.g. antibiotic resistance genes
  • the nucleic acid sequences encoding the peptides or fusion proteins described herein can be expressed in a variety of host cells, including, but not limited to, E. coli, other bacterial hosts, yeast, fungus, and various higher eukaryotic cells such as insect cells (e.g. SF3), the COS, CHO and HeLa cells lines and myeloma cell lines.
  • the recombinant protein gene will typically be operably linked to appropriate expression control sequences for each host.
  • this can include a promoter such as the T7, trp, or lambda promoters, a ribosome binding site and preferably a transcription termination signal.
  • control sequences can include a promoter and often an enhancer (e.g., an enhancer derived from immunoglobulin genes, SV40, cytomegalovirus, etc.), and a polyadenylation sequence, and may include splice donor and acceptor sequences.
  • an enhancer e.g., an enhancer derived from immunoglobulin genes, SV40, cytomegalovirus, etc.
  • a polyadenylation sequence and may include splice donor and acceptor sequences.
  • the plasmids can be transferred into the chosen host cell by well-known methods such as calcium chloride transformation for E. coli and calcium phosphate treatment or electroporation for mammalian cells.
  • Cells transformed by the plasmids can be selected by resistance to antibiotics conferred by genes contained on the plasmids, such as the amp, gpt, neo and yg genes.
  • the recombinant peptide(s) or fusion protein(s) can be purified according to standard procedures of the art, including ammonium sulfate
  • the peptide(s) or fusion protein(s) may possess a conformation substantially different than desired native conformation. In this case, it may be necessary to denature and reduce the peptide or fusion protein and then to cause the molecule to re-fold into the preferred conformation. Methods of reducing and denaturing proteins and inducing re-folding are well known to those of skill in the art ⁇ see, e.g., Debinski et al. (1993) J. Biol. Chem., 268: 14065-14070; Kreitman and Pastan (1993) Bioconjug.
  • Debinski et al describes the denaturation and reduction of inclusion body proteins in guanidine-DTE. The protein is then refolded in a redox buffer containing oxidized glutathione and L-arginine.
  • modifications can be made to the peptide(s) and/or fusion protein(s) proteins without diminishing their biological activity. Some modifications may be made to facilitate the cloning, expression, or incorporation of the targeting molecule into a fusion protein. Such modifications are well known to those of skill in the art and include, for example, a methionine added at the amino terminus to provide an initiation site, or additional amino acids (e.g., poly His) placed on either terminus to create conveniently located restriction sites or termination codons or purification sequences.
  • one or more targeting peptide(s) described herein are chemically conjugated to one or more antimicrobial peptides.
  • the targeting peptides are conjugated directly to the antimicrobial peptide (s) via naturally occurring reactive groups or the targeting peptide(s) and/or the antimicrobial peptide (s) can be functionalized to provide such reactive groups.
  • the targeting peptides are attached to antimicrobial peptide(s) via one or more linking agents.
  • the targeting peptides and the antimicrobial peptide(s) can be conjugated via a single linking agent or multiple linking agents.
  • the targeting peptide and the antimicrobial peptide can be conjugated via a single multifunctional (e.g., bi-, tri-, or tetra-) linking agent or a pair of complementary linking agents.
  • the targeting peptide and the antimicrobial peptide are conjugated via two, three, or more linking agents.
  • Suitable linking agents include, but are not limited to, e.g., functional groups, affinity agents, stabilizing groups, and combinations thereof.
  • the linking agent is or comprises a functional group.
  • Functional groups include monofunctional linkers comprising a reactive group as well as multifunctional crosslinkers comprising two or more reactive groups capable of forming a bond with two or more different functional targets (e.g., labels, proteins, macromolecules, semiconductor nanocrystals, or substrate).
  • functional targets e.g., labels, proteins, macromolecules, semiconductor nanocrystals, or substrate.
  • multifunctional crosslinkers are heterobifunctional crosslinkers comprising two or more different reactive groups.
  • Suitable reactive groups include, but are not limited to thiol (-SH), carboxylate
  • Amine reactive groups include, but are not limited to e.g., isothiocyanates, isocyanates, acyl azides, NHS esters, sulfonyl chlorides, aldehydes and glyoxals, epoxides and oxiranes, carbonates, arylating agents, imidoesters, carbodiimides, and anhydrides.
  • Thiol -reactive groups include, but are not limited to e.g., haloacetyl and alkyl halide derivates, maleimides, aziridines, acryloyl derivatives, arylating agents, and thiol- disulfides exchange reagents.
  • Carboxylate reactive groups include, but are not limited to e.g., diazoalkanes and diazoacetyl compounds, such as carbonyldiimidazoles and carbodiimides.
  • Hydroxyl reactive groups include, but are not limited to e.g., epoxides and oxiranes,
  • Aldehyde and ketone reactive groups include, but are not limited to e.g., hydrazine derivatives for schiff base formation or reduction amination.
  • Active hydrogen reactive groups include, but are not limited to e.g., diazonium derivatives for mannich condensation and iodination reactions.
  • Photoreactive groups include, but are not limited to e.g., aryl azides and halogenated aryl azides, benzophenones, diazo compounds, and diazirine derivatives.
  • Suitable reactive groups and classes of reactions useful in forming chemical conjugates include those that are well known in the art of bioconjugate chemistry.
  • Currently favored classes of reactions available with reactive chelates are those which proceed under relatively mild conditions. These include, but are not limited to, nucleophilic substitutions (e.g., reactions of amines and alcohols with acyl halides, active esters), electrophilic substitutions (e.g., enamine reactions), and additions to carbon-carbon and carbon- heteroatom multiple bonds (e.g., Michael reaction, Diels- Alder addition).
  • a “linker” or “linking agent” as used herein, is a molecule that is used to join two or more molecules.
  • the linker is typically capable of forming covalent bonds to both molecule(s) ⁇ e.g., the targeting peptide and the effector).
  • Suitable linkers are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers.
  • the linkers can be joined to the constituent amino acids through their side groups ⁇ e.g., through a disulfide linkage to cysteine). However, in certain embodiments, the linkers will be joined to the alpha carbon amino and carboxyl groups of the terminal amino acids.
  • a bifunctional linker having one functional group reactive with a group on one molecule ⁇ e.g., a targeting peptide), and another group reactive on the other molecule ⁇ e.g., an antimicrobial peptide), can be used to form the desired conjugate.
  • a group on one molecule e.g., a targeting peptide
  • another group reactive on the other molecule e.g., an antimicrobial peptide
  • derivatization can be performed to provide functional groups.
  • procedures for the generation of free sulfhydryl groups on peptides are also known (See U.S. Pat. No. 4,659,839).
  • the linking agent is a heterobifunctional crosslinker comprising two or more different reactive groups that form a heterocyclic ring that can interact with a peptide.
  • a heterobifunctional crosslinker such as cysteine may comprise an amine reactive group and a thiol-reactive group can interact with an aldehyde on a derivatized peptide. Additional combinations of reactive groups suitable for
  • heterobifunctional crosslinkers include, for example, amine- and sulfhydryl reactive groups; carbonyl and sulfhydryl reactive groups; amine and photoreactive groups; sulfhydryl and photoreactive groups; carbonyl and photoreactive groups; carboxylate and photoreactive groups; and arginine and photoreactive groups.
  • the heterobifunctional crosslinker is SMCC.
  • the various constructs e.g., anti-C. difficile STAMPs
  • antimicrobial peptides may be shown herein with no protecting groups, in certain embodiments they can bear one, two, three, four, or more protecting groups.
  • the protecting groups can be coupled to the C- and/or N-terminus of the antimicrobial peptide(s) and/or constructs and/or to one or more internal residues comprising the antimicrobial peptide(s) and/or constructs ⁇ e.g., one or more R-groups on the constituent amino acids can be blocked).
  • any of the protecting groups can be coupled to the C- and/or N-terminus of the antimicrobial peptide(s) and/or constructs and/or to one or more internal residues comprising the antimicrobial peptide(s) and/or constructs ⁇ e.g., one or more R-groups on the constituent amino acids can be blocked).
  • STAMPs described herein can bear, e.g., an acetyl group protecting the amino terminus and/or an amide group protecting the carboxyl terminus.
  • a wide number of protecting groups are suitable for this purpose.
  • Such groups include, but are not limited to acetyl, amide, and alkyl groups with acetyl and alkyl groups being particularly preferred for N-terminal protection and amide groups being preferred for carboxyl terminal protection.
  • the protecting groups include, but are not limited to alkyl chains as in fatty acids, propionyl, formyl, and others.
  • Particularly preferred carboxyl protecting groups include amides, esters, and ether-forming protecting groups.
  • an acetyl group is used to protect the amino terminus and an amide group is used to protect the carboxyl terminus.
  • Certain particularly preferred blocking groups include alkyl groups of various lengths, e.g., groups having the formula: CH 3 -(CH 2 ) n -CO- where n ranges from about 1 to about 20, preferably from about 1 to about 16 or 18, more preferably from about 3 to about 13, and most preferably from about 3 to about 10.
  • the protecting groups include, but are not limited to alkyl chains as in fatty acids, propionyl, formyl, and others.
  • Particularly preferred carboxyl protecting groups include amides, esters, and ether-forming protecting groups.
  • an acetyl group is used to protect the amino terminus and/or an amino group is used to protect the carboxyl terminus ⁇ i.e., amidated carboxyl terminus).
  • blocking groups include alkyl groups of various lengths, e.g., groups having the formula: CH 3 -(CH 2 ) n -CO- where n ranges from about 3 to about 20, preferably from about 3 to about 16, more preferably from about 3 to about 13, and most preferably from about 3 to about 10.
  • the acid group on the C-terminal can be blocked with an alcohol, aldehyde or ketone group and/or the N-terminal residue can have the natural amide group, or be blocked with an acyl, carboxylic acid, alcohol, aldehyde, or ketone group.
  • t-BOC 9-fluoreneacetyl group, 1-fluorenecarboxylic group, 9-florenecarboxylic group, 9- fluorenone-1 -carboxylic group, benzyloxycarbonyl, xanthyl (Xan), trityl (Trt), 4-methyltrityl (Mtt), 4-methoxytrityl (Mmt), 4-methoxy-2,3,6-trimethyl-benzenesulphonyl (Mtr),
  • Protecting/blocking groups are well known to those of skill as are methods of coupling such groups to the appropriate residue(s) comprising the peptides of this invention ⁇ see, e.g., Greene et al, (1991) Protective Groups in Organic Synthesis, 2nd ed., John Wiley & Sons, Inc. Somerset, N.J.).
  • acetylation is accomplished during the synthesis when the peptide is on the resin using acetic anhydride.
  • Amide protection can be achieved by the selection of a proper resin for the synthesis. For example, a rink amide resin can be used.
  • the semipermanent protecting groups on acidic bifunctional amino acids such as Asp and Glu and basic amino acid Lys, hydroxyl of Tyr are all simultaneously removed.
  • the peptides released from such a resin using acidic treatment comes out with the n-terminal protected as acetyl and the carboxyl protected as NH 2 and with the simultaneous removal of all of the other protecting groups.
  • amino acid sequences comprising, one or more protecting groups, e.g., as described above (or any other commercially available protecting groups for amino acids used, e.g., in boc or fmoc peptide synthesis) are also contemplated.
  • the active AMPs, STAMPs and the like can be identified and/or validated using an in vitro screening assay. Additionally, despite certain apparent limitations of in vitro susceptibility tests, clinical data indicate that a good correlation exists between minimal inhibitory concentration (MIC) test results and in vivo efficacy of antibiotic compounds ⁇ see, e.g., Murray et al. (1994) Antimicrobial Susceptibility Testing, Poupard et al, eds., Plenum Press, New York; Knudsen et al. (1995) Antimicrob. Agents Chemother. 39(6): 1253-1258; and the like). Thus, AMPs useful for treating infections and diseases related thereto are also conveniently identified by demonstrated in vitro antimicrobial activity against specified microbial targets, e.g., C. difficile).
  • MIC minimal inhibitory concentration
  • the in vitro antimicrobial activity of antimicrobial agents is tested using standard NCCLS bacterial inhibition assays, or MIC tests (see, National Committee on Clinical Laboratory Standards “Performance Standards for Antimicrobial Susceptibility Testing," NCCLS Document M100-S5 Vol. 14, No. 16, December 1994; “Methods for dilution antimicrobial susceptibility test for bacteria that grow aerobically-Third Edition,” Approved Standard M7-A3, National Committee for Clinical Standards, Villanova, Pa.).
  • active peptides of the invention will exhibit MICs (as measured using the assays described in the examples) of less than about 100 ⁇ , preferably less than about 80 or 60 ⁇ , more preferably about 50 ⁇ or less, about 25 ⁇ or less, or about 15 ⁇ or less, or about 10 ⁇ or less.
  • the constructs described herein ⁇ e.g., STAMPS comprising C. difficile-targeting peptides attached to antimicrobial peptide(s)) are administered to a mammal in need thereof, to a cell, to a tissue, to a composition (e.g., a stool sample), etc.).
  • the compositions can be administered to detect and/or locate, and/or quantify the presence of particular microorganisms, microorganism
  • compositions can be administered to inhibit particular microorganisms, microorganism populations, biofilms comprising particular microorganisms, and the like.
  • active agents e.g., STAMPs
  • STAMPs active agents
  • these active agents can be administered in the "native" form or, if desired, in the form of salts, esters, amides, prodrugs, derivatives, and the like, provided the salt, ester, amide, prodrug or derivative is suitable pharmacologically, i.e., effective in the present method(s).
  • Salts, esters, amides, prodrugs and other derivatives of the active agents can be prepared using standard procedures known to those skilled in the art of synthetic organic chemistry and described, for example, by March (1992) Advanced Organic Chemistry; Reactions, Mechanisms and Structure, 4th Ed. N. Y. Wiley-Interscience.
  • Suitable acids for preparing acid addition salts include, but are not limited to both organic acids, e.g., acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid, and the like, as well as inorganic acids, e.g., hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.
  • An acid addition salt can be recon
  • basic salts of the active agents of this invention are prepared in a similar manner using a pharmaceutically acceptable base such as sodium hydroxide, potassium hydroxide, ammonium hydroxide, calcium hydroxide, trimethylamine, or the like.
  • basic salts include alkali metal salts, e.g., the sodium salt, and copper salts.
  • the pKa of the counterion is preferably at least about 2 pH lower than the pKa of the drug.
  • the pKa of the counterion is preferably at least about 2 pH higher than the pKa of the drug. This permits the counterion to bring the solution's pH to a level lower than the pHma X to reach the salt plateau, at which the solubility of salt prevails over the solubility of free acid or base.
  • the generalized rule of difference in pKa units of the ionizable group in the active pharmaceutical ingredient (API) and in the acid or base is meant to make the proton transfer energetically favorable.
  • the counterion is a pharmaceutically acceptable counterion.
  • Suitable anionic salt forms include, but are not limited to acetate, benzoate, benzylate, bitartrate, bromide, carbonate, chloride, citrate, edetate, edisylate, estolate, fumarate, gluceptate, gluconate, hydrobromide, hydrochloride, iodide, lactate, lactobionate, malate, maleate, mandelate, mesylate, methyl bromide, methyl sulfate, mucate, napsylate, nitrate, pamoate (embonate), phosphate and diphosphate, salicylate and disalicylate, stearate, succinate, sulfate, tartrate, tosylate, triethiodide, valerate, and the like, while suitable cationic salt forms include, but are not limited to aluminum, benzathine, calcium, ethylene diamine, lysine, magnesium, meglumine, potassium, procaine, sodium, t
  • preparation of esters typically involves
  • esters are typically acyl- substituted derivatives of free alcohol groups, i.e., moieties that are derived from carboxylic acids of the formula RCOOH where R is alky, and preferably is lower alkyl. Esters can be reconverted to the free acids, if desired, by using conventional hydrogenolysis or hydrolysis procedures.
  • Amides can also be prepared using techniques known to those skilled in the art or described in the pertinent literature. For example, amides may be prepared from esters, using suitable amine reactants, or they may be prepared from an anhydride or an acid chloride by reaction with ammonia or a lower alkyl amine.
  • the active agents identified herein are useful for the detection and/or treatment of C. difficile infecitons.
  • administration is parenteral, oral, nasal (or otherwise inhaled), rectal, or local administration, for detection and/or quantification, and or localization, and/or prophylactic and/or therapeutic treatment of infection ⁇ e.g., microbial infection).
  • the compositions can be administered in a variety of unit dosage forms depending upon the method of administration. Suitable unit dosage forms, include, but are not limited to powders, tablets, pills, capsules, lozenges, suppositories, patches, nasal sprays, injectibles, implantable sustained-release formulations, lipid complexes, etc.
  • the active agents ⁇ e.g., STAMPs) described herein can also be combined with a pharmaceutically acceptable carrier (excipient) to form a pharmacological composition.
  • pharmaceutically acceptable carriers include those approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in/on animals, and more particularly in/on humans.
  • a "carrier” refers to, for example, a diluent, adjuvant, excipient, auxiliary agent or vehicle with which an active agent of the present invention is administered.
  • Pharmaceutically acceptable carriers can contain one or more physiologically acceptable compound(s) that act, for example, to stabilize the composition or to increase or decrease the absorption of the active agent(s).
  • physiologically acceptable compounds can include, for example, carbohydrates, such as glucose, sucrose, or dextrans, antioxidants, such as ascorbic acid or glutathione, chelating agents, low molecular weight proteins, protection and uptake enhancers such as lipids, compositions that reduce the clearance or hydrolysis of the active agents, or excipients or other stabilizers and/or buffers.
  • physiologically acceptable compounds particularly of use in the preparation of tablets, capsules, gel caps, and the like include, but are not limited to binders, diluent/fillers, disentegrants, lubricants, suspending agents, and the like.
  • an oral dosage form ⁇ e.g., a tablet
  • an excipient e.g., lactose, sucrose, starch, mannitol, etc.
  • an optional disintegrator e.g. calcium carbonate, carboxymethylcellulose calcium, sodium starch gly collate, crospovidone etc.
  • a binder e.g.
  • alpha-starch gum arabic, microcrystalline cellulose, carboxymethylcellulose, polyvinylpyrrolidone, hydroxypropylcellulose, cyclodextrin, etc.), and an optional lubricant ⁇ e.g., talc, magnesium stearate, polyethylene glycol 6000, etc.), for instance, are added to the active component or components ⁇ e.g., active peptide) and the resulting composition is compressed. Where necessary the compressed product is coated, e.g., known methods for masking the taste or for enteric dissolution or sustained release.
  • Suitable coating materials include, but are not limited to ethyl-cellulose, hydroxymethylcellulose, polyoxyethylene glycol, cellulose acetate phthalate, hydroxypropylmethylcellulose phthalate, and Eudragit (Rohm & Haas, Germany; methaciylic-acrylic copolymer).
  • physiologically acceptable compounds include wetting agents, emulsifying agents, dispersing agents or preservatives that are particularly useful for preventing the growth or action of microorganisms.
  • Various preservatives are well known and include, for example, phenol and ascorbic acid.
  • pharmaceutically acceptable carrier(s) including a physiologically acceptable compound depends, for example, on the route of administration of the active agent(s) and on the particular physio-chemical characteristics of the active agent(s).
  • the excipients are sterile and generally free of undesirable matter. These compositions can be sterilized by conventional, well-known sterilization techniques. For various oral dosage form excipients such as tablets and capsules sterility is not required. The USP/NF standard is usually sufficient.
  • compositions of this invention are administered, e.g., orally or rectally administered to a patient suffering from infection or at risk for infection or prophylactically to prevent C. difficile infections and associated pathologies in an amount sufficient to prevent and/or cure and/or at least partially prevent or arrest the disease and/or its complications.
  • An amount adequate to accomplish this is defined as a "therapeutically effective dose.” Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health. Single or multiple administrations of the compositions may be administered depending on the dosage and frequency as required and tolerated by the patient. In any event, the composition should provide a sufficient quantity of the active agents of the formulations of this invention to effectively treat (ameliorate one or more symptoms in) the patient.
  • the concentration of active agent(s) can vary widely, and will be selected primarily based on activity of the active ingredient(s), body weight and the like in accordance with the particular mode of administration selected and the patient's needs. Concentrations, however, will typically be selected to provide dosages ranging from about 0.1 or 1 mg/kg/day to about 50 mg/kg/day and sometimes higher. Typical dosages range from about 3 mg/kg/day to about 3.5 mg/kg/day, preferably from about 3.5 mg/kg/day to about 7.2 mg/kg/day, more preferably from about 7.2 mg/kg/day to about 11.0 mg/kg/day, and most preferably from about 11.0 mg/kg/day to about 15.0 mg/kg/day.
  • dosages range from about 10 mg/kg/day to about 50 mg/kg/day. In certain embodiments, dosages range from about 20 mg to about 50 mg given orally twice daily. It will be appreciated that such dosages may be varied to optimize a therapeutic and/or phophylactic regimen in a particular subject or group of subjects.
  • the active agents of this invention are administered to the oral cavity. This is readily accomplished by the use of lozenges, aersol sprays, mouthwash, coated swabs, and the like.
  • the active agents of this invention are administered systemically (e.g., orally, or as an injectable) in accordance with standard methods well known to those of skill in the art.
  • the agents can also be delivered through the skin using conventional transdermal drug delivery systems, i.e., transdermal "patches" wherein the active agent(s) are typically contained within a laminated structure that serves as a drug delivery device to be affixed to the skin.
  • the drug composition is typically contained in a layer, or "reservoir,” underlying an upper backing layer.
  • the term “reservoir” in this context refers to a quantity of "active ingredient(s)" that is ultimately available for delivery to the surface of the skin.
  • the “reservoir” may include the active ingredient(s) in an adhesive on a backing layer of the patch, or in any of a variety of different matrix formulations known to those of skill in the art.
  • the patch may contain a single reservoir, or it may contain multiple reservoirs.
  • the reservoir comprises a polymeric matrix of a pharmaceutically acceptable contact adhesive material that serves to affix the system to the skin during drug delivery.
  • suitable skin contact adhesive materials include, but are not limited to, polyethylenes, polysiloxanes, polyisobutylenes, polyacrylates,
  • the drug-containing reservoir and skin contact adhesive are present as separate and distinct layers, with the adhesive underlying the reservoir which, in this case, may be either a polymeric matrix as described above, or it may be a liquid or hydrogel reservoir, or may take some other form.
  • the backing layer in these laminates which serves as the upper surface of the device, preferably functions as a primary structural element of the "patch" and provides the device with much of its flexibility.
  • the material selected for the backing layer is preferably substantially impermeable to the active agent(s) and any other materials that are present.
  • Ointments are semisolid preparations that are typically based on petrolatum or other petroleum derivatives.
  • Creams containing the selected active agent are typically viscous liquid or semisolid emulsions, often either oil-in-water or water-in-oil.
  • Cream bases are typically water- washable, and contain an oil phase, an emulsifier and an aqueous phase.
  • the oil phase also sometimes called the "internal" phase, is generally comprised of petrolatum and a fatty alcohol such as cetyl or stearyl alcohol; the aqueous phase usually, although not necessarily, exceeds the oil phase in volume, and generally contains a humectant.
  • the emulsifier in a cream formulation is generally a nonionic, anionic, cationic or amphoteric surfactant.
  • the specific ointment or cream base to be used is one that will provide for optimum drug delivery. As with other carriers or vehicles, an ointment base should be inert, stable, nonirritating and nonsensitizing.
  • one or more active agents of the present invention can be provided as a "concentrate”, e.g., in a storage container (e.g., in a premeasured volume) ready for dilution, or in a soluble capsule ready for addition to a volume of water, alcohol, hydrogen peroxide, or other diluent.
  • While the invention is described with respect to use in humans, it is also suitable for animal, e.g., veterinary use.
  • animal e.g., veterinary use.
  • certain preferred organisms include, but are not limited to humans, non-human primates, canines, equines, felines, porcines, ungulates, largomorphs, and the like.
  • anti-C. difficile constructs described herein ⁇ e.g.,
  • Nanoemulsions include, but are not limited to oil in water (O/W) nanoemulsions, and water in oil (W/O) nanoemulsions.
  • Nanoemulsions can be defined as emulsions with mean droplet diameters ranging from about 20 to about 1000 nm. Usually, the average droplet size is between about 20 nm or 50 nm and about 500 nm.
  • SME sub-micron emulsion
  • mini-emulsion are used as synonyms.
  • Illustrative oil in water (O/W) nanoemulsions include, but are not limited to:
  • Surfactant micelles micelles composed of small molecules surfactants or detergents (e.g., SDS/PBS/2-propanol) which are suitable for predominantly hydrophobic peptides.
  • Polymer micelles micelles composed of polymer, copolymer, or block copolymer surfactants (e.g., Pluronic L64/PBS/2-propanol) which are suitable for
  • Blended micelles micelles in which there is more than one surfactant component or in which one of the liquid phases (generally an alcohol or fatty acid compound) participates in the formation of the micelle (e.g., Octanoic acid/PBS/EtOH) which are suitable for predominantly hydrophobic peptides;
  • one of the liquid phases generally an alcohol or fatty acid compound
  • Integral peptide micelles blended micelles in which the peptide serves as an auxiliary surfactant, forming an integral part of the micelle (e.g., amphipathic
  • Solid phase emulsions emulsions in which the peptides are associated with the exterior of a solid nanoparticle (e.g., polystyrene nanoparticles/PBS/no oil phase) which are suitable for amphipathic peptides.
  • a solid nanoparticle e.g., polystyrene nanoparticles/PBS/no oil phase
  • Illustrative water in oil (W/O) nanoemulsions include, but are not limited to:
  • Surfactant micelles micelles composed of small molecules surfactants or detergents (e.g., dioctyl sulfosuccinate/PBS/2-propanol, Isopropylmyristate/PBS/2-propanol, etc.) which are suitable for predominantly hydrophilic peptides;
  • surfactants or detergents e.g., dioctyl sulfosuccinate/PBS/2-propanol, Isopropylmyristate/PBS/2-propanol, etc.
  • Polymer micelles micelles composed of polymer, copolymer, or block copolymer surfactants (e.g., PLURONIC® L121/PBS/2-propanol), which are suitable for predominantly hydrophilic peptides;
  • Blended micelles micelles in which there is more than one surfactant component or in which one of the liquid phases (generally an alcohol or fatty acid compound) participates in the formation of the micelle (e.g., capric/caprylic diglyceride/PBS/EtOH) which are suitable for predominantly hydrophilic peptides;
  • one of the liquid phases generally an alcohol or fatty acid compound
  • Integral peptide micelles blended micelles in which the peptide serves as an auxiliary surfactant, forming an integral part of the micelle (e.g., amphipathic
  • the nanoemulsions comprise one or more surfactants or detergents.
  • the surfactant is a non-anionic detergent (e.g., a polysorbate surfactant, a poly oxy ethylene ether, etc.).
  • Surfactants that find use in the present invention include, but are not limited to surfactants such as the TWEEN®, TRITON®, and TYLOXAPOL® families of compounds.
  • the emulsions further comprise one or more cationic halogen containing compounds, including but not limited to, cetylpyridinium chloride.
  • the compositions further comprise one or more compounds that increase the interaction ("interaction enhancers") of the composition with microorganisms (e.g., chelating agents like ethylenediaminetetraacetic acid, or
  • the nanoemulsion further comprises an emulsifying agent to aid in the formation of the emulsion.
  • Emulsifying agents include compounds that aggregate at the oil/water interface to form a kind of continuous membrane that prevents direct contact between two adjacent droplets.
  • Certain embodiments of the present invention feature oil-in-water emulsion compositions that may readily be diluted with water to a desired concentration without impairing their anti-pathogenic properties.
  • certain oil- in-water emulsions can also contain other lipid structures, such as small lipid vesicles (e.g., lipid spheres that often consist of several substantially concentric lipid bilayers separated from each other by layers of aqueous phase), micelles (e.g., amphiphilic molecules in small clusters of 50-200 molecules arranged so that the polar head groups face outward toward the aqueous phase and the apolar tails are sequestered inward away from the aqueous phase), or lamellar phases (lipid dispersions in which each particle consists of parallel amphiphilic bilayers separated by thin films of water).
  • small lipid vesicles e.g., lipid spheres that often consist of several substantially concentric lipid bilayers separated from each other by layers of aqueous phase
  • micelles e.g., amphiphilic molecules in small clusters of 50-200 molecules arranged so that the polar head groups face outward toward the aqueous phase and the
  • SLPs surfactant lipid preparations
  • SLPs are minimally toxic to mucous membranes and are believed to be metabolized within the small intestine (see e.g., Hamouda et al, (1998) J. Infect. Disease 180: 1939).
  • the emulsion comprises a discontinuous oil phase distributed in an aqueous phase, a first component comprising an alcohol and/or glycerol, and a second component comprising a surfactant or a halogen-containing compound.
  • the aqueous phase can comprise any type of aqueous phase including, but not limited to, water ⁇ e.g., dionized water, distilled water, tap water) and solutions ⁇ e.g., phosphate buffered saline solution, or other buffer systems).
  • the oil phase can comprise any type of oil including, but not limited to, plant oils ⁇ e.g., soybean oil, avocado oil, flaxseed oil, coconut oil, cottonseed oil, squalene oil, olive oil, canola oil, corn oil, rapeseed oil, safflower oil, and sunflower oil), animal oils ⁇ e.g., fish oil), flavor oil, water insoluble vitamins, mineral oil, and motor oil.
  • plant oils ⁇ e.g., soybean oil, avocado oil, flaxseed oil, coconut oil, cottonseed oil, squalene oil, olive oil, canola oil, corn oil, rapeseed oil, safflower oil, and sunflower oil
  • animal oils ⁇ e.g., fish oil
  • flavor oil water insoluble vitamins, mineral oil, and motor oil.
  • the oil phase comprises 30-90 vol % of the oil-in-water emulsion ⁇ i.e., constitutes 30-90% of the total volume of the final emulsion), more preferably 50-
  • the alcohol when present, is ethanol.
  • the surfactant is a polysorbate surfactant ⁇ e.g., TWEEN 20®, TWEEN 40®, TWEEN 60®, and TWEEN 80®), a phenoxypolyethoxy ethanol ⁇ e.g., TRITON® X-100, X-301, X-165, X-102, and X-200, and TYLOXAPOL®), or sodium dodecyl sulfate, and the like.
  • a polysorbate surfactant ⁇ e.g., TWEEN 20®, TWEEN 40®, TWEEN 60®, and TWEEN 80®
  • a phenoxypolyethoxy ethanol e.g., TRITON® X-100, X-301, X-165, X-102, and X-200, and TYLOXAPOL®
  • sodium dodecyl sulfate sodium dodecyl sulfate
  • a halogen-containing component is present, the nature of the halogen-containing compound, in some preferred embodiments the halogen-containing compound comprises a chloride salt ⁇ e.g., NaCl, KC1, etc.), a cetylpyridinium halide, a cetyltrimethylammonium halide, a cetyldimethylethylammonium halide, a
  • cetyldimethylbenzylammonium halide a cetyltributylphosphonium halide
  • dodecyltrimethylammomum halides tetradecyltrimethylammomum halides, cetylpyridinium chloride, cetyltrimethylammonium chloride, cetylbenzyldimethylammonium chloride, cetylpyridinium bromide, cetyltrimethylammonium bromide, cetyldimethylethylammonium bromide, cetyltributylphosphonium bromide, dodecyltrimethylammonium bromide, tetradecyltrimethylammonium bromide, and the like
  • the emulsion comprises a quaternary ammonium compound.
  • Quaternary ammonium compounds include, but are not limited to, N- alkyldimethyl benzyl ammonium saccharinate, l,3,5-Triazine-l,3,5(2H,4H,6H)-triethanol; 1- Decanaminium, N-decyl-N,N-dimethyl-, chloride (or) Didecyl dimethyl ammonium chloride; 2-(2-(p-(Diisobuyl)cresosxy)ethoxy)ethyl dimethyl benzyl ammonium chloride; 2-(2-(p- (Diisobutyl)phenoxy)ethoxy)ethyl dimethyl benzyl ammonium chloride; alkyl 1 or 3 benzyl- l-(2-hydroxethyl)-2-imidazolinium chloride; alkyl bis(2-hydroxyethyl)
  • octyphenoxyethoxyethyl dimethyl benzyl ammonium chloride oxydiethylenebis (alkyl dimethyl ammonium chloride); quaternary ammonium compounds, dicoco alkyldimethyl, chloride; trimethoxysily propyl dimethyl octadecyl ammonium chloride; trimethoxysilyl quats, trimethyl dodecylbenzyl ammonium chloride; n-dodecyl dimethyl ethylbenzyl ammonium chloride; n-hexadecyl dimethyl benzyl ammonium chloride; n-tetradecyl dimethyl benzyl ammonium chloride; n-tetradecyl dimethyl ethylbenzyl ammonium chloride; and n-octadecyl dimethyl benzyl ammonium chloride.
  • Nanoemulsion formulations and methods of making such are well known to those of skill in the art and described for example in U.S. Patent Nos: 7,476,393, 7,468,402, 7,314,624, 6,998,426, 6,902,737, 6,689,371, 6,541,018, 6,464,990, 6,461,625, 6,419,946, 6,413,527, 6,375,960, 6,335,022, 6,274,150, 6, 120,778, 6,039,936, 5,925,341, 5,753,241, 5,698,219, an d5, 152,923 and in Fanun et al. (2009) Microemulsions: Properties and
  • formulations are selected to optimize binding specificity, and/or binding avidity, and/or antimicrobial activity, and/or
  • the targeting peptide and/or antimicrobial peptide, and/or STAMP is formulated in combination with one or more salts.
  • the formulations disclosed herein, however, are not limited to those containing salt(s).
  • Embodiments, are also contemplated where the targeting peptide and/or antimicrobial peptide, and/or STAMP is formulated without the presence of a salt.
  • sodium chloride plus a little potassium chloride resulted in the best activity of the salts tested.
  • other salts e.g., CaC , MgCl 2 , MnCl 2 also enhanced activity.
  • the targeting peptide(s), and/or antimicrobial peptide(s), and/or chimeric moieties, and/or STAMPs are formulated with one or more salts.
  • suitable salts include any of a number of
  • salts include the hydrobromide, hydrochloride, sulfate, bisulfate, phosphate, nitrate, acetate, valerate, oleate, palmitate, stearate, laurate, benzoate, lactate, phosphate, tosylate, citrate, maleate, fumarate, succinate, tartrate, napthylate, mesylate, besylate, glucoheptonate, lactobionate, and laurylsulphonate salts and the like (see, e.g., Berge et al. (1977) J. Pharm. Sci. 66: 1-19), although it is noted that citrate salts appear to inhibit the activity of certain STAMPs.
  • pharmaceutically acceptable salts of the present invention include the conventional nontoxic salts or quaternary ammonium salts of the compounds, e.g., from non-toxic organic or inorganic acids.
  • non-toxic organic or inorganic acids include those derived from inorganic acids such as hydrochloride,
  • organic acids such as acetic, propionic, succinic, glycolic, stearic, lactic, malic, tartaric, citric, ascorbic, palmitic, maleic, hydroxymaleic, phenylacetic, glutamic, benzoic, salicyclic, sulfanilic
  • the compounds of the present invention may contain one or more acidic functional groups and, thus, are capable of forming pharmaceutically-acceptable salts with pharmaceutically-acceptable bases.
  • pharmaceutically-acceptable salts refers to the relatively non-toxic, inorganic and organic base addition salts of compounds of the present invention. These salts can likewise be prepared in situ in the administration vehicle or the dosage form manufacturing process, or by separately treating the compound in its free acid form with a suitable base, such as the hydroxide, carbonate or bicarbonate of a pharmaceutically-acceptable metal cation, with ammonia, or with a pharmaceutically-acceptable organic primary, secondary or tertiary amine.
  • a suitable base such as the hydroxide, carbonate or bicarbonate of a pharmaceutically-acceptable metal cation, with ammonia, or with a pharmaceutically-acceptable organic primary, secondary or tertiary amine.
  • Representative alkali or alkaline earth salts include the lithium, sodium, potassium, calcium, magnesium, and aluminum salts and the like.
  • Representative organic amines useful for the formation of base addition salts include ethylamine, diethylamine, ethylenediamine, ethanolamine,
  • the salt is simply a sodium chloride and/or a potassium chloride and can readily be prepared, for example, as a phosphate buffered saline (PBS) solution.
  • PBS phosphate buffered saline
  • the salt concentration is comparable to that found in 0.5 X PBS to about 2.5 X PBS, more preferably from about 0.5 X PBS to about 1.5 X PBS. In certain embodiments optimum activity has been observed in 1 X PBS.
  • the pH of the formulation ranges from about pH 5.0 to about pH 8.5, preferably from about pH 6.0 to about pH 8.0, more preferably from about pH 7.0 to about pH 8.0. In certain embodiments the pH is about pH 7.4.
  • buffers include, but are not limited to sulfate buffers, carbonate buffers, Tris buffers, CHAPS buffers, PIPES buffers, and the like, as long as the salt is included.
  • the targeting peptide, and/or antimicrobial peptide, and/or chimeric moiety, and/or STAMP is present in the formulation at a concentration ranging from about 1 nM, to about 1, 10, or 100 mM, more preferably from about 1 nM, about 10 nM, about 100 nM, about 1 ⁇ , or about 10 ⁇ to about 50 ⁇ , about 100 ⁇ , about 200 ⁇ , about 300 ⁇ , about 400 ⁇ , or about 500 ⁇ , preferably from about 1 ⁇ , about 10 ⁇ , about 25 ⁇ , or about 50 ⁇ to about 1 mM, about 10 mM, about 20 mM, or about 5 mM, most preferably from about 10 ⁇ , about 20 ⁇ , or about 50 ⁇ to about 100 ⁇ , about 150 ⁇ , or about 200 ⁇ .
  • the constructs described herein are formulated for specific or preferential delivery to the colon.
  • Approaches for targeted/preferential delivery of drugs (including proteins and peptides) to the colon include, but are not limited to: 1) pH sensitive polymer coatings; 2) Delayed (time controlled) release systems, 3) Microbially triggered drug delivery; 4) Pressure controlled drug delivery stems; an 5) Colon targeted delivery systems; Osmotic controlled drug delivery.
  • pH ranges between 1 and 2 during fasting but increases after eating (Rubinstein (1995) Crit. Rev. Ther. Drug Carrier Syst, 12(2-3): 101-149.).
  • the pH is about 6.5 in the proximal small intestine, and about 7.5 in the distal small intestine. From the ileum to the colon, pH declines significantly. It is about 6.4 in the cecum. However, pH values as low as 5.7 have been measured in the ascending colon in healthy volunteers.
  • the pH in the transverse colon is 6.6 and 7.0 in the descending colon. Use of pH dependent polymers is based on these differences in pH levels.
  • Polymers described as pH dependent in colon specific drug delivery have low solubility or are insoluble at low pH levels, but become increasingly more soluble as pH rises ⁇ see, e.g., Ashord et al. (1993) J Control Release, 26: 213-220).
  • Illustrative pH sensitive coatings are described, for example in PCT Publication No: WO1995011032A1.
  • Illustrative materials described therein include pH-sensitive polymers that do not dissolve in the lower pH environs of the stomach and the upper portions of the small intestine (pHs lower than about 6.5), but that disintegrate or dissolve at the pH commonly found in the latter portions of the small intestine or in the proximal region of the colon, e.g., above pH 6.5.
  • Such polymers include polymethacrylates ⁇ e.g., EUDRAGIT® Type S, or combinations of EUDRAGIT® Types L and S, Rohm Pharma, Darmstadt, West Germany), hydroxypropyl methylcellulose phthalate, shellac, and polyvinyl acetate phthalate.
  • the pH at which such pH-sensitive polymers begin to dissolve and the thickness of coating determines the site in the intestinal lumen at which the encapsulated drug is released.
  • higher pH dissolution points and increased amounts of pH-sensitive polymer will increase the distance the unit dosage form will travel in the small intestine and colon prior to release of the drug.
  • preferred pH-sensitive enteric materials dissolve only at a pH of greater than about 6.5, more preferred enteric materials dissolve only at pH of greater than about 6.8; also preferred are enteric materials which dissolve only at a pH of greater than about 7.
  • An especially preferred pH-sensitive material is a polymethacrylate polymer (Eudragit® S) with a pH dissolution value of about pH 7.
  • U.S. Pat. No. 5,484,610 discloses terpolymers or monomes such as alkyl acrylates or methacrylates, 1,3-diene monomers, a-methyl styrene, halogenated olefins, vinyl esters, acrylonitrile, methacrylonitrile, N-vinyl carbazole and the like.
  • the terpolymers are sensitive to pH and temperature and are useful carriers for conducting bioactive agents through the gastric juices of the stomach in a protected form. The terpolymers swell at the higher physiologic pH of the intestinal tract causing release of the bioactive agents into the intestine.
  • the terpolymers are linear and are typically made up of 35 to 99 wt % of a temperature sensitive component, which imparts to the terpolymer LCST (lower critical solution temperature) properties below body temperatures, 1 to 30 wt % of a pH sensitive component having a pK a in the range of from 2 to 8 that functions through ionization or deionization of carboxylic acid groups to prevent the bioactive agent from being lost at low pH but allows bioactive agent release at physiological pH of about 7.4 and a hydrophobic component that stabilizes the LCST below body temperatures and compensates for bioactive agent effects on the terpolymers.
  • a temperature sensitive component which imparts to the terpolymer LCST (lower critical solution temperature) properties below body temperatures
  • a pH sensitive component having a pK a in the range of from 2 to 8 that functions through ionization or deionization of carboxylic acid groups to prevent the bioactive agent from being lost at low pH but allows bioactive agent release at physiological pH of
  • Terpolymers provide for safe bioactive agent loading, a simple procedure for dosage form fabrication and the terpolymer functions as a protective carrier in the acidic environment of the stomach and also protects the bioactive agents from digestive enzymes until the bioactive agent is released in the intestinal tract.
  • U.S. Pat. No. 6,103,865 discloses pH-sensitive polymers containing sulfonamide groups, which can be changed in physical properties, such as swellability and solubility, depending on pH and which can be applied for a drug-delivery system, bio- material, sensor, and the like, and a preparation method therefore.
  • the pH-sensitive polymers are prepared by introduction of sulfonamide groups, various in pKa, to hydrophilic groups of polymers either through coupling to the hydrophilic groups of polymers, such as acrylamide, N,N-dimethylacrylamide, acrylic acid, N-isopropyl aery 1 amide and the like or copolymerization with other polymerizable monomers.
  • pH-sensitive polymers may have a structure of linear polymer, grafted copolymer, hydrogel or interpenetrating network polymer.
  • U.S. Pat. No. 5,656,292 discloses a composition for pH dependent or pH regulated controlled release of active ingredients especially drugs.
  • the composition consists of a compactable mixture of the active ingredient and starch molecules substituted with acetate and dicarboxylate residues.
  • One preferred dicarboxylate acid is succinate.
  • the average substitution degree of the acetate residue is at least 1 and 0.2-1.2 for the
  • the starch molecules can have the acetate and dicarboxylate residues attached to the same starch molecule backbone or attached to separate starch molecule backbones.
  • U.S. Pat. Nos. 5,554, 147, 5,788,687, and 6,306,422 disclose a method for the controlled release of a biologically active agent wherein the agent is released from a hydrophobic, pH-sensitive polymer matrix. The polymer matrix swells when the agent is released from a hydrophobic, pH-sensitive polymer matrix. The polymer matrix swells when the agent is released from a hydrophobic, pH-sensitive polymer matrix. The polymer matrix swells when the agent is released from a hydrophobic, pH-sensitive polymer matrix. The polymer matrix swells when the agent is released from a hydrophobic, pH-sensitive polymer matrix. The polymer matrix swells when the agent is released from a hydrophobic, pH-sensitive polymer matrix. The polymer matrix swells when the agent is released from a hydrophobic, pH-sensitive polymer matrix. The polymer matrix swells when the agent is released from a hydrophobic, pH-sensitive polymer matrix. The polymer
  • a polymer of hydrophobic and weakly acidic comonomers is disclosed for use in the controlled release system. Also disclosed is a specific embodiment in which the controlled release system may be used.
  • amylose can be provided in the form of a high amylose starch, for example Hylon 7 or Eurylon 7 (a starch having about 70% by weight amylose. It has been found that a mix of two polymers at an appropriate ratio, applied as a film coating on to a core, minimizes drug release in the stomach and small intestine. Subsequent drug release in the colon occurs by the combined active physiological triggers: e.g., by Eudragit® S dissolution and amylose digestion.
  • the proportion of the first material to the second material may in some circumstances be up to 50:50, preferably up to 65:35 and most preferably from 15:85 to 30:70.
  • Time controlled release system such as sustained or delayed release dosage forms are useful drug release systems for colonic delivery.
  • Enteric coated time-release press coated (ETP) tablets can be composed of three components, a drug containing core tablet (rapid release function), the press coated swellable hydrophobic polymer layer (Hydroxy propyl cellulose layer (HPC), time release function) and an enteric coating layer (acid resistance function).
  • a drug containing core tablet rapid release function
  • the press coated swellable hydrophobic polymer layer Hydroxy propyl cellulose layer (HPC), time release function
  • enteric coating layer acid resistance function
  • the enteric coating layer After gastric emptying, the enteric coating layer rapidly dissolves and the intestinal fluid begins to slowly erode the press coated polymer (HPC) layer.
  • HPC press coated polymer
  • the duration of lag phase is controlled either by the weight or composition of the polymer (HPC) layer.
  • the microflora of the colon is in the range of 10 u -10 12 CFU/ mL, consisting mainly of anaerobic bacteria, e.g. bacteroides, bifidobacteria, eubacteria, Clostridia, enterococci, enterobacteria and ruminococcus etc.
  • This microflora fulfills its energy needs by fermenting various types of substrates that have been left undigested in the small intestine, e.g. di- and tri-saccharides, polysaccharides etc.
  • the microflora produces a large number of enzymes like glucoronidase, xylosidase, arabinosidase, galactosidase, nitroreductase, azareducatase, deaminase, and urea dehydroxylase. Because of the presence of the biodegradable enzymes only in the colon, the use of biodegradable polymers for colon-specific drug delivery provides a more site-specific approach as compared to many other approaches.
  • these polymers shield the drug from the environments of stomach and small intestine, and are able to deliver the drug to the colon. On reaching the colon, they undergo assimilation by micro-organism, or degradation by enzyme or break down of the polymer back bone leading to a subsequent reduction in their molecular weight and thereby loss of mechanical strength. They are then unable to hold the drug entity any longer.
  • drug delivery to the colon can be achieved by formulating the active agent(s) (e.g., STAMPs) as a prodrug.
  • active agent(s) e.g., STAMPs
  • prodrugs are pharmacologically inactive (or reduced activity) derivatives of a parent drug molecule that exploits spontaneous or enzymatic transformation in vivo to release the active drug.
  • the prodrug is typically designed to undergo minimal hydrolysis in the upper tracts of the GI tract and and undergo enzymatic hydrolysis in the colon thereby releasing the active drug moiety from the drug carrier. Metabolism of azo compounds by intestinal bacteria is one of the most extensively studied bacterial metabolic process.
  • prodrug forms include, but are not limited to azo conjugates, amino acid conjugates, saccharide carriers,
  • glucose/galactose/cellobioside linkages glucuronide conjugates and the like.
  • azo-polymers are used to form prodrugs for delivery to the colon. Both synthetic as well as naturally occurring polymers have been used for this purpose. Synthetic polymers have been used to form polymeric prodrug with azo linkage between the polymer and drug moiety. A number of these have been evaluated for CDDS. Various azo polymers have also been evaluated as coating materials over drug cores. These have been found to be similarly susceptible to cleavage by the azoreducatase in the large bowel. Coating of peptide capsules with polymers cross linked with azoaromatic group have been found to protect the drug from digestion in the stomach and small intestine. In the colon, the azo bonds are reduced, and the drug is released. Illustrative azopolymeric prodrugs include, but are not limited to copolymers of styrene with 2- hydroxyethylmethacrylate, hydrogels comprising 2-hydroxymethacrylate with 4
  • methacryloyloxy azobenzene segmented polyurethane, aromatic azo bonds containing urethane analogs, and the like.
  • PCT Patent Publication No: WO 1998001421 Al describes hydrogel polymeric systems for the site specific delivery of peptide and protein drugs to the colon.
  • the hydrogel protects the drug through the acid environment of the stomach, swells at a chemically controlled rate in the higher pH environment of the small intestine and is enzymatically degraded by azoreductases in the colon.
  • a series of N, O-diacylhydroxylamine monomers were synthesized and incorporated into an aromatic azo crosslinked hydrophilic aciylamide/acrylic acid hydrogel network.
  • N, O-diacylhydroxylamines function as either acid group protectants or cross- linking moieties that also protect an acid functionality at an acid pH but hydrolyze at higher pH ranges as found in the small intestine to expose free carboxylic acid groups.
  • Naturally occurring polysaccharides can also be used for targeting drugs to the colon since these polymers of monosaccharides are found in abundance, have wide availability are inexpensive and are available in a verity of a structures with varied properties. They can be easily modified chemically, biochemically, and are highly stable, safe, nontoxic, hydrophilic and gel forming and in addition, are biodegradable.
  • Suitable polysaccharides include naturally occurring polysaccharides obtained from plant (e.g., guar gum, inulin), animal (e.g., chitosan, chondroitin sulfate), algal (e.g., alginates) or microbial (e.g., dextran) origin.
  • plant e.g., guar gum, inulin
  • animal e.g., chitosan, chondroitin sulfate
  • algal e.g., alginates
  • microbial e.g., dextran
  • Illustrative polysaccharide-based delivery systems include, but are not limited to chitosan (e.g., enteric coated chitosan capsules), chitosan derivatives (e.g., chitosan succinate, chitosan succinate used as a carrier matrix or capsule), pectin (e.g., used as a carrier matrix or capsule, amidated pectin/calcium pectinate (e.g., utilized as a matrix tablet with ethyl cellulose, or as a drug matrix additive), chondroitin sulfate and/or cross-linked chondroitin (e.g., as a matrix tablet), alginates (e.g., as a calcium salt on swellable beads), and the like.
  • chitosan e.g., enteric coated chitosan capsules
  • chitosan derivatives e.g., chitosan succinate, chitosan succinate used as a carrier
  • Illustrative controlled colon-delivery capsules can be prepared using ethylcellulose, which is insoluble in water. In such systems, drug release occurs following the disintegration of a water-insoluble polymer capsule because of pressure in the lumen of the colon. The thickness of the ethylcellulose membrane, the capsule size and density control the rate of disintegration of the formulation.
  • CODES 11V1 Novel Colon Targeted Delivery Systems
  • CODESTM is a CDDS technology that was designed to avoid the inherent problems associated with pH or time dependent systems. CODESTM utilizes a combined approach of pH dependent and microbially triggered CDDS (see, e.g., U.S. Patent No:
  • the system typically comprises a traditional tablet core containing lactulose, that is overcoated with an acid soluble material (e.g., EUDRAGIT® E, and which is subsequently overcoated with an enteric material, (e.g., EUDRAGIT® L).
  • an acid soluble material e.g., EUDRAGIT® E
  • an enteric material e.g., EUDRAGIT® L
  • the enteric coating protects the tablet while it is located in the stomach and then dissolves quickly following gastric emptying.
  • the acid soluble material coating then protects the preparation as it passes through the alkaline pH of the small intestine. Once the tablet arrives in the colon, bacteria enzymatically degrade the polysaccharide (lactulose) into organic acid. This lowers the pH surrounding the system sufficient to effect the dissolution of the acid soluble coating and subsequent drug release.
  • Osmotic Controlled Drug Delivery (ORDS-CT) (see, e.g., U.S. Patent No:
  • the system can be a single osmotic unit or may incorporate as many as 5-6 push-pull units, each encapsulated within a hard gelatin capsule, Each bilayer push pull unit contains an osmotic push layer and a drug layer, both surrounded by a semipermeable membrane. An orifice is drilled through the membrane next to the drug layer. Immediately after the ORDS-CT is swallowed, the gelatin capsule containing the push-pull units dissolves.
  • each push-pull unit Because of its drug-impermeable enteric coating, each push-pull unit is prevented from absorbing water in the acidic aqueous environment of the stomach, and hence no drug is delivered. As the unit enters the small intestine, the coating dissolves in this higher pH environment (pH >7), water enters the unit causing the osmotic push compartment to swell, and concomitantly creates a flowable gel in the drug compartment. Swelling of the osmotic push compartment forces drug gel out of the orifice at a rate precisely controlled by the rate of water transport through the semipermeable membrane.
  • each push pull unit is designed with a 3-4 h post gastric delay to prevent drug delivery in the small intestine.
  • ORDS-CT units can maintain a constant release rate for up to 24 hours in the colon or can deliver drug over a period as short as four hours.
  • Other phase transited systems also provide good tools for targeting drugs to the colon.
  • Various in vitro I in vivo evaluation techniques have been developed and proposed to test the performance and stability of CDDS.
  • Fecal microbiota transplantation also known as a fecal matter transplant or a stool transplant is the process of transplantation of fecal bacteria typically from a healthy individual into a recipient an autologous transplant from an earlier stored sample into the same subject (Bakken et al. (2011) Clin. Gastroenterol. Hepatol, 9(12): 1044-1049).
  • Various studies have shown fecal matter transplantation to provide effective treatment for patients suffering from Clostridium difficile infection (CDI), that can produce effects ranging from diarrhea to pseudomembranous colitis (Borody and Khoruts (2011) Nat. Rev. Gastroenterol. Hepatol. 9(2): 88-96). Additionally, beginning in 2000, various hypervirulent strains of C. difficile have emerged, that appear to be linked to the CDI
  • CDI Clostridium difficile infection
  • pseudomembranous colitis Borody and Khoruts (2011) Nat. Rev. Gastroenterol. Hepatol. 9(2): 88-96.
  • Clostridium difficile infections currently are diagnosed annually (Sailhamer et al. (2009) Arch. Surg. 144: 433-439). Of these, a subgroup will go on to develop fulminant CDI which results in approximately 300 deaths per day or almost 110,000 deaths per year (Jarvis et al.
  • fecal matter transplantation involves restoration of the colonic microflora by introducing healthy bacterial flora through infusion of stool ⁇ e.g. by enema, colonoscopy, rectal suppository, oral capsule, etc.), obtained from a healthy human donor or from the same subject ⁇ e.g., before administration of antibiotics).
  • Infusion of feces from healthy donors has been demonstrated in a randomized, controlled trial to be highly effective in treating recurrent C. difficile, and more effective than vancomycin alone (van Nood et al. (2013) N. Engl. J. Med., 368(5): 407-415).
  • Preparing for the procedure typically involves careful selection and screening of the donor and excluding those who test positive for certain diseases as well as any donor carrying any pathogenic gastrointestinal infectious agent.
  • treatment of the fecal matter (stool) with one or more of the constructs described herein can reduce or eliminate viable C. difficile in the sample without substantially depleting or killing the other microbiota in the sample thereby improving safety and broadening the donor pool.
  • composition comprising fecal matter
  • the composition comprises fecal matter combined with a construct that kills C. difficile as described herein ⁇ e.g. a C. difficile targeting peptide attached to an antimicrobial peptide).
  • the construct will be present in an amount sufficient to reduce or eliminate viable C. difficile in the fecal matter.
  • the fecal matter can comprise human stool or stool from a non-human mammal ⁇ e.g., a feline, a canine, a porcine, a bovine, an equine, a non-human primate, a largomorph, etc.).
  • the procedure can involve single to multiple infusions
  • construct-treated fecal material preferably obtained from a healthy donor or the same subject, e.g., obtained before administration of certain antibiotics.
  • Most fecal transplant patients with CDI recover clinically and their CDI can be eradicated after just one treatment (Kelly et al. (2012) J. Clin. Gastroenterol. 46(2): 145-149; Brandt et al. (2011) J. Clin. Gastroenterol. 45(8): 655-657). While C.
  • ulcerative colitis is easily eradicated with a single FMT infusion, however, this generally appears to not be the case with ulcerative colitis. Published experience of ulcerative colitis treatment with FMT largely shows that multiple and recurrent infusions are required to achieve prolonged remission or cure (Borody and Campbell (2011) Exp. Rev. Gastroenterol. Hepatol. 5(6): 653-655).
  • the fecal microbiota infusions can be administered via various routes depending on suitability and ease, although enema infusion is perhaps the simplest.
  • Other routes include, but are not limited to colonoscopy, rectal suppository, through a nasogastric or nasoduodenal tube, or via oral administration of encapsulated fecal matter.
  • repeat stool testing is performed on subjects to confirm eradication of CDI.
  • an autologous fecal sample can be provided from the subject before medical treatment, and this sample can be is stored under refrigeration. Should the patient subsequently develop a C. difficile infection, the sample is extracted with saline filtered and treated with the anti-C. difficile constructs described herein. The filtrate can be used directly or it can be freeze-dried and the resulting solid enclosed in enteric-coated capsules.
  • the subjects most likely to receive this treatment are those who have had at least three recurrences of C. difficile infection and have failed conventional therapies, including, for example a pulsed, tapered regimen of vancomycin.
  • the treatment spectrum can be widened to include any subjects that are severely ill because of C. difficile infection, even if the current infection is their first episode. Some of these severely ill subjects could develop fulminant colitis, require colectomy, or even die. It is believed that such complications can be prevented by fecal transplantation earlier in these subjects.
  • Another group of subjects in whom fecal transplantation might be considered using the construct-treated stool samples described herein is any subject with C. difficile infection, regardless of the number of recurrences or the severity of the infection.
  • ACG American College of Gastroenterology
  • the fecal transplantation using the construct-treated stool contemplated herein is performed in combination with antibiotic therapy ⁇ e.g.
  • vancomycin treatment In certain embodiments the antibiotic treatment will follow fecal transplantation. Without being bound to a particular theory, it is believed that subjects can respond to vancomycin after fecal transplantations because they now have sufficient diversity of bacteria to keep C. difficile in check once vancomycin lowered the C. difficile burden.
  • fecal transplantation has been used primarily for treatment of C. difficile infection, it is believed to provide an effective treatment for other diseases.
  • Clinicians have limited experience using fecal transplantation for a variety of gastroenterologic diseases, including, but not limited to, ulcerative colitis, Crohn's disease, irritable bowel syndrome, and idiopathic constipation. It is contemplated that the construct-treated stool samples described herein find utility in the treatment of these conditions as well.
  • kits are provided for the inhibition of a C. difficile infection and/or for prevention of a C. difficile infection in a mammal.
  • the kits typically comprise a container containing one or more of the active agents ⁇ i.e., the antimicrobial peptide(s) and/or construct(s)) described herein.
  • the active agent(s) can be provided in a unit dosage formulation ⁇ e.g., suppository, tablet, caplet, patch, etc.) and/or may be optionally combined with one or more pharmaceutically acceptable excipients.
  • kits optionally include labeling and/or instructional materials providing directions ⁇ i.e., protocols) for the practice of the methods or use of the
  • therapeutics or “prophylactics” or detection reagents of this invention.
  • Certain instructional materials describe the use of one or more active agent(s) of this invention to therapeutically or prophylactically to inhibit or prevent infection.
  • the instructional materials may also, optionally, teach preferred dosages/therapeutic regiment, counter indications and the like.
  • instructional materials typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to electronic storage media ⁇ e.g., magnetic discs, tapes, cartridges, chips), optical media ⁇ e.g., CD ROM), and the like. Such media may include addresses to internet sites that provide such instructional materials.
  • Table 7 shows the physical properties of various illustrative anti-C. difficile
  • Table 8 shows the biological activity of various illustrative anti-C. difficile STAMPs.
  • LATKLKYLKELKKMGGK 11.0 39.39 115.0 11.5 42.81 9.27 GFLKFLKKFFKKLKYY 7 5
  • Figure 1 shows activity of STAMPs against C. difficile spores.
  • Figure 2 shows anti-C. difficile activity of STAMPs in a hamster
  • Figure 3 shows anti-C. difficile activity of STAMPs in mouse pharmacology model with prevention of recurrence. Improvement is seen over the standard of care (Vancomycin).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Engineering & Computer Science (AREA)
  • Physiology (AREA)
  • Nutrition Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Dans certains modes de réalisation, l'invention concerne des constructions qui inhibent et/ou éliminent de façon sélective/préférentielle Clostridium difficile. Dans certains modes de réalisation, les constructions selon l'invention comprennent un peptide qui se lie à C. difficile, fixé directement ou par l'intermédiaire d'un acide aminé ou d'un lieur à un peptide antimicrobien.
PCT/US2017/044248 2016-07-29 2017-07-27 Fractions de ciblage de clostridium difficile et constructions comprenant lesdites fractions WO2018022936A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662368970P 2016-07-29 2016-07-29
US62/368,970 2016-07-29

Publications (1)

Publication Number Publication Date
WO2018022936A1 true WO2018022936A1 (fr) 2018-02-01

Family

ID=61016819

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/044248 WO2018022936A1 (fr) 2016-07-29 2017-07-27 Fractions de ciblage de clostridium difficile et constructions comprenant lesdites fractions

Country Status (1)

Country Link
WO (1) WO2018022936A1 (fr)

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110039761A1 (en) * 2009-01-06 2011-02-17 C3 Jian, Inc. Targeted antimicrobial moieties
US20160207969A1 (en) * 2014-12-29 2016-07-21 C3 Jian, Inc. Clostridium difficile targeting moieties and constructs comprising said moieties

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110039761A1 (en) * 2009-01-06 2011-02-17 C3 Jian, Inc. Targeted antimicrobial moieties
US20160207969A1 (en) * 2014-12-29 2016-07-21 C3 Jian, Inc. Clostridium difficile targeting moieties and constructs comprising said moieties

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
DATABASE UniProtKB 5 May 2009 (2009-05-05), "ALBO1_HYPAB, Hylin-a1 teaches a peptide with antibacterial activity against the Gram-positive bacteria S.aureus ATCC 25926", XP055458063, Database accession no. P85982 *

Similar Documents

Publication Publication Date Title
JP6585099B2 (ja) α−メラニン形成細胞刺激ホルモンのペプチド類似体
JP6166312B2 (ja) ミトコンドリア透過性転移の阻止方法
US20160207969A1 (en) Clostridium difficile targeting moieties and constructs comprising said moieties
US20100184681A1 (en) Antibacterial and antifungal peptides
AU2014218599B2 (en) Guanylate cyclase receptor agonists for use in colonic cleansing
JP2017526640A (ja) S.ミュータンス(S.mutans)を結合させるターゲティングペプチド、そのようなペプチドを含む構築物、およびその使用
JP2017526640A5 (fr)
CA3095484A1 (fr) Constructions polypeptidiques de lysine-peptide antimicrobien (amp), lysines, polynucleotides isoles les codant et utilisations correspondantes
US11965039B2 (en) Compstatin analogues and their medical uses
US20220251162A1 (en) Pac1 receptor agonists (maxcaps) and uses thereof
EP4272751A2 (fr) Analogues de compstatine et leurs utilisations médicales
JP2017501999A (ja) Cd28を介したシグナル伝達を阻害する短ペプチドによる炎症性疾病の症候の軽減
EP3054969B1 (fr) Agonistes de guanylate cyclase utiles pour le traitement de troubles induits par les opioïdes
JP4744443B2 (ja) 毒素中和性ペプチドのスクリーニング方法とstx2阻害性ペプチド並びにベロ毒素中和剤
US20050130901A1 (en) Modified alpha-MSH peptides and derivatives thereof
WO2018022936A1 (fr) Fractions de ciblage de clostridium difficile et constructions comprenant lesdites fractions
CN105753939A (zh) 芳香族阳离子肽及其用途
JP3472821B2 (ja) 新規ペプチド、及び当該ペプチドを用いた組成物
JPWO2008114577A1 (ja) 抗菌性ペプチド
WO2014075137A1 (fr) Peptides comprenant des lactames à substitution amino pour le traitement de la rétinopathie
Ishibashi et al. Surface Plasmon Resonance Analysis of Beetle Defensin-Derived Antimicrobial Peptide-Membrane Interactions

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17835306

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17835306

Country of ref document: EP

Kind code of ref document: A1