WO2017151818A2 - T-cell modulatory multimeric polypeptides and methods of use thereof - Google Patents
T-cell modulatory multimeric polypeptides and methods of use thereof Download PDFInfo
- Publication number
- WO2017151818A2 WO2017151818A2 PCT/US2017/020276 US2017020276W WO2017151818A2 WO 2017151818 A2 WO2017151818 A2 WO 2017151818A2 US 2017020276 W US2017020276 W US 2017020276W WO 2017151818 A2 WO2017151818 A2 WO 2017151818A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- amino acid
- acid sequence
- cases
- variant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70532—B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/46—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/02—Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70539—MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/605—MHC molecules or ligands thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6056—Antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/64—Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K33/00—Medicinal preparations containing inorganic active ingredients
- A61K33/42—Phosphorus; Compounds thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001124—CD20
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/19—Cosmetics or similar toiletry preparations characterised by the composition containing inorganic ingredients
- A61K8/20—Halogens; Compounds thereof
- A61K8/21—Fluorides; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- An adaptive immune response involves the engagement of the T cell receptor (TCR), present on the surface of a T cell, with a small peptide antigen non-covalently presented on the surface of an antigen presenting cell (APC) by a major histocompatibility complex (MHC; also referred to in humans as a human leukocyte antigen (HLA) complex).
- TCR T cell receptor
- APC antigen presenting cell
- MHC major histocompatibility complex
- HLA human leukocyte antigen
- TCR is specific for a given epitope; however, the costimulatory protein not epitope specific and instead is generally expressed on all T cells or on large T cell subsets.
- the present disclosure provides variant immunomodulatory polypeptides, and fusion
- the present disclosure provides T-cell modulatory multimeric polypeptides, and compositions comprising same, where the T-cell modulatory multimeric polypeptides comprise a variant immunomodulatory polypeptide of the present disclosure.
- the present disclosure provides nucleic acids comprising nucleotide sequences encoding the T-cell modulatory multimeric polypeptides, and host cells comprising the nucleic acids.
- the present disclosure provides methods of modulating the activity of a T cell; the methods comprise contacting the T cell with a T-cell modulatory multimeric polypeptide of the present disclosure.
- the present disclosure provides a variant CD80 immunomodulatory polypeptide comprising an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the CD80 amino acid sequence depicted in FIG. 2A or to the CD80 amino acid sequence set forth in SEQ ID NO:l, wherein the variant CD80 immunomodulatory polypeptide has one or more amino acid substitutions relative to the CD80 amino acid sequence depicted in FIG. 2A or to the CD80 amino acid sequence set forth in SEQ ID NO: l ; and wherein the variant CD80 immunomodulatory polypeptide exhibits reduced binding affinity to a CD 86 polypeptide having an amino acid sequence depicted in one of FIG.
- the polypeptide comprises a substitution of amino acid N19, N63, 167, K86, Q157, D158, L25, Y31 , Q33, M38, V39, 149, Y53, D60, F108, or S156.
- the polypeptide comprises a substitution of amino acid N19.
- the polypeptide comprises a substitution of amino acid 167.
- the polypeptide comprises a substitution of amino acid K86.
- the polypeptide comprises a substitution of amino acid Q157. In some cases, the polypeptide comprises a substitution of amino acid D158. In some cases, the polypeptide comprises a substitution of amino acid L25. In some cases, the polypeptide comprises a substitution of amino acid Y31. In some cases, the polypeptide comprises a substitution of amino acid Q33. In some cases, the polypeptide comprises a substitution of amino acid M38. In some cases, the polypeptide comprises a substitution of amino acid V39. In some cases, the polypeptide comprises a substitution of amino acid 149. In some cases, the polypeptide comprises a substitution of amino acid Y53. In some cases, the polypeptide comprises a substitution of amino acid D60.
- the polypeptide comprises a substitution of amino acid F108. In some cases, the polypeptide comprises a substitution of amino acid SI 56. In some cases, the variant immunomodulatory polypeptide exhibits from less than 10% to less than 50% of binding affinity exhibited by to the CD80 amino acid sequence depicted in FIG. 2A, or as set forth in SEQ ID NO: l, for the CD86 polypeptide.
- the present disclosure provides a multimeric polypeptide comprising: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a first major
- MHC histocompatibility complex
- a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide; and ii) optionally an immunoglobulin (Ig) Fc polypeptide or a non-Ig scaffold, wherein the multimeric polypeptide comprises one or more immunomodulatory domains, wherein the one or more
- immunomodulatory domain is: A) at the C-terminus of the first polypeptide; B) at the N- terminus of the second polypeptide; C) at the C-terminus of the second polypeptide; or D) at the C-terminus of the first polypeptide and at the N-terminus of the second polypeptide, wherein the immunomodulatory domain is a variant immunomodulatory polypeptide as described above, or elsewhere herein; and wherein the multimeric polypeptide exhibits reduced binding affinity to a CD28 polypeptide having an amino acid sequence depicted in one of FIG. 3A-3C, compared to the binding affinity of a control multimeric polypeptide comprising an immunomodulatory domain comprising the CD80 amino acid sequence depicted in FIG.
- the multimeric polypeptide comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a first MHC polypeptide; and iii) an immunomodulatory domain; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide; and ii) an Ig Fc polypeptide.
- the multimeric polypeptide comprises: a) a first polypeptide comprising, in order from N- terminus to C-terminus: i) an epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) an immunomodulatory domain; iii) a second MHC polypeptide; and iv) an immunoglobulin (Ig) Fc polypeptide.
- the multimeric polypeptide comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide; and ii) an Ig Fc polypeptide; and iii) an immunomodulatory domain.
- the multimeric polypeptide comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide; and ii) an immunomodulatory domain.
- the multimeric polypeptide comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) an immunomodulatory domain; and ii) a second MHC polypeptide.
- the multimeric polypeptide comprises: a) a first polypeptide comprising, in order from N- terminus to C-terminus: i) an epitope; ii) a first MHC polypeptide; and iii) an
- the immunomodulatory domain and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide.
- the non-Ig scaffold is an XTEN polypeptide, a transferrin polypeptide, an elastin-like polypeptide, a silk-like polypeptide, or a silk-elastin-like polypeptide.
- the first MHC polypeptide is a 2-microglobulin polypeptide; and wherein the second MHC polypeptide is an MHC class I heavy chain polypeptide.
- the 2-microglobulin polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to one of the amino acid sequences set forth in FIG. 6.
- the MHC class I heavy chain polypeptide is an HLA-A, an HLA-B, or an HLA-C heavy chain. In some cases, the MHC class I heavy chain polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to the amino acid sequence set forth in one of FIG. 5A-5C. In some cases, the first MHC polypeptide is an MHC Class II alpha chain polypeptide; and wherein the second MHC polypeptide is an MHC class II beta chain polypeptide. In some cases, the epitope is a T-cell epitope.
- the multimeric polypeptide comprises an Fc polypeptide, and wherein the Ig Fc polypeptide is an IgGl Fc polypeptide, an IgG2 Fc polypeptide, an IgG3 Fc polypeptide, an IgG4 Fc polypeptide, an IgA Fc polypeptide, or an IgM Fc polypeptide.
- the Ig Fc polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to an amino acid sequence depicted in FIG. 4A-4C.
- the first polypeptide and the second polypeptide are non-covalently associated.
- the first polypeptide and the second polypeptide are covalently linked.
- the covalent linkage is via a disulfide bond.
- the first MHC polypeptide or a linker between the epitope and the first MHC polypeptide comprises an amino acid substitution to provide a first Cys residue
- the second MHC polypeptide comprises an amino acid substitution to provide a second Cys residue
- the disulfide linkage is between the first and the second Cys residues.
- the multimeric polypeptide comprises a first linker interposed between the epitope and the first MHC polypeptide.
- the variant CD80 immunomodulatory polypeptide comprises a substitution of amino acid N19, N63, 167, K86, Q157, D158, L25, Y31, Q33, M38, V39, 149, Y53, D60, F108, or S156.
- the multimeric polypeptide comprises 2 or more immunomodulatory polypeptides. In some cases, the multimeric polypeptide comprises 3 immunomodulatory polypeptides. In some cases, the 2 or more (e.g., 3) immunomodulatory polypeptides are in tandem.
- the multimeric polypeptide comprises a third polypeptide, wherein the third polypeptide comprises an immunomodulatory polypeptide comprising an amino acid sequence having at least 90% amino acid sequence identity to the immunomodulatory polypeptide of the first polypeptide or the second polypeptide.
- the third polypeptide is covalently linked to the first polypeptide.
- the second polypeptide comprises, in order from N-terminus to C-terminus: i) the second MHC polypeptide; ii) the Ig Fc polypeptide; and iii) an affinity tag.
- the present disclosure provides a nucleic acid comprising a nucleotide sequence encoding a recombinant polypeptide, i) wherein the recombinant polypeptide comprises, in order from N- terminus to C-terminus: a) an epitope; b) a first major histocompatibility complex (MHC) polypeptide; c) an immunomodulatory polypeptide; d) a proteolytically cleavable linker or a ribosome skipping signal; e) a second MHC polypeptide; and f) an immunoglobulin (Ig) Fc polypeptide; wherein the immunomodulatory polypeptide is a variant immunomodulatory polypeptide as described above, or elsewhere herein; or ii) wherein the recombinant polypeptide comprises, in order from N-terminus to C-terminus: a) an epitope; b) a first MHC polypeptide; c) a proteolytically cleavable
- the second MHC polypeptide is an MHC class I heavy chain polypeptide.
- the 2-microglobulin polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to one of the amino acid sequences set forth in FIG. 6.
- the MHC class I heavy chain polypeptide is an HLA-A, HLA-B, or HLA- C heavy chain.
- the MHC class I heavy chain polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to the amino acid sequence set forth in any one of FIG. 5A-5C.
- the first MHC polypeptide is an MHC Class II alpha chain polypeptide; and wherein the second MHC polypeptide is an MHC class II beta chain polypeptide.
- the epitope is a T-cell epitope.
- the Ig Fc polypeptide is an IgGl Fc polypeptide, an IgG2 Fc polypeptide, an IgG3 Fc polypeptide, an IgG4 Fc polypeptide, an IgA Fc polypeptide, or an IgM Fc polypeptide.
- the Ig Fc polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to an amino acid sequence depicted in Figures 4A-4C.
- the variant CD80 immunomodulatory polypeptide comprises a substitution of amino acid N19, N63, 167, K86, Q157, D158, L25, Y31, Q33, M38, V39, 149, Y53, D60, F108, or S156.
- the multimeric polypeptide comprises a second immunomodulatory polypeptide selected from a CD7, CD30L, CD40, CD70, CD83, HLA-G, MICA, MICB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, and HVEM.
- the proteolytically cleavable linker or ribosome skipping signal comprises an amino acid sequence selected from: a) LEVLFQGP (SEQ ID NO:78); b) ENLYTQS (SEQ ID NO:79); c) a furin cleavage site; d) LVPR (SEQ ID NO:80); e) GSGATNFSLLKQAGDVEENPGP (SEQ ID NO:81); f) GSGEGRGSLLTCGDVEENPGP (SEQ ID NO:82); g) GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO:83); and h)
- the recombinant polypeptide comprises, in order from N-terminus to C-terminus: a) a first leader peptide; b) the epitope; c) the first MHC polypeptide; d) the immunomodulatory polypeptide; e) the proteolytically cleavable linker or ribosome skipping signal; f) a second leader peptide; g) the second MHC polypeptide; and h) the immunoglobulin (Ig) Fc polypeptide.
- the first leader peptide and the second leader peptide is a ⁇ 2- ⁇ leader peptide.
- the nucleotide sequence is operably linked to a transcriptional control element.
- the transcriptional control element is a promoter that is functional in a eukaryotic cell.
- the first MHC polypeptide or a linker between the epitope and the first MHC polypeptide comprises an amino acid substitution to provide a first Cys residue
- the second MHC polypeptide comprises an amino acid substitution to provide a second Cys residue
- the first and the second Cys residues provide for a disulfide linkage between the first MHC polypeptide and the second MHC polypeptide.
- the vector is a viral vector or a non- viral vector.
- the present disclosure provides a host cell genetically modified with a recombinant expression vector as described above or elsewhere herein.
- the host cell is in vitro.
- the host cell is genetically modified such that the cell does not produce an endogenous MHC 2-microglobulin polypeptide.
- the host cell is a T lymphocyte.
- the present disclosure provides a composition comprising: a) a first nucleic acid comprising a nucleotide sequence encoding a first polypeptide comprising, in order from N-terminus to C- terminus: i) an epitope; ii) a first MHC polypeptide; and iii) an immunomodulatory domain, wherein the immunomodulatory domain is a variant immunomodulatory polypeptide as described above or elsewhere herein; and b) a first nucleic acid comprising a nucleotide sequence encoding a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide; and ii) an Ig Fc polypeptide.
- the first and/or the second nucleic acid is present in a recombinant expression vector.
- the present disclosure provides a composition comprising: a) a first nucleic acid comprising a nucleotide sequence encoding a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a first MHC polypeptide; and b) a first nucleic acid comprising a nucleotide sequence encoding a second polypeptide comprising, in order from N-terminus to C-terminus: i) an immunomodulatory domain, wherein the immunomodulatory domain is a variant
- the first and/or the second nucleic acid is present in a recombinant expression vector.
- the present disclosure provides a host cell genetically modified with a nucleic acid composition as described above or elsewhere herein.
- the present disclosure provides a method of producing a multimeric polypeptide as described above or elsewhere herein, the method comprising: a) culturing a genetically modified host cell, as described above or elsewhere herein, in vitro in a culture medium under conditions such that the host cell synthesizes the multimeric polypeptide; and b) isolating the multimeric polypeptide from the host cell and/or from the culture medium.
- the second polypeptide comprises an affinity tag
- said isolating comprises contacting the multimeric polypeptide produced by the cell with a binding partner for the affinity tag, wherein the binding partner is immobilized, thereby immobilizing the multimeric polypeptide.
- the method comprises eluting the immobilized multimeric polypeptide.
- the present disclosure provides a method of selectively modulating the activity of an epitope - specific T cell, the method comprising contacting the T cell with a multimeric polypeptide polypeptide as described above or elsewhere herein, wherein said contacting selectively modulates the activity of the epitope-specific T cell.
- the immunomodulatory polypeptide is an activating polypeptide, and wherein the multimeric polypeptide activates the epitope-specific T cell.
- the immunomodulatory polypeptide is an inhibiting polypeptide, and wherein the multimeric polypeptide inhibits the epitope-specific T cell.
- the contacting is carried out in vitro. In some cases, the contacting is carried out in vivo.
- the present disclosure provides a method of selectively modulating the activity of an epitope- specific T cell in an individual, the method comprising administering to the individual an effective amount of a multimeric polypeptide, as described above or elsewhere herein, effective to selectively modulate the activity of an epitope-specific T cell in an individual.
- the immunomodulatory polypeptide is an activating polypeptide, and wherein the multimeric polypeptide activates the epitope-specific T cell.
- the epitope is a cancer- associated epitope, and wherein said administering selectively increases the activity of a T cell specific for the cancer-associate epitope.
- the immunomodulatory polypeptide is an inhibitory polypeptide, and wherein the multimeric polypeptide inhibits activity of the epitope-specific T cell.
- the epitope is a self -epitope, and wherein said administering selectively inhibits the activity of a T cell specific for the self-epitope.
- the present disclosure provides a method of treating an infection in an individual, the method comprising administering to the individual an effective amount of a) a multimeric polypeptide as described above or elsewhere herein; or b) one or more recombinant expression vectors comprising nucleotide sequences encoding a multimeric polypeptide as described above or elsewhere herein; or c) one or more mRNAs comprising nucleotide sequences encoding a multimeric polypeptide as described above or elsewhere herein, wherein the epitope is a pathogen-associated epitope, wherein the immunomodulatory polypeptide is an activating polypeptide, and wherein said administering effective to selectively modulate the activity of a pathogen-associated epitope-specific T cell in an individual.
- the pathogen is a virus, a bacterium, or a protozoan.
- said administering is subcutaneous. In some cases, said administering is intravenous. In some cases, said administering is intramuscular. In some cases, said administering is systemic. In some cases, said administering is distal to a treatment site. In some cases, said administering is local. In some cases, said administering is at or near a treatment site.
- composition comprising: a) a multimeric polypeptide as
- composition comprising: a) a nucleic acid as described above or elsewhere herein, or a recombinant expression vector as described above or elsewhere herein; and b) a pharmaceutically acceptable excipient.
- FIG. 1A-1D schematically depict various embodiments of a T-cell modulatory multimeric
- polypeptide of the present disclosure are polypeptide of the present disclosure.
- disulfide bonds are formed between MHC (e.g., HLA) polypeptides present in separate polypeptides.
- FIG. 2A-2II provide an amino acid sequence of a CD80 (FIG. 2A) and examples of variant CD80 polypeptides (FIG. 2B-2II).
- FIG. 3A-3D provide amino acid sequences of CD28 (FIG. 3A-3C) and CTLA4 (FIG. 3D).
- FIG. 4A-4C provide amino acid sequences of immunoglobulin Fc polypeptides.
- FIG. 5 A-5C provide amino acid sequences of human leukocyte antigen (HLA) Class I heavy chain polypeptides. Signal sequences are underlined.
- HLA human leukocyte antigen
- FIG. 6 provides a multiple amino acid sequence alignment of beta-2 microglobulin ( ⁇ 2 ⁇ )
- NP_004039.1 Homo sapiens
- NP_001009066.1 Pan troglodytes
- Amino acids 1-20 are a signal peptide.
- FIG. 7A-7B provide amino acid sequences of PD-L1 polypeptides.
- FIG. 8 provides an amino acid sequence of a 4-1BBL polypeptide.
- FIG. 9 provides an amino acid sequence of an ICOS-L polypeptide.
- FIG. 10 provides an amino acid sequence of an OX40L polypeptide.
- FIG. 11 provides an amino acid sequence of a PD-L2 polypeptide.
- FIG. 12 provides an amino acid sequence of a CD86 (B7-2) polypeptide.
- FIG. 13 provides an amino acid sequence of a Fas ligand (FAS-L) polypeptide.
- FIG. 14 depicts interferon-gamma (IFN- ⁇ ) secretion by target cells contacted with a synTac polypeptide according to an embodiment of the present disclosure.
- IFN- ⁇ interferon-gamma
- FIG. 15 depicts interleukin-2 (IL-2) secretion by target cells contacted with a synTac polypeptide according to an embodiment of the present disclosure.
- FIG. 16 depicts interleukin-6 (IL-6) secretion by target cells contacted with a synTac polypeptide according to an embodiment of the present disclosure.
- FIG. 17 depicts tumor necrosis factor (TNF) secretion by target cells contacted with a synTac polypeptide according to an embodiment of the present disclosure.
- TNF tumor necrosis factor
- FIG. 18 depicts proliferation of target cells contacted with a synTac polypeptide according to an embodiment of the present disclosure.
- FIG. 19 depicts viability of target cells contacted with a synTac polypeptide according to an embodiment of the present disclosure.
- FIG. 20 depicts the in vivo effect of a synTac polypeptide of the present disclosure on tumor volume.
- polynucleotide and “nucleic acid,” used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. Thus, this term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA -RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
- peptide refers to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.
- a polynucleotide or polypeptide has a certain percent "sequence identity" to another polynucleotide or polypeptide, meaning that, when aligned, that percentage of bases or amino acids are the same, and in the same relative position, when comparing the two sequences.
- Sequence identity can be determined in a number of different ways. To determine sequence identity, sequences can be aligned using various convenient methods and computer programs (e.g., BLAST, T-COFFEE, MUSCLE, MAFFT, etc.), available over the world wide web at sites including ncbi.nlm.nili.gov/BLAST, ebi.ac.uk/Tools/msa/tcoffee/, ebi.ac.uk Tools/msa/muscle/, mafft.cbrc.jp/alignment/software/. See, e.g., Altschul et al. (1990), J. Mol. Bioi. 215:403-10.
- a group of amino acids having aliphatic side chains consists of glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains consists of serine and threonine; a group of amino acids having amide containing side chains consisting of asparagine and glutamine; a group of amino acids having aromatic side chains consists of phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains consists of lysine, arginine, and histidine; a group of amino acids having acidic side chains consists of glutamate and aspartate; and a group of amino acids having sulfur containing side chains consists of cysteine and methionine.
- Exemplary conservative amino acid substitution groups are: valine -leucine - isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine-glycine, and asparagine- glutamine.
- Binding as used herein (e.g. with reference to binding of a T-cell modulatory
- multimeric polypeptide of the present disclosure to a polypeptide (e.g., a T-cell receptor) on a T cell) refers to a non-covalent interaction between. Binding interactions are generally characterized by a dissociation constant (K D ) of less than 10 6 M, less than 10 7 M, less than 10 8 M, less than 10 9 M, less than 10 10 M, less than 10 11 M, less than 10 12 M, less than 10 13 M, less than 10 14 M, or less than 10 15 M. "Affinity" refers to the strength of binding, increased binding affinity being correlated with a lower K D .
- immunological synapse or “immune synapse” as used herein generally refers to the natural interface between two interacting immune cells of an adaptive immune response including, e.g., the interface between an antigen-presenting cell (APC) or target cell and an effector cell, e.g., a lymphocyte, an effector T cell, a natural killer cell, and the like.
- An immunological synapse between an APC and a T cell is generally initiated by the interaction of a T cell antigen receptor and major histocompatibility complex molecules, e.g., as described in Bromley et al., Annu Rev Immunol. 2001 ;19:375-96; the disclosure of which is incorporated herein by reference in its entirety.
- T cell includes all types of immune cells expressing CD3, including T-helper cells (CD4 + cells), cytotoxic T-cells (CD8 + cells), T-regulatory cells (Treg), and NK-T cells.
- Co-stimulatory polypeptide includes a polypeptide on an antigen presenting cell (APC) (e.g., a dendritic cell, a B cell, and the like) that specifically binds a cognate co-stimulatory polypeptide on a T cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with a major histocompatibility complex (MHC) polypeptide loaded with peptide, mediates a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
- APC antigen presenting cell
- MHC major histocompatibility complex
- a co- stimulatory ligand can include, but is not limited to, CD7, B7-1 (CD80), B7-2 (CD86), PD-L1, PD-L2, 4-1BBL, OX40L, Fas ligand (FasL), inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM), CD30L, CD40, CD70, CD83, HLA-G, MICA, MICB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, HVEM, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3.
- a co-stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co-stimulatory molecule present on a T cell, such as, but not limited to, CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds to CD83.
- an antibody that specifically binds with a co-stimulatory molecule present on a T cell such as, but not limited to, CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds to CD83.
- a "modulatory domain" of a T-cell modulatory multimeric polypeptide of the present disclosure comprises a co-stimulatory polypeptide.
- Heterologous means a nucleotide or polypeptide that is not found in the native nucleic acid or protein, respectively.
- Recombinant means that a particular nucleic acid (DNA or RNA) is the
- DNA sequences encoding polypeptides can be assembled from cDNA fragments or from a series of synthetic oligonucleotides, to provide a synthetic nucleic acid which is capable of being expressed from a recombinant transcriptional unit contained in a cell or in a cell-free transcription and translation system.
- recombinant expression vector or "DNA construct” are used interchangeably herein to refer to a DNA molecule comprising a vector and one insert.
- Recombinant expression vectors are usually generated for the purpose of expressing and/or propagating the insert(s), or for the construction of other recombinant nucleotide sequences.
- the insert(s) may or may not be operably linked to a promoter sequence and may or may not be operably linked to DNA regulatory sequences.
- a cell has been "genetically modified” or “transformed” or “transfected” by exogenous DNA, e.g. a recombinant expression vector, when such DNA has been introduced inside the cell.
- exogenous DNA e.g. a recombinant expression vector
- the presence of the exogenous DNA results in permanent or transient genetic change.
- the transforming DNA may or may not be integrated (covalently linked) into the genome of the cell.
- the transforming DNA may be maintained on an episomal element such as a plasmid.
- a stably transformed cell is one in which the transforming DNA has become integrated into a chromosome so that it is inherited by daughter cells through chromosome replication.
- a "host cell,” as used herein, denotes an in vivo or in vitro eukaryotic cell or a cell from a
- multicellular organism e.g., a cell line
- a nucleic acid e.g., an expression vector that comprises a nucleotide sequence encoding a multimeric polypeptide of the present disclosure
- the progeny of a single cell may not necessarily be completely identical in morphology or in genomic or total DNA complement as the original parent, due to natural, accidental, or deliberate mutation.
- a “recombinant host cell” (also referred to as a “genetically modified host cell”) is a host cell into which has been introduced a heterologous nucleic acid, e.g., an expression vector.
- a genetically modified eukaryotic host cell is genetically modified by virtue of introduction into a suitable eukaryotic host cell a heterologous nucleic acid, e.g., an exogenous nucleic acid that is foreign to the eukaryotic host cell, or a recombinant nucleic acid that is not normally found in the eukaryotic host cell.
- treatment means obtaining a desired pharmacologic and/or physiologic effect.
- the effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease.
- Treatment covers any treatment of a disease or symptom in a mammal, and includes: (a) preventing the disease or symptom from occurring in a subject which may be predisposed to acquiring the disease or symptom but has not yet been diagnosed as having it; (b) inhibiting the disease or symptom, i.e., arresting its development; or (c) relieving the disease, i.e., causing regression of the disease.
- the therapeutic agent may be administered before, during or after the onset of disease or injury.
- the treatment of ongoing disease, where the treatment stabilizes or reduces the undesirable clinical symptoms of the patient, is of particular interest. Such treatment is desirably performed prior to complete loss of function in the affected tissues.
- the subject therapy will desirably be administered during the symptomatic stage of the disease, and in some cases after the symptomatic stage of the disease.
- mammals include, e.g., humans, non-human primates, rodents (e.g., rats; mice), lagomorphs (e.g., rabbits), ungulates (e.g., cows, sheep, pigs, horses, goats, and the like), etc.
- rodents e.g., rats; mice
- lagomorphs e.g., rabbits
- ungulates e.g., cows, sheep, pigs, horses, goats, and the like
- the present disclosure provides variant immunomodulatory polypeptides, and fusion
- the present disclosure provides T-cell modulatory multimeric polypeptides, and compositions comprising same, where the T-cell modulatory multimeric polypeptides comprise a variant immunomodulatory polypeptide of the present disclosure.
- the present disclosure provides nucleic acids comprising nucleotide sequences encoding the T-cell modulatory multimeric polypeptides, and host cells comprising the nucleic acids.
- the present disclosure provides methods of modulating the activity of a T cell; the methods comprise contacting the T cell with a T-cell modulatory multimeric polypeptide of the present disclosure.
- a T-cell modulatory multimeric polypeptide of the present disclosure is also referred to as a "synTac polypeptide.”
- a synTac polypeptide of the present disclosure comprises a variant modulatory domain, where the variant modulatory domain exhibits reduced binding affinity to an immunomodulatory polypeptide, compared to the affinity of a wild-type modulatory domain for the immunomodulatory polypeptide.
- a synTac polypeptide of the present disclosure can modulate the activity of a target T-cell.
- a synTac polypeptide of the present disclosure provides for enhanced target cell specificity.
- the present disclosure provides variant CD80 modulatory polypeptides.
- a wild-type amino acid sequence of human CD80 is provided in FIG. 2A.
- the ectodomain of human CD80 comprises amino acids 1-208 of the amino acid sequence depicted in FIG. 2A.
- a wild-type amino acid sequence of the ectodomain of human CD80 can be as follows:
- Wild-type CD80 binds to CD28 and to CTLA4.
- Amino acid sequences of CD28 are provided in FIG. 3A-3C.
- An amino acid sequence of CTLA4 is provided in FIG. 3D.
- a variant CD80 polypeptide of the present disclosure binds to CD80 and/or CTLA4 with reduced affinity compared to binding of wild-type CD80 to CD28 or to CTLA4.
- a variant CD80 polypeptide of the present disclosure exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for CD28.
- a variant CD80 polypeptide of the present disclosure binds CD28 with a binding affinity that is less than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C.
- a variant CD80 polypeptide of the present disclosure binds CD28 with a binding affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C).
- a variant CD80 polypeptide of the present disclosure exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in SEQ ID NO: l for CD28.
- a variant CD80 polypeptide of the present disclosure binds CD28 with a binding affinity that is less than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in SEQ ID NO: l for a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A- 3C.
- a variant CD80 polypeptide of the present disclosure binds CD28 with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25%, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in SEQ ID NO: l for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C).
- a variant CD80 polypeptide of the present disclosure has a binding affinity to CD28 that is from 100 nM to 100 ⁇ .
- a variant CD80 polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG.
- 3A-3C that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or from about 75 ⁇ to about 100 ⁇ .
- a variant CD80 polypeptide of the present disclosure exhibits reduced binding affinity to CTLA4, compared to the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A.
- a variant CD80 polypeptide of the present disclosure binds CTLA4 with a binding affinity that less than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for a CTLA4 polypeptide comprising the amino acid sequence depicted in FIG. 3D.
- a variant CD80 polypeptide of the present disclosure binds CTLA4 with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25%, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for CTLA4 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in FIG. 3D).
- a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for CTLA4 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in FIG. 3D).
- a variant CD80 polypeptide of the present disclosure can have a single amino acid substitution relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l). In some cases, a variant CD80 polypeptide of the present disclosure has from 2 to 10 amino acid substitutions relative to a wild- type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l).
- a variant CD80 polypeptide of the present disclosure has 2 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l). In some cases, a variant CD80 polypeptide of the present disclosure has 3 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l).
- a variant CD80 polypeptide of the present disclosure has 4 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l). In some cases, a variant CD80 polypeptide of the present disclosure has 5 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO:l).
- a variant CD80 polypeptide of the present disclosure has 6 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO:l). In some cases, a variant CD80 polypeptide of the present disclosure has 7 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO:l).
- a variant CD80 polypeptide of the present disclosure has 8 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO:l). In some cases, a variant CD80 polypeptide of the present disclosure has 9 amino acid substitutions relative to a wild-type CD 80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO:l).
- a variant CD 80 polypeptide of the present disclosure has 10 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO:l).
- a variant CD80 polypeptide of the present disclosure has from 11 to 50 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO:l).
- a variant CD80 polypeptide of the present disclosure has from 11 to 15, from 15 to 20, from 20 to 25, from 25 to 30, from 30 to 35, from 35 to 40, from 40 to 45, or from 45 to 50, amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO:l).
- a variant CD80 polypeptide of the present disclosure can have a length of from 150 to 254 amino acids.
- a variant CD80 polypeptide of the present disclosure has a length of from 150 amino acids to 175 amino acids, from 175 amino acids to 200 amino acids, from 200 amino acids to 225 amino acids, or from 225 amino acids to 254 amino acids.
- a variant CD80 polypeptide of the present disclosure has a length of from 200 amino acids to 225 amino acids.
- a variant CD80 polypeptide of the present disclosure has a length of from 200 amino acids to 210 amino acids.
- a variant CD80 polypeptide of the present disclosure has a length of from 205 amino acids to 210 amino acids.
- a variant CD80 polypeptide of the present disclosure has a length of 208 amino acids.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is an amino acid other than an asparagine, e.g., where amino acid 19 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at N19.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at N19.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is any amino acid other than asparagine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2C.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is an amino acid other than an asparagine, e.g., where amino acid 63 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at N63.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at N63.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is any amino acid other than asparagine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2E.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is an amino acid other than an isoleucine, e.g., where amino acid 67 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is Ala, Gly, Val, or Leu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is Leu.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at 167. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at 167. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at 167. For example, in some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- x is any amino acid other than asparagine; for example, "x” can be Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2F, where "x" is Ala, Gly, Val, or Leu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2F, where "x" is Ala.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2F, where "x" is Val.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2F, where "x" is Leu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2F, where "x" is Gly.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2G.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is an amino acid other than a lysine, e.g., where amino acid 86 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at K86.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at K86.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is any amino acid other than lysine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 21.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is an amino acid other than a glutamine, e.g., where amino acid 157 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at Q157.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at Q157.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is any amino acid other than glutamine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2K.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is an amino acid other than an aspartic acid, e.g., where amino acid 158 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at D158.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at D158.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is any amino acid other than aspartic acid; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2M.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is an amino acid other than a leucine, e.g., where amino acid 25 is Gly, Ala, Val, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is Ala, Gly, Val, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at L25.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at L25.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is any amino acid other than leucine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is Ala, Gly, Val, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is Gly.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 20.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is an amino acid other than a tyrosine, e.g., where amino acid 31 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at Y31.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at Y31.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is any amino acid other than tyrosine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is an amino acid other than a glutamine, e.g., where amino acid 33 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at Q33.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at Q33.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is any amino acid other than glutamine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2S.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is an amino acid other than a methionine, e.g., where amino acid 38 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is Gly.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at M38.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at M38.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is any amino acid other than methionine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2U.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is an amino acid other than a valine, e.g., where amino acid 39 is Gly, Ala, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is Ala, Gly, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is Leu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at V39.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at V39.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is any amino acid other than valine; for example, "x" can be Gly, Ala, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is Ala, Gly, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2W.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is an amino acid other than an isoleucine, e.g., where amino acid 49 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is Ala, Gly, Val, or Leu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is Leu. In some cases, the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at 149.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at 149.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is any amino acid other than isoleucine; for example, "x" can be Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is Ala, Gly, Val, or Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Y.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is an amino acid other than a tyrosine, e.g., where amino acid 53 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is Gly.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at Y53.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at Y53.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is any amino acid other than tyrosine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2AA.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is an amino acid other than an aspartic acid, e.g., where amino acid 60 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is Gly.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at D60.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at D60.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is any amino acid other than aspartic acid; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2CC.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is an amino acid other than a phenylalanine, e.g., where amino acid 108 is Gly, Ala, Val, Leu, He, Pro, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at F108.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at F108.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is any amino acid other than phenylalanine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2EE.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is an amino acid other than a serine, e.g., where amino acid 156 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at SI 56.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at SI 56.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is any amino acid other than serine; for example, "x" can be Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2GG.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is Ala, Gly, Val, Leu, or He.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is Ala.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is Gly. In some cases, a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is Val.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is Leu.
- a variant CD80 polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at PI 11.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at Pi l l.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is any amino acid other than proline; for example, "x" can be Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is Ala, Gly, Val, Leu, or He. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is Ala. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is Val. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is Leu. In some cases, a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is He.
- a variant CD80 polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 211.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- a fusion polypeptide of the present disclosure comprises: a) a variant CD80 polypeptide of the present disclosure; and b) a heterologous fusion partner.
- the heterologous fusion partner is fused to the N- terminus of the variant CD80 polypeptide.
- the heterologous fusion partner is fused to the C-terminus of the variant CD80 polypeptide.
- a CD80 fusion polypeptide of the present disclosure comprises a first heterologous fusion partner fused to the N-terminus of the variant CD80 polypeptide, and a second heterologous fusion partner fused to the C-terminus of the variant CD80 polypeptide.
- the total length of a CD80 fusion polypeptide of the present disclosure can range from
- a CD80 fusion polypeptide of the present disclosure can range from 215 amino acids to 225 amino acids, from 225 amino acids to 250 amino acids, from 250 amino acids to 275 amino acids, from 275 amino acids to 300 amino acids, from 300 amino acids to 350 amino acids, from 350 amino acids, from 350 amino acids to 400 amino acids, from 400 amino acids, from 400 amino acids to 450 amino acids, from 450 amino acids to 500 amino acids, from 500 amino acids to 600 amino acids, from 600 amino acids to 700 amino acids, from 700 amino acids to 800 amino acids, from 800 amino acids to 900 amino acids, from 900 amino acids to 1000 amino acids, from 1000 amino acids to 1250 amino acids, from 1250 amino acids to 1500 amino acids, from 1500 amino acids to 1750 amino acids, or from 1750 amino acids to 2000 amino acids.
- Suitable fusion partners include, but are not limited to, a transmembrane domain; an antibody Fc region; an antigen-binding region of an antibody; a cytokine; an immunomodulatory domain; an intracellular signaling domain; and the like.
- the present disclosure provides multimeric (e.g., heterodimeric, heterotrimeric)
- the multimeric polypeptides are T cell modulatory polypeptides, and are also referred to herein as "T-cell modulatory multimeric polypeptides," or "synTac" (for
- FIG. 1A-1D provide schematic depictions of T- cell modulatory multimeric polypeptides of the present disclosure.
- a T-cell modulatory multimeric polypeptide of the present disclosure is also referred to as a "synTac polypeptide” or a "multimeric polypeptide.”
- a synTac polypeptide of the present disclosure comprises a variant immunomodulatory polypeptide of the present disclosure.
- a variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure exhibits reduced binding affinity to CD86, compared to the binding affinity of wild-type CD80 to CD86.
- a multimeric polypeptide of the present disclosure that comprises a variant CD80 polypeptide of the present disclosure also exhibits reduced binding affinity to CD86, compared to a control multimeric polypeptide comprising a wild-type CD80 (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A).
- a synTac polypeptide of the present disclosure exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for CD28.
- a synTac polypeptide of the present disclosure binds CD28 with a binding affinity that is less than the binding affinity of a control synTac polypeptide comprising a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C.
- a synTac polypeptide of the present disclosure binds CD28 with a binding affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a control synTac polypeptide comprising a CD80 polypeptide comprising the amino acid sequence depicted in FIG.
- a synTac polypeptide of the present disclosure exhibits reduced binding affinity to CD28, compared to the binding affinity of a control synTac polypeptide comprising a CD80 polypeptide comprising the amino acid sequence depicted in SEQ ID NO: l for CD28.
- a synTac polypeptide of the present disclosure binds CD28 with a binding affinity that is less than the binding affinity of a control synTac polypeptide comprises a CD80 polypeptide comprising the amino acid sequence depicted in SEQ ID NO: l for a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C.
- a synTac polypeptide of the present disclosure binds CD28 with a binding affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a control synTac polypeptide comprising a CD80 polypeptide comprising the amino acid sequence depicted in SEQ ID NO: l for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C).
- a synTac polypeptide of the present disclosure has a binding affinity for
- a synTac polypeptide of the present disclosure has a binding affinity for CD28 that is from about 100 nM to 500 nM.
- a synTac polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG.
- a synTac polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C) that is from about 500 nM to ⁇ .
- a synTac polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C) that is from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, or from about 900 nM to about 1 ⁇ .
- a synTac polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG.
- a synTac polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3 A-3C) that is from about 1 ⁇ to 2 ⁇ , from about 2 ⁇ to about 3 ⁇ , from about 3 ⁇ to about 4 ⁇ , from about 4 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 6 ⁇ , from about 6 ⁇ to about 7 ⁇ , from about 7 ⁇ to about 8 ⁇ , from about 8 ⁇ to about 9 ⁇ , or from about 9 ⁇ to about 10 ⁇ .
- CD28 e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3 A-3C
- a synTac polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C) that is from about 10 ⁇ to 100 ⁇ .
- a synTac polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG.
- 3A-3C that is from about 10 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 30 ⁇ , from about 30 ⁇ to about 40 ⁇ , from about 40 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 60 ⁇ , from about 60 ⁇ to about 70 ⁇ , from about 70 ⁇ to about 80 ⁇ , from about 80 ⁇ to about 90 ⁇ , or from about 90 ⁇ to about 100 ⁇ .
- a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure can have a single amino acid substitution relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l).
- a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure has from 2 to 10 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l).
- a variant CD 80 polypeptide present in a synTac polypeptide of the present disclosure has 2 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l). In some cases, a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure has 3 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l).
- a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure has 4 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l). In some cases, a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure has 5 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l).
- a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure has 6 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l). In some cases, a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure has 7 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l).
- a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure has 8 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l). In some cases, a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure has 9 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l).
- a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure has 10 amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l).
- a variant CD80 polypeptide present in a synTac polypeptide of the present disclosure has from 11 to 15, from 15 to 20, from 20 to 25, from 25 to 30, from 30 to 35, from 35 to 40, from 40 to 45, or from 45 to 50, amino acid substitutions relative to a wild-type CD80 polypeptide (e.g., a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A or as set forth in SEQ ID NO: l).
- a multimeric polypeptide of the present disclosure comprises a first polypeptide and a second polypeptide, where the first polypeptide comprises, in order from amino terminus (N-terminus) to carboxyl terminus (C-terminus): a) an epitope (e.g., a T-cell epitope); b) a first major histocompatibility complex (MHC) polypeptide and c) an
- immunomodulatory polypeptide e.g., a variant CD80 polypeptide of the present disclosure
- second polypeptide comprises, in order from N-terminus to C-terminus: a) a second MHC polypeptide; and b) an immunoglobulin (Ig) Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises a first polypeptide and a second polypeptide, where the first polypeptide comprises, in order from N-terminus to C-terminus: a) an epitope (e.g., a T-cell epitope); and b) a first MHC polypeptide; and where the second polypeptide comprises, in order from N-terminus to C-terminus: a) an immunomodulatory polypeptide (e.g., a variant CD80 polypeptide of the present disclosure); b) a second MHC polypeptide; and c) an Ig Fc polypeptide.
- an immunomodulatory polypeptide e.g., a variant CD80 polypeptide of the present disclosure
- the first and the second MHC polypeptides are Class I MHC polypeptides; e.g., in some cases, the first MHC polypeptide is an MHC Class I ⁇ 2- microglobulin (B2M or ⁇ 2 ⁇ ) polypeptide, and the second MHC polypeptide is an MHC Class I heavy chain (H chain); or the first MHC polypeptide is an MHC Class I H chain, and the second MHC polypeptide is an MHC Class I ⁇ 2 ⁇ polypeptide).
- B2M or ⁇ 2 ⁇ microglobulin
- H chain MHC Class I heavy chain
- the first and the second MHC polypeptides are Class II MHC polypeptides; e.g., in some cases, the first MHC polypeptide is an MHC Class II a-chain polypeptide, and the second MHC polypeptide is an MHC Class II ⁇ -chain polypeptide. In other cases, the first polypeptide is an MHC Class II ⁇ - chain polypeptide, and the second MHC polypeptide is an MHC Class II a-chain polypeptide. In some cases, the multimeric polypeptide includes two or more immunomodulatory polypeptides, where at least one of the immunomodulatory polypeptides is a variant CD80 immunomodulatory polypeptide of the present disclosure.
- a multimeric polypeptide of the present disclosure includes two or more immunomodulatory polypeptides
- the two or more immunomodulatory polypeptides are present in the same polypeptide chain, and may be in tandem.
- a multimeric polypeptide of the present disclosure includes two or more immunomodulatory polypeptides
- the two or more immunomodulatory polypeptides are present in separate polypeptides.
- a multimeric polypeptide of the present disclosure is a heterodimer.
- a multimeric polypeptide of the present disclosure is a trimeric polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a second MHC polypeptide; and ii) an Ig Fc polypeptide; and iii) an
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide; and ii) an immunomodulatory domain (e.g., a variant CD80 polypeptide of the present disclosure).
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) an immunomodulatory domain (e.g., a variant CD80 polypeptide of the present disclosure); and ii) a second MHC polypeptide.
- an immunomodulatory domain e.g., a variant CD80 polypeptide of the present disclosure
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a first MHC polypeptide; and iii) an immunomodulatory domain (e.g., a variant CD80 polypeptide of the present disclosure); and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide.
- a multimeric polypeptide of the present disclosure comprises a non-Ig scaffold
- the non-Ig scaffold is an XTEN peptide, a transferrin polypeptide, an Fc receptor polypeptide, an elastin-like polypeptide, a silk-like polypeptide, or a silk-elastin-like polypeptide.
- a multimeric polypeptide of the present disclosure is monovalent. In some cases, a multimeric polypeptide of the present disclosure is multivalent. In some cases, a multivalent multimeric polypeptide of the present disclosure comprises an immunoglobulin Fc polypeptide on one of the first or the second polypeptide.
- the multimeric polypeptide can be a homodimer, where two molecules of the multimeric polypeptide are present in the homodimer, where the two molecules of the multimeric polypeptide can be disulfide linked to one another, e.g., via the Fc polypeptide present in the two molecules.
- a multimeric polypeptide of the present disclosure can comprise three, four, or five molecules of the multimeric polypeptide, where the molecules of the multimeric polypeptide can be disulfide linked to one another, e.g., via the Fc polypeptide present in the molecules.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N- terminus to C-terminus: i) a variant CD80 polypeptide of the present disclosure; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C- terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- the first, second, and third variant CD80 polypeptides have the same amino acid sequence. In some cases, the first, second, and third variant CD80 polypeptides differ from one another in amino acid sequence.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide. In some cases, the first, second, and third variant CD80 polypeptides have the same amino acid sequence. In some cases, the first, second, and third variant CD
- a multimeric polypeptide of the present disclosure can include linker peptides
- an epitope and an MHC polypeptide interposed between, e.g., an epitope and an MHC polypeptide; between an MHC polypeptide and an immunomodulatory polypeptide; between an MHC polypeptide and an Ig Fc polypeptide; between a first variant CD80 polypeptide and a second variant CD80 polypeptide; or a between a second variant CD80 polypeptide and a third variant CD80 polypeptide.
- Suitable linkers can be readily selected and can be of any of a number of suitable lengths, such as from 1 amino acid to 25 amino acids, from 3 amino acids to 20 amino acids, from 2 amino acids to 15 amino acids, from 3 amino acids to 12 amino acids, including 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or 7 amino acids to 8 amino acids.
- a suitable linker can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids in length.
- Exemplary linkers include glycine polymers (G) n , glycine-serine polymers (including, for example, (GS) n , (GSGGS) n (SEQ ID NO:65) and (GGGS) n (SEQ ID NO:66), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers can be used; both Gly and Ser are relatively unstructured, and therefore can serve as a neutral tether between components.
- Glycine polymers can be used; glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)).
- Exemplary linkers can comprise amino acid sequences including, but not limited to, GGSG (SEQ ID NO:67), GGSGG (SEQ ID NO:68), GSGSG (SEQ ID NO:69), GSGGG (SEQ ID NO:70), GGGSG (SEQ ID NO:71), GSSSG (SEQ ID NO:72), and the like.
- Exemplary linkers can include, e.g., Gly(Ser 4 )n, where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- a linker comprises the amino acid sequence (GSSSS)n (SEQ ID NO:73), where n is 4. In some cases, a linker comprises the amino acid sequence (GSSSS)n (SEQ ID NO:73), where n is 5. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:74), where n is 4. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO: 74), where n is 5.
- a linker polypeptide present in a first polypeptide of a multimeric
- polypeptide of the present disclosure includes a cysteine residue that can form a disulfide bond with a cysteine residue present in a second polypeptide of a multimeric polypeptide of the present disclosure.
- a suitable linker comprises the amino acid sequence GCGASGGGGSGGGGS (SEQ ID NO:75).
- An epitope present in a multimeric polypeptide of the present disclosure can have a length of from about 4 amino acids to about 25 amino acids, e.g., the epitope can have a length of from 4 amino acids (aa) to 10 aa, from 10 aa to 15 aa, from 15 aa to 20 aa, or from 20 aa to 25 aa.
- an epitope present in a multimeric polypeptide of the present disclosure can have a length of 4 amino acids (aa), 5 aa, 6 aa, 7, aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa.
- an epitope present in a multimeric polypeptide of the present disclosure has a length of from 5 amino acids to 10 amino acids, e.g., 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, or 10 aa.
- An epitope present in a multimeric polypeptide of the present disclosure is specifically bound by a T-cell, i.e., the epitope is specifically bound by an epitope-specific T cell.
- An epitope-specific T cell binds an epitope having a reference amino acid sequence, but does not substantially bind an epitope that differs from the reference amino acid sequence.
- an epitope-specific T cell binds an epitope having a reference amino acid sequence, and binds an epitope that differs from the reference amino acid sequence, if at all, with an affinity that is less than 10 6 M, less than 10 s M, or less than 10 4 M.
- An epitope-specific T cell can bind an epitope for which it is specific with an affinity of at least 10 7 M, at least 10 s M, at least 10 9 M, or at least 10 10 M.
- Suitable epitopes include, but are not limited to, epitopes present in a cancer-associated antigen.
- Cancer-associated antigens include, but are not limited to, a-folate receptor; carbonic anhydrase IX (CAIX); CD19; CD20; CD22; CD30; CD33; CD44v7/8; carcinoembryonic antigen (CEA); epithelial glycoprotein-2 (EGP-2); epithelial glycoprotein-40 (EGP-40); folate binding protein (FBP); fetal acetylcholine receptor; ganglioside antigen GD2; Her2/neu; IL-13R-a2; kappa light chain; LeY; LI cell adhesion molecule; melanoma-associated antigen (MAGE); MAGE-A1 ; mesothelin; MUC1 ; NKG2D ligands; oncofetal antigen (h5T4); prostate stem cell antigen (PSCA); prostate-specific membrane antigen (
- a multimeric polypeptide of the present disclosure includes MHC
- MHC polypeptides include MHC polypeptides of various species, including human MHC (also referred to as human leukocyte antigen (HLA)) polypeptides, rodent (e.g., mouse, rat, etc.) MHC polypeptides, and MHC polypeptides of other mammalian species (e.g., lagomorphs, non-human primates, canines, felines, ungulates (e.g., equines, bovines, ovines, caprines, etc.), and the like.
- human MHC also referred to as human leukocyte antigen (HLA)
- rodent e.g., mouse, rat, etc.
- MHC polypeptides of other mammalian species e.g., lagomorphs, non-human primates, canines, felines, ungulates (e.g., equines, bovines, ovines, caprines, etc.), and the like.
- MHC polypeptide is meant to include Class I MHC polypeptides (e.g., ⁇ -2 microglobulin and MHC class I heavy chain) and MHC Class II polypeptides (e.g., MHC Class II a polypeptide and MHC Class II ⁇ polypeptide).
- Class I MHC polypeptides e.g., ⁇ -2 microglobulin and MHC class I heavy chain
- MHC Class II polypeptides e.g., MHC Class II a polypeptide and MHC Class II ⁇ polypeptide.
- the first and the second MHC polypeptides are Class I MHC polypeptides; e.g., in some cases, the first MHC polypeptide is an MHC Class I 2-microglobulin ( ⁇ 2 ⁇ ) polypeptide, and the second MHC polypeptide is an MHC Class I heavy chain (H chain).
- the first and the second MHC polypeptides are Class II MHC polypeptides; e.g., in some cases, the first MHC polypeptide is an MHC Class II a-chain polypeptide, and the second MHC polypeptide is an MHC Class II ⁇ -chain polypeptide.
- the first polypeptide is an MHC Class II ⁇ -chain polypeptide
- the second MHC polypeptide is an MHC Class II a- chain polypeptide.
- an MHC polypeptide of a multimeric polypeptide of the present disclosure is a Class I HLA polypeptide, e.g., a ⁇ 2- microglobulin polypeptide, or a Class I HLA heavy chain polypeptide.
- Class I HLA heavy chain polypeptides include HLA-A heavy chain polypeptides, HLA-B heavy chain polypeptides, HLA- C heavy chain polypeptides, HLA-E heavy chain polypeptides, HLA-F heavy chain
- an MHC polypeptide of a multimeric polypeptide of the present disclosure is a Class II HLA polypeptide, e.g., a Class II HLA a chain or a Class II HLA ⁇ chain.
- MHC Class II polypeptides include MCH Class II DP a and ⁇ polypeptides, DM a and ⁇ polypeptides, DOA a and ⁇ polypeptides, DOB a and ⁇ polypeptides, DQ a and ⁇ polypeptides, and DR a and ⁇ polypeptides.
- an MHC Class I heavy chain polypeptide of a multimeric polypeptide of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to amino acids 25-365 of the amino acid sequence of the human HLA-A heavy chain polypeptide depicted in Figure 5A.
- an MHC Class I heavy chain polypeptide of a multimeric polypeptide of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to amino acids 25-365 of the amino acid sequence of the following human HLA-A heavy chain amino acid sequence:
- polypeptide of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to amino acids 25-362 of the amino acid sequence of the human HLA-B heavy chain polypeptide depicted in Figure 5B.
- polypeptide of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to amino acids 25-362 of the amino acid sequence of the human HLA-C heavy chain polypeptide depicted in Figure 5C.
- polypeptide of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- a 2-microglobulin ( ⁇ 2 ⁇ ) polypeptide of a multimeric polypeptide of the present disclosure can be a human ⁇ 2 ⁇ polypeptide, a non-human primate ⁇ 2 ⁇ polypeptide, a murine ⁇ 2 ⁇ polypeptide, and the like.
- a ⁇ 2 ⁇ polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to a ⁇ 2 ⁇ amino acid sequence depicted in FIG. 6.
- a ⁇ 2 ⁇ polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to amino acids 21 to 119 of a ⁇ 2 ⁇ amino acid sequence depicted in FIG. 6.
- an MHC polypeptide comprises a single amino acid substitution relative to a reference MHC polypeptide (where a reference MHC polypeptide can be a wild-type MHC polypeptide), where the single amino acid substitution substitutes an amino acid with a cysteine (Cys) residue.
- cysteine residues when present in an MHC polypeptide of a first polypeptide of a multimeric polypeptide of the present disclosure, can form a disulfide bond with a cysteine residue present in a second polypeptide chain of a multimeric polypeptide of the present disclosure.
- polypeptide of the present disclosure and/or the second MHC polypeptide in the second polypeptide of a multimeric polypeptide of the present disclosure, includes an amino acid substitution to substitute an amino acid with a cysteine, where the substituted cysteine in the first MHC polypeptide forms a disulfide bond with a cysteine in the second MHC polypeptide, where a cysteine in the first MHC polypeptide forms a disulfide bond with the substituted cysteine in the second MHC polypeptide, or where the substituted cysteine in the first MHC polypeptide forms a disulfide bond with the substituted cysteine in the second MHC polypeptide.
- one of following pairs of residues in an HLA ⁇ 2- microglobulin and an HLA Class I heavy chain is substituted with cysteines (where residue numbers are those of the mature polypeptide): 1) ⁇ 2 ⁇ residue 12, HLA Class I heavy chain residue 236; 2) ⁇ 2 ⁇ residue 12, HLA Class I heavy chain residue 237; 3) ⁇ 2 ⁇ residue 8, HLA Class I heavy chain residue 234; 4) ⁇ 2 ⁇ residue 10, HLA Class I heavy chain residue 235; 5) ⁇ 2 ⁇ residue 24, HLA Class I heavy chain residue 236; 6) ⁇ 2 ⁇ residue 28, HLA Class I heavy chain residue 232; 7) ⁇ 2 ⁇ residue 98, HLA Class I heavy chain residue 192; 8) ⁇ 2 ⁇ residue 99, HLA Class I heavy chain residue 234; 9) ⁇ 2 ⁇ residue 3, HLA Class I heavy chain residue 120; 10) ⁇ 2 ⁇ residue 31, HLA Class I heavy chain residue 96; 11) ⁇ 2 ⁇ residue 53, HLA Class I heavy chain residue 35
- the amino acid numbering of the MHC/HLA Class I heavy chain is in reference to the mature MHC/HLA Class I heavy chain, without a signal peptide.
- Glyl20 is Glyl44
- Gln96 is Glnl20
- the ⁇ 2 ⁇ polypeptide comprises an R12C substitution
- the HLA Class I heavy chain comprises an A236C substitution; in such cases, a disulfide bond forms between Cys-12 of the ⁇ 2 ⁇ polypeptide and Cys-236 of the HLA Class I heavy chain.
- residue 236 of the mature HLA -A amino acid sequence i.e., residue 260 of the amino acid sequence depicted in FIG. 5A
- residue 236 of the mature HLA-B amino acid sequence i.e., residue 260 of the amino acid sequence depicted in FIG. 5B
- residue 236 of the mature HLA-C amino acid sequence i.e., residue 260 of the amino acid sequence depicted in FIG. 5C
- residue 32 (corresponding to Arg-12 of mature ⁇ 2 ⁇ ) of an amino acid sequence depicted in FIG. 6 is substituted with a Cys.
- a ⁇ 2 ⁇ polypeptide comprises the amino acid sequence: IQRTPKIQVY
- a ⁇ 2 ⁇ polypeptide comprises the amino acid sequence: IQRTPKIQVY SCHPAENGKS NFLNCYVSGF HPSDIEVDLLKNGERIEKVE HSDLSFSKDW SFYLLYYTEF TPTEKDEYAC RVNHVTLSQP KIVKWDRDM (SEQ ID NO: 87).
- an HLA Class I heavy chain polypeptide comprises the amino acid
- an HLA Class I heavy chain polypeptide comprises the amino acid
- GSHSMRYFFT SVSRPGRGEPRF IAVGYVDDTQFVRFDS DAASQRMEPRAPWIEQEGPEY WDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS DWRFLRGYHQYAYDGKDY IALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKT HMTHHAVS DHEATLRCWALSFYPAE I TLTWQRDGEDQTQDTELVETRPCGDGTFQKWAAVWPS GQEQRYTCHVQHEGLPKPLTLRWEP (SEQ ID NO:86).
- the ⁇ 2 ⁇ polypeptide comprises the following amino acid sequence:
- HSDLSFSKDW SFYLLYYTEF TPTEKDEYAC RVNHVTLSQP KIVKWDRDM SEQ ID NO:87
- HLA ClassI heavy chain polypeptide of a multimeric polypeptide of the present disclosure comprises the following amino acid sequence:
- a multimeric polypeptide of the present disclosure comprises a variant
- a multimeric polypeptide of the present disclosure comprises the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for CD28.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure binds CD28 with a binding affinity that is less than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure binds CD28 with a binding affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in SEQ ID NO: 1 for CD28.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure binds CD28 with a binding affinity that is less than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in SEQ ID NO: 1 for a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure binds CD28 with a binding affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in SEQ ID NO: l for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG. 3A-3C).
- a variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure has a binding affinity to CD28 that is from 100 nM to 100 ⁇ .
- a variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in one of FIG.
- 3A-3C that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or from about 75 ⁇ to about 100 ⁇ .
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure exhibits reduced binding affinity to CTLA4, compared to the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure binds CTLA4 with a binding affinity that less than the binding affinity a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for a CTLA4 polypeptide comprising the amino acid sequence depicted in FIG. 3D.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure binds CTLA4 with a binding affinity that is at least at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for CTLA4 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in FIG. 3D).
- a CD80 polypeptide comprising the amino acid sequence depicted in FIG. 2A for CTLA4 (e.g., a CD28 polypeptide comprising the amino acid sequence depicted in FIG. 3D).
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is an amino acid other than an asparagine, e.g., where amino acid 19 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at N19. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at N19. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2B, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2C.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is an amino acid other than an asparagine, e.g., where amino acid 63 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at N63. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at N63. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2D, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2E.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is an amino acid other than an isoleucine, e.g., where amino acid 67 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- amino acid 67 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is Ala, Gly, Val, or Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is Leu.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at 167.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at 167.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2F, where "x" is Ala, Gly, Val, or Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2F, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2F, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2F, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2F, where "x" is Gly. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2G.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is an amino acid other than a lysine, e.g., where amino acid 86 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at K86. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at K86. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2H, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 21.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is an amino acid other than a glutamine, e.g., where amino acid 157 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at Q157. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at Q157. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2J, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2K.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is an amino acid other than an aspartic acid, e.g., where amino acid 158 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at D158. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at D158. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD 80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2L, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2M.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is an amino acid other than a leucine, e.g., where amino acid 25 is Gly, Ala, Val, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- amino acid 25 is Gly, Ala, Val, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is Ala, Gly, Val, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at L25. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at L25. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is Ala, Gly, Val, or Ile.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2N, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 20.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is an amino acid other than a tyrosine, e.g., where amino acid 31 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at Y31. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at Y31. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2P.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is an amino acid other than a glutamine, e.g., where amino acid 33 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is Gly.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at Q33. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at Q33. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2R, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2S.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is an amino acid other than a methionine, e.g., where amino acid 38 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is Gly.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at M38.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at M38.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2T, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2U.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is an amino acid other than a valine, e.g., where amino acid 39 is Gly, Ala, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is Ala, Gly, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at V39. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at V39.For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is Ala, Gly, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2V, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2W.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is an amino acid other than an isoleucine, e.g., where amino acid 49 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is Ala, Gly, Val, or Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is Leu.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at 149. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at 149. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is Ala, Gly, Val, or Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2X, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Y.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is an amino acid other than a tyrosine, e.g., where amino acid 53 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is Gly.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at Y53. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at Y53.For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2Z, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2AA.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is an amino acid other than an aspartic acid, e.g., where amino acid 60 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is Gly.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at D60. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at D60. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD 80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2BB, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2CC.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is an amino acid other than a phenylalanine, e.g., where amino acid 108 is Gly, Ala, Val, Leu, He, Pro, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at F108. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at F108. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2DD, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2EE.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is an amino acid other than a serine, e.g., where amino acid 108 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2FF, where amino acid 156 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at SI 56. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at SI 56. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2FF, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2GG.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is Ala, Gly, Val, Leu, or He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is Val.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is Leu.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is He.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇ to about 20 ⁇ , from about 20 ⁇ to about 25 ⁇ , from about 25 ⁇ to about 50 ⁇ , from about 50 ⁇ to about 75 ⁇ , or
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2A, with an amino acid substitution at Pi l l. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in SEQ ID NO: l, with an amino acid substitution at Pi l l. For example, in some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is Ala, Gly, Val, Leu, or He. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is Ala.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is Val. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is Leu. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is Gly. In some cases, the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 2HH, where "x" is He.
- the variant CD80 polypeptide present in a multimeric polypeptide of the present disclosure comprises the amino acid sequence set forth in FIG. 211.
- the variant CD80 polypeptide has a binding affinity to CD28 that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ , to about 1 ⁇ to about 5 ⁇ , from about 5 ⁇ to about 10 ⁇ , from about 10 ⁇ to about 15 ⁇ , from about 15 ⁇
- disclosure can be an activating immunomodulatory polypeptide or an inhibitory
- a multimeric polypeptide of the present disclosure includes a single immunomodulatory polypeptide. In some cases, a multimeric polypeptide of the present disclosure includes two immunomodulatory polypeptides. In some cases, the two immunomodulatory polypeptides are in tandem in a polypeptide chain. In some cases, the two immunomodulatory polypeptides are in separate polypeptide chains. In some cases, the two immunomodulatory polypeptides are in separate polypeptide chains and are disulfide linked to one another.
- T-cell modulatory polypeptide is a stimulatory (activating) T-cell modulatory polypeptide. In some cases, the T-cell modulatory polypeptide is an inhibitory T-cell modulatory polypeptide.
- a T-cell modulatory polypeptide can be an antibody, a peptide ligand, a T-cell co-stimulatory
- polypeptide polypeptide, a cytokine, or a toxin.
- an immunomodulatory polypeptide of a multimeric polypeptide of the present disclosure is an antibody-based or non-antibody-based recognition moiety that specifically binds a co-stimulatory polypeptide that is expressed on the surface of an epitope - specific T cell.
- Antibody-based recognition moieties include, e.g., antibodies; fragments of antibodies that retain specific binding to antigen, including, but not limited to, Fab, Fv, single- chain Fv (scFv), and Fd fragments; chimeric antibodies; humanized antibodies; single -chain antibodies (scAb), single domain antibodies (dAb); single domain heavy chain antibodies; single domain light chain antibodies; and the like.
- Suitable non-antibody-based recognition moieties include, e.g., affibodies; engineered Kunitz domains; monobodies (adnectins); anticalins;
- an antibody- based or non-antibody-based recognition moiety specifically binds co-stimulatory polypeptide that is expressed on the surface of an epitope-specific T cell, where such co-stimulatory polypeptides include, but are not limited to, CTLA4, PDl, ICOS, OX40, CD20, and 4-lBB.
- co-stimulatory polypeptides include, but are not limited to, CTLA4, PDl, ICOS, OX40, CD20, and 4-lBB.
- Co- stimulatory polypeptides that are expressed on the surface of an epitope-specific T cell are known in the art. Multiple immunomodulatory domains
- the two or more immunomodulatory polypeptide comprises two or more immunomodulatory polypeptides, where at least one of the two or more immunomodulatory polypeptide is a variant CD80 polypeptide of the present disclosure.
- a multimeric polypeptide of the present disclosure comprises two or more copies of a variant CD80 polypeptide of the present disclosure.
- the two or more variant CD80 polypeptides are on the same polypeptide chain of a multimeric polypeptide of the present disclosure.
- the two or more variant CD80 polypeptides are on separate polypeptide chains of a multimeric polypeptide of the present disclosure.
- a multimeric polypeptide of the present disclosure comprises a first immunomodulatory polypeptide, and at least a second immunomodulatory polypeptide, where the first immunomodulatory polypeptide is a variant CD80 polypeptide of the present disclosure, and the second immunomodulatory polypeptide is not a CD80 polypeptide.
- the second immunomodulatory polypeptide is a member of the tumor necrosis factor (TNF) superfamily; e.g., a FasL polypeptide, a 4-1BBL polypeptide, a CD40 polypeptide, an OX40L polypeptide, a CD30L polypeptide, a CD70 polypeptide, etc.
- TNF tumor necrosis factor
- the second immunomodulatory polypeptide of a multimeric polypeptide of the present disclosure is a T-cell co-stimulatory polypeptide and is a member of the immunoglobulin (Ig) superfamily; e.g., a CD7 polypeptide, a CD86 polypeptide, an ICAM polypeptide, etc.
- the second immunomodulatory polypeptide is 4-1BBL, OX40L, ICOS-L, ICAM, PD-L1, FasL, and PD-L2.
- Suitable immunomodulatory polypeptides of a multimeric polypeptide of the present disclosure include, e.g., CD7, CD30L, CD40, CD70, CD83, HLA-G, MICA, MICB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, or HVEM.
- T cell modulatory domains that can be included in a multimeric
- polypeptide of the present disclosure include naturally occurring or synthetic human gene products (protein), affinity reagents (e.g., an antibody, antibody fragment, single chain Fvs, aptamers, nanobody) targeting a human gene product, including, but not limited to all secreted proteins arising from classical and non-classical (e.g., FGF2, IL1, S100A4) secretion mechanisms, and ecto-domains of all cell surface proteins anchored by naturally occurring genetically encoded protein segments (single or multiple membrane spans) or post-translational modifications such as GPI linkages).
- protein protein
- affinity reagents e.g., an antibody, antibody fragment, single chain Fvs, aptamers, nanobody
- FGF2, IL1, S100A4 e.g., IL1, S100A4
- affinity reagent e.g., antibody, antibody fragment, single chain Fvs, aptamer, nanobody, lectin, etc
- a cell surface glycan e.g., a cell surface glycan or other post-translational modification (e.g., sulfation).
- TNF/TNFR family examples include, but are not limited to, members of the TNF/TNFR family (OX40L, ICOSL, FASL, LTA, LTB TRAIL, CD153, TNFSF9, RANKL, TWEAK, TNFSF13, TNFSF13b, TNFSF14, TNFSF15, TNFSF18, CD40LG, CD70) or affinity reagents directed at the TNF/TNFR family members; members of the Immunoglobulin superfamily (VISTA, PDl, PD-Ll, PD-L2, B71, B72, CTLA4, CD28, TIM3, CD4, CD8, CD19, T cell receptor chains, ICOS, ICOS ligand, HHLA2, butyrophilins, BTLA, B7-H3, B7-H4, CD3, CD79a, CD79b, IgSF CAMS (including CD2, CD58, CD48, CD150, CD229, CD244, ICAM-1), Leukocyte immunoglobulin like receptors
- active homologs/orthologs of these gene products including but not limited to, viral sequences (e.g., CMV, EBV), bacterial sequences, fungal sequences, eukaryotic pathogens (e.g., Schistosoma, Plasmodium, Babesia, Eimeria, Theileria, Toxoplasma, Entamoeba, Leishmania, and Trypanosoma), and mammalian -derived coding regions.
- a MOD may comprise a small molecules drug targeting a human gene product.
- a T-cell modulatory multimeric polypeptide of the present disclosure comprises an Fc polypeptide, or another suitable scaffold polypeptide.
- Suitable scaffold polypeptides include antibody-based scaffold polypeptides and non- antibody-based scaffolds.
- Non-antibody-based scaffolds include, e.g., albumin, an XTEN (extended recombinant) polypeptide, transferrin, an Fc receptor polypeptide, an elastin-like polypeptide (see, e.g., Hassouneh et al. (2012) Methods Enzymol.
- Suitable XTEN polypeptides include, e.g., those disclosed in WO 2009/023270, WO 2010/091122, WO
- Suitable albumin polypeptides include, e.g., human serum albumin.
- Suitable scaffold polypeptides will in some cases be a half-life extending polypeptides.
- a suitable scaffold polypeptide increases the in vivo half-life (e.g., the serum half -life) of the multimeric polypeptide, compared to a control multimeric polypeptide lacking the scaffold polypeptide.
- a scaffold polypeptide increases the in vivo half -life (e.g., the serum half-life) of the multimeric polypeptide, compared to a control multimeric polypeptide lacking the scaffold polypeptide, by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 50%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, at least about 25-fold, at least about 50-fold, at least about 100-fold, or more than 100-fold.
- an Fc polypeptide increases the in vivo half-life (e.g., the serum half-life) of the multimeric polypeptide, compared to a control multimeric polypeptide lacking the Fc polypeptide, by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 50%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, at least about 25-fold, at least about 50-fold, at least about 100-fold, or more than 100-fold.
- the in vivo half-life e.g., the serum half-life
- the first and/or the second polypeptide chain of a multimeric polypeptide of the present disclosure comprises an Fc polypeptide.
- the Fc polypeptide of a multimeric polypeptide of the present disclosure can be a human IgGl Fc, a human IgG2 Fc, a human IgG3 Fc, a human IgG4 Fc, etc.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to an amino acid sequence of an Fc region depicted in Figures 4A-C.
- the Fc region comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgGl Fc polypeptide depicted in Figure 4A.
- the Fc region comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgGl Fc polypeptide depicted in Figure 4A; and comprises a substitution of N77; e.g., the Fc polypeptide comprises an N77A substitution.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgG2 Fc polypeptide depicted in Figure 4A; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 99-325 of the human IgG2 Fc polypeptide depicted in Figure 4A.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgG3 Fc polypeptide depicted in Figure 4A; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 19-246 of the human IgG3 Fc polypeptide depicted in Figure 4A.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgM Fc polypeptide depicted in FIG. 4B; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 1-276 to the human IgM Fc polypeptide depicted in FIG. 4B.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgA Fc polypeptide depicted in Figure 4C; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 1-234 to the human IgA Fc polypeptide depicted in FIG. 4C.
- a polypeptide chain of a multimeric polypeptide of the present disclosure can include one or more polypeptides in addition to those described above. Suitable additional polypeptides include epitope tags and affinity domains. The one or more additional polypeptide can be included at the N-terminus of a polypeptide chain of a multimeric polypeptide of the present disclosure, at the C-terminus of a polypeptide chain of a multimeric polypeptide of the present disclosure, or internally within a polypeptide chain of a multimeric polypeptide of the present disclosure.
- Suitable epitope tags include, but are not limited to, hemagglutinin (HA; e.g., HA;
- YPYDVPDYA (SEQ ID NO:89); FLAG (e.g., DYKDDDDK (SEQ ID NO:90); c-myc (e.g., EQKLISEEDL; SEQ ID NO:91), and the like.
- Affinity domains include peptide sequences that can interact with a binding partner, e.g., such as one immobilized on a solid support, useful for identification or purification.
- DNA sequences encoding multiple consecutive single amino acids, such as histidine, when fused to the expressed protein, may be used for one-step purification of the recombinant protein by high affinity binding to a resin column, such as nickel sepharose.
- Exemplary affinity domains include His5 (HHHHH) (SEQ ID NO:92), HisX6 (HHHHHH) (SEQ ID NO:93), C-myc
- WSHPQFEK SEQ ID NO:96
- hemagglutinin e.g., HA Tag (YPYDVPDYA) (SEQ ID NO:97)
- glutathione-S-transferase GST
- thioredoxin glutathione-S-transferase
- cellulose binding domain RYIRS (SEQ ID NO:98), Phe-His-His-Thr (SEQ ID NO:99), chitin binding domain, S-peptide, T7 peptide, SH2 domain, C-end RNA tag, WEAAAREACCRECCARA (SEQ ID NO: 100), metal binding domains, e.g., zinc binding domains or calcium binding domains such as those from calcium- binding proteins, e.g., calmodulin, troponin C, calcineurin B, myosin light chain, recoverin, S- modulin, visinin, VILIP, neurocalcin, hippocalcin, frequenin,
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 19 is an amino acid other than an asparagine, e.g., where amino acid 19 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 19 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C- terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 19 is an amino acid other than an asparagine, e.g., where amino acid 19 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 19 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is an amino acid other than an asparagine, e.g., where amino acid 19 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 19 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C- terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2B, where amino acid 19 is an amino acid other than an asparagine, e.g., where amino acid 19 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 19 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 63 is an amino acid other than an asparagine, e.g., where amino acid 63 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 63 is Ala, Gly, Val, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 63 is an amino acid other than an asparagine, e.g., where amino acid 63 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 63 is Ala, Gly, Val, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- the first, second, and third variant CD80 polypeptides each comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is an amino acid other than an asparagine, e.g., where amino acid 63 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 63 is Ala, Gly, Val, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- the first, second, and third variant CD80 polypeptides each comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is an amino acid other than an asparagine, e.g., where amino acid 63 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 63 is Ala, Gly, Val, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- the first, second, and third variant CD80 polypeptides each comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is an amino acid other than an asparagine, e.g., where amino acid 63 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 63 is Ala, Gly, Val, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; iv) a third variant CD80 polypeptide of the present disclosure; v) a Class I MHC heavy chain; and vi) an Fc polypeptide.
- the first, second, and third variant CD80 polypeptides each comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2D, where amino acid 63 is an amino acid other than an asparagine, e.g., where amino acid 63 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 63 is Ala, Gly, Val, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 67 is an amino acid other than an isoleucine, e.g., where amino acid 67 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 67 is Val, Gly, or Leu; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 67 is an amino acid other than an isoleucine, e.g., where amino acid 67 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 67 is Val, Gly, or Leu; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is an amino acid other than an isoleucine, e.g., where amino acid 67 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 67 is Ala, Val, Gly, or Leu.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vi) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is an amino acid other than an isoleucine, e.g., where amino acid 67 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 67 is Ala, Val, Gly, or Leu.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is an amino acid other than an isoleucine, e.g., where amino acid 67 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 67 is Ala, Val, Gly, or Leu.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2F, where amino acid 67 is an amino acid other than an isoleucine, e.g., where amino acid 67 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 67 is Ala, Val, Gly, or Leu.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 86 is an amino acid other than a lysine, e.g., where amino acid 86 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Arg, His, Asp, or Glu, e.g., where amino acid 86 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 86 is an amino acid other than a lysine, e.g., where amino acid 86 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Arg, His, Asp, or Glu, e.g., where amino acid 86 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is an amino acid other than a lysine, e.g., where amino acid 86 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Arg, His, Asp, or Glu, e.g., where amino acid 86 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is an amino acid other than a lysine, e.g., where amino acid 86 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Arg, His, Asp, or Glu, e.g., where amino acid 86 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is an amino acid other than a lysine, e.g., where amino acid 86 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Arg, His, Asp, or Glu, e.g., where amino acid 86 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2H, where amino acid 86 is an amino acid other than a lysine, e.g., where amino acid 86 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Arg, His, Asp, or Glu, e.g., where amino acid 86 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is an amino acid other than a glutamine, e.g., where amino acid 157 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 157 is an amino acid other than a glutamine, e.g., where amino acid 157 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 157 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C- terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 157 is an amino acid other than a glutamine, e.g., where amino acid 157 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 157 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is an amino acid other than a glutamine, e.g., where amino acid 157 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 157 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is an amino acid other than a glutamine, e.g., where amino acid 157 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 157 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is an amino acid other than a glutamine, e.g., where amino acid 157 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 157 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2J, where amino acid 157 is an amino acid other than a glutamine, e.g., where amino acid 157 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 157 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 158 is an amino acid other than an aspartic acid, e.g., where amino acid 158 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 158 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C- terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 158 is an amino acid other than an aspartic acid, e.g., where amino acid 158 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 158 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is an amino acid other than an aspartic acid, e.g., where amino acid 158 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 158 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N- terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is an amino acid other than an aspartic acid, e.g., where amino acid 158 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 158 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is an amino acid other than an aspartic acid, e.g., where amino acid 158 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 158 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vi) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2L, where amino acid 158 is an amino acid other than an aspartic acid, e.g., where amino acid 158 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 158 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 25 is an amino acid other than a leucine, e.g., where amino acid 25 is Gly, Ala, Val, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 25 is Ala, Val, Gly, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N- terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 25 is an amino acid other than a leucine, e.g., where amino acid 25 is Gly, Ala, Val, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 25 is Ala, Val, Gly, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is an amino acid other than a leucine, e.g., where amino acid 25 is Gly, Ala, Val, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 25 is Ala, Val, Gly, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is an amino acid other than a leucine, e.g., where amino acid 25 is Gly, Ala, Val, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 25 is Ala, Val, Gly, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is an amino acid other than a leucine, e.g., where amino acid 25 is Gly, Ala, Val, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 25 is Ala, Val, Gly, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2N, where amino acid 25 is an amino acid other than a leucine, e.g., where amino acid 25 is Gly, Ala, Val, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 25 is Ala, Val, Gly, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 31 is an amino acid other than a tyrosine, e.g., where amino acid 31 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 31 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 31 is an amino acid other than a tyrosine, e.g., where amino acid 31 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 31 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is an amino acid other than a tyrosine, e.g., where amino acid 31 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 31 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is an amino acid other than a tyrosine, e.g., where amino acid 31 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 31 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is an amino acid other than a tyrosine, e.g., where amino acid 31 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 31 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2P, where amino acid 31 is an amino acid other than a tyrosine, e.g., where amino acid 31 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 31 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 33 is an amino acid other than a glutamine, e.g., where amino acid 33 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 33 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 33 is an amino acid other than a glutamine, e.g., where amino acid 33 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 33 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is an amino acid other than a glutamine, e.g., where amino acid 33 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 33 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is an amino acid other than a glutamine, e.g., where amino acid 33 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 33 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is an amino acid other than a glutamine, e.g., where amino acid 33 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 33 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2R, where amino acid 33 is an amino acid other than a glutamine, e.g., where amino acid 33 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 33 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 38 is an amino acid other than a methionine, e.g., where amino acid 38 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 38 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C- terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 38 is an amino acid other than a methionine, e.g., where amino acid 38 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 38 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is an amino acid other than a methionine, e.g., where amino acid 38 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 38 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is an amino acid other than a methionine, e.g., where amino acid 38 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 38 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is an amino acid other than a methionine, e.g., where amino acid 38 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 38 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2T, where amino acid 38 is an amino acid other than a methionine, e.g., where amino acid 38 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 38 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 39 is an amino acid other than a valine, e.g., where amino acid 39 is Gly, Ala, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 39 is Ala, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N- terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 39 is an amino acid other than a valine, e.g., where amino acid 39 is Gly, Ala, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 39 is Ala, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is an amino acid other than a valine, e.g., where amino acid 39 is Gly, Ala, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 39 is Ala, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is an amino acid other than a valine, e.g., where amino acid 39 is Gly, Ala, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 39 is Ala, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is an amino acid other than a valine, e.g., where amino acid 39 is Gly, Ala, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 39 is Ala, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2V, where amino acid 39 is an amino acid other than a valine, e.g., where amino acid 39 is Gly, Ala, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 39 is Ala, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 49 is an amino acid other than an isoleucine, e.g., where amino acid 49 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 49 is Ala, Val, Gly, or Leu; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C- terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 49 is an amino acid other than an isoleucine, e.g., where amino acid 49 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 49 is Ala, Val, Gly, or Leu; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is an amino acid other than an isoleucine, e.g., where amino acid 49 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 49 is Ala, Val, Gly, or Leu.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is an amino acid other than an isoleucine, e.g., where amino acid 49 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 49 is Ala, Val, Gly, or Leu.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is an amino acid other than an isoleucine, e.g., where amino acid 49 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 49 is Ala, Val, Gly, or Leu.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2X, where amino acid 49 is an amino acid other than an isoleucine, e.g., where amino acid 49 is Gly, Ala, Val, Leu, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 49 is Ala, Val, Gly, or Leu.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 53 is an amino acid other than a tyrosine, e.g., where amino acid 53 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 53 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 53 is an amino acid other than a tyrosine, e.g., where amino acid 53 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 53 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is an amino acid other than a tyrosine, e.g., where amino acid 53 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 53 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is an amino acid other than a tyrosine, e.g., where amino acid 53 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 53 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is an amino acid other than a tyrosine, e.g., where amino acid 53 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 53 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2Z, where amino acid 53 is an amino acid other than a tyrosine, e.g., where amino acid 53 is Gly, Ala, Val, Leu, He, Pro, Phe, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 53 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 60 is an amino acid other than an aspartic acid, e.g., where amino acid 60 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 60 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 60 is an amino acid other than an aspartic acid, e.g., where amino acid 60 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 60 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is an amino acid other than an aspartic acid, e.g., where amino acid 60 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 60 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is an amino acid other than an aspartic acid, e.g., where amino acid 60 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 60 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is an amino acid other than an aspartic acid, e.g., where amino acid 60 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 60 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2BB, where amino acid 60 is an amino acid other than an aspartic acid, e.g., where amino acid 60 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, or Glu, e.g., where amino acid 60 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 108 is an amino acid other than a phenylalanine, e.g., where amino acid 108 is Gly, Ala, Val, Leu, He, Pro, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 108 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C- terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 108 is an amino acid other than a phenylalanine, e.g., where amino acid 108 is Gly, Ala, Val, Leu, He, Pro, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 108 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is an amino acid other than a phenylalanine, e.g., where amino acid 108 is Gly, Ala, Val, Leu, He, Pro, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 108 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is an amino acid other than a phenylalanine, e.g., where amino acid 108 is Gly, Ala, Val, Leu, He, Pro, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 108 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is an amino acid other than a phenylalanine, e.g., where amino acid 108 is Gly, Ala, Val, Leu, He, Pro, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 108 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2DD, where amino acid 108 is an amino acid other than a phenylalanine, e.g., where amino acid 108 is Gly, Ala, Val, Leu, He, Pro, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 108 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C- terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; and iii) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 156 is an amino acid other than a serine, e.g., where amino acid 156 is Gly, Ala, Val, Leu, He, Pro, Phe, Tyr, Trp, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 156 is Ala, Val, Gly, Leu, or He; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a variant CD80 polypeptide comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG.
- amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He; ii) a Class I MHC heavy chain; and iii) an Fc polypeptide.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a second variant CD80 polypeptide of the present disclosure; and v) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C- terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a ⁇ 2 ⁇ polypeptide; iii) a first variant CD80 polypeptide of the present disclosure; iv) a linker; v) a second variant CD80 polypeptide of the present disclosure; vi) a linker; and vii) a third variant CD80 polypeptide of the present disclosure; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a Class I MHC heavy chain; and ii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a second variant CD80 polypeptide of the present disclosure; and iii) a third variant CD80 polypeptide of the present disclosure; iv) a Class I MHC heavy chain; and v) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He.
- a multimeric polypeptide of the present disclosure comprises: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; and ii) a ⁇ 2 ⁇ polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a first variant CD80 polypeptide of the present disclosure; ii) a linker; iii) a second variant CD80 polypeptide of the present disclosure; iv) a linker; v) a third variant CD80 polypeptide of the present disclosure; vi) a Class I MHC heavy chain; and vii) an Fc polypeptide.
- each of the first, second, and third variant CD80 polypeptides comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, or at least 99%, amino acid sequence identity to the amino acid sequence depicted in FIG. 2HH, where amino acid 111 is an amino acid other than a proline, e.g., where amino acid 111 is Gly, Ala, Val, Leu, He, Phe, Tyr, Trp, Ser, Thr, Cys, Met, Asn, Gin, Lys, Arg, His, Asp, or Glu, e.g., where amino acid 111 is Ala, Val, Gly, Leu, or He.
- the linker comprises a (GSSSS)n (SEQ ID NO:73) sequence, where n is 1, 2, 3, 4, or 5. In some cases, n is 4. In some cases, n is 5.
- the present disclosure provides a nucleic acid comprising a nucleotide sequence
- the present disclosure provides a nucleic acid comprising a nucleotide sequence encoding a CD80 fusion polypeptide of the present disclosure.
- the present disclosure provides nucleic acids comprising nucleotide sequences encoding a multimeric polypeptide of the present disclosure.
- the individual polypeptide chains of a multimeric polypeptide of the present disclosure are encoded in separate nucleic acids.
- all polypeptide chains of a multimeric polypeptide of the present disclosure are encoded in a single nucleic acid.
- a first nucleic acid comprises a nucleotide sequence encoding a first polypeptide of a multimeric polypeptide of the present disclosure; and a second nucleic acid comprises a nucleotide sequence encoding a second polypeptide of a multimeric polypeptide of the present disclosure.
- single nucleic acid comprises a nucleotide sequence encoding a first polypeptide of a multimeric polypeptide of the present disclosure and a second polypeptide of a multimeric polypeptide of the present disclosure.
- nucleic acids comprising nucleotide sequences encoding a multimeric polypeptide of the present disclosure.
- the individual polypeptide chains of a multimeric polypeptide of the present disclosure are encoded in separate nucleic acids.
- nucleotide sequences encoding the separate polypeptide chains of a multimeric polypeptide of the present disclosure are operably linked to transcriptional control elements, e.g., promoters, such as promoters that are functional in a eukaryotic cell, where the promoter can be a constitutive promoter or an inducible promoter.
- the present disclosure provides a first nucleic acid and a second nucleic acid, where the first nucleic acid comprises a nucleotide sequence encoding a first polypeptide of a multimeric polypeptide of the present disclosure, where the first polypeptide comprises, in order from N- terminus to C-terminus: a) an epitope (e.g., a T-cell epitope); b) a first MHC polypeptide; and c) an immunomodulatory polypeptide (e.g., a variant CD80 polypeptide of the present disclosure); and where the second nucleic acid comprises a nucleotide sequence encoding a second polypeptide of a multimeric polypeptide of the present disclosure, where the second polypeptide comprises, in order from N-terminus to C-terminus: a) a second MHC polypeptide; and b) an Ig Fc polypeptide.
- the first nucleic acid comprises a nucleotide sequence encoding a first polypeptide
- Suitable T-cell epitopes, MHC polypeptides, immunomodulatory polypeptides, and Ig Fc polypeptides are described above.
- the nucleotide sequences encoding the first and the second polypeptides are operably linked to transcriptional control elements.
- the transcriptional control element is a promoter that is functional in a eukaryotic cell.
- the nucleic acids are present in separate expression vectors.
- the present disclosure provides a first nucleic acid and a second nucleic acid, where the first nucleic acid comprises a nucleotide sequence encoding a first polypeptide of a multimeric polypeptide of the present disclosure, where the first polypeptide comprises, in order from N- terminus to C-terminus: a) an epitope (e.g., a T-cell epitope); and b) a first MHC polypeptide; and where the second nucleic acid comprises a nucleotide sequence encoding a second polypeptide of a multimeric polypeptide of the present disclosure, where the second polypeptide comprises, in order from N-terminus to C-terminus: a) an immunomodulatory polypeptide (e.g., a variant CD80 polypeptide of the present disclosure); b) a second MHC polypeptide; and c) an Ig Fc polypeptide.
- an immunomodulatory polypeptide e.g., a variant CD80 polypeptide of the present
- Suitable T-cell epitopes, MHC polypeptides, immunomodulatory polypeptides, and Ig Fc polypeptides are described above.
- the nucleotide sequences encoding the first and the second polypeptides are operably linked to transcriptional control elements.
- the transcriptional control element is a promoter that is functional in a eukaryotic cell.
- the nucleic acids are present in separate expression vectors.
- the present disclosure provides a nucleic acid comprising nucleotide sequences
- the nucleic acid includes a nucleotide sequence encoding the first, second, and third polypeptides.
- the nucleotide sequences encoding the first polypeptide and the second polypeptide of a multimeric polypeptide of the present disclosure includes a proteolytically cleavable linker interposed between the nucleotide sequence encoding the first polypeptide and the nucleotide sequence encoding the second polypeptide.
- the nucleotide sequences encoding the first polypeptide and the second polypeptide of a multimeric polypeptide of the present disclosure includes an internal ribosome entry site (IRES) interposed between the nucleotide sequence encoding the first polypeptide and the nucleotide sequence encoding the second polypeptide.
- the nucleotide sequences encoding the first polypeptide and the second polypeptide of a multimeric polypeptide of the present disclosure includes a ribosome skipping signal (or cw-acting hydrolase element, CHYSEL) interposed between the nucleotide sequence encoding the first polypeptide and the nucleotide sequence encoding the second polypeptide.
- nucleic acids examples include nucleic acids, where a proteolytically cleavable linker is provided between nucleotide sequences encoding the first polypeptide and the second polypeptide of a multimeric polypeptide of the present disclosure; in any of these embodiments, an IRES or a ribosome skipping signal can be used in place of the nucleotide sequence encoding the proteolytically cleavable linker.
- a first nucleic acid (e.g., a recombinant expression vector, an mRNA, a viral RNA, etc.) comprises a nucleotide sequence encoding a first polypeptide chain of a multimeric polypeptide of the present disclosure
- a second nucleic acid (e.g., a recombinant expression vector, an mRNA, a viral RNA, etc.) comprises a nucleotide sequence encoding a second polypeptide chain of a multimeric polypeptide of the present disclosure.
- the nucleotide sequence encoding the first polypeptide, and the second nucleotide sequence encoding the second polypeptide are each operably linked to transcriptional control elements, e.g., promoters, such as promoters that are functional in a eukaryotic cell, where the promoter can be a constitutive promoter or an inducible promoter.
- promoters such as promoters that are functional in a eukaryotic cell, where the promoter can be a constitutive promoter or an inducible promoter.
- the present disclosure provides a nucleic acid comprising a nucleotide sequence
- a recombinant polypeptide comprising, in order from N-terminus to C-terminus: a) an epitope (e.g., a T-cell epitope); b) a first MHC
- an immunomodulatory polypeptide e.g., a variant CD80 polypeptide of the present disclosure
- a proteolytically cleavable linker e.g., a second MHC polypeptide
- an immunoglobulin (Ig) Fc polypeptide e.g., an immunoglobulin (Ig) Fc polypeptide.
- the present disclosure provides a nucleic acid comprising a nucleotide sequence encoding a recombinant polypeptide, where the recombinant polypeptide comprises, in order from N-terminus to C-terminus: a) a first leader peptide; b) the epitope; c) the first MHC polypeptide; d) the immunomodulatory polypeptide (e.g., a variant CD80 polypeptide of the present disclosure); e) the proteolytically cleavable linker; f) a second leader peptide; g) the second MHC polypeptide; and h) the Ig Fc polypeptide.
- the immunomodulatory polypeptide e.g., a variant CD80 polypeptide of the present disclosure
- the present disclosure provides a nucleic acid comprising a nucleotide sequence encoding a recombinant polypeptide, where the recombinant polypeptide comprises, in order from N-terminus to C-terminus: a) an epitope; b) a first MHC polypeptide; c) a proteolytically cleavable linker; d) an
- immunomodulatory polypeptide e.g., a variant CD80 polypeptide of the present disclosure
- a second MHC polypeptide e.g., a second MHC polypeptide
- an Ig Fc polypeptide e.g., an immunomodulatory polypeptide.
- the first leader peptide and the second leader peptide is a ⁇ 2- ⁇ leader peptide.
- the nucleotide sequence is operably linked to a transcriptional control element.
- the transcriptional control element is a promoter that is functional in a eukaryotic cell.
- Suitable MHC polypeptides are described above. In some cases, the first MHC
- polypeptide is a 2-microglobulin polypeptide; and wherein the second MHC polypeptide is an MHC class I heavy chain polypeptide.
- the 2-microglobulin polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:52, or at least 85% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO: 87).
- the MHC class I heavy chain polypeptide is an HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, HLA-G, HLA-K, or HLA-L heavy chain.
- the MHC class I heavy chain polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to amino acids 25-365 of the amino acid sequence set forth in SEQ ID NO:49. In some cases, the MHC class I heavy chain polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to amino acids 25-362 of the amino acid sequence set forth in SEQ ID NO:50. In some cases, the MHC class I heavy chain polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to amino acids 25-366 of the amino acid sequence set forth in SEQ ID NO:51. In some cases, the first MHC polypeptide is an MHC Class II alpha chain polypeptide; and wherein the second MHC polypeptide is an MHC class II beta chain polypeptide.
- Suitable Fc polypeptides are described above.
- the Ig Fc polypeptide is an
- the Ig Fc polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to an amino acid sequence depicted in Figures 4A-4C.
- Suitable proteolytically cleavable linkers are described above. In some cases, the
- proteolytically cleavable linker comprises an amino acid sequence selected from: a) LEVLFQGP (SEQ ID NO:78); b) ENLYTQS (SEQ ID NO:79); c) DDDDK (SEQ ID NO: 101); d) LVPR (SEQ ID NO:80); and e) GSGATNFSLLKQAGDVEENPGP (SEQ ID NO:81).
- the proteolytically cleavable linker comprises an amino acid sequence selected from: a) LEVLFQGP (SEQ ID NO:78); b) ENLYTQS (SEQ ID NO:79); c) a furin cleavage site; d) LVPR (SEQ ID NO:80); e) GSGATNFSLLKQAGDVEENPGP (SEQ ID NO:81); f)
- GSGEGRGSLLTCGDVEENPGP SEQ ID NO: 82
- GSGQCTNYALLKLAGDVESNPGP SEQ ID NO:83
- GSGVKQTLNFDLLKLAGDVESNPGP SEQ ID NO:84
- a linker between the epitope and the first MHC polypeptide comprises a first Cys residue
- the second MHC polypeptide comprises an amino acid substitution to provide a second Cys residue, such that the first and the second Cys residues provide for a disulfide linkage between the linker and the second MHC polypeptide.
- first MHC polypeptide comprises an amino acid substitution to provide a first Cys residue
- the second MHC polypeptide comprises an amino acid substitution to provide a second Cys residue, such that the first Cys residue and the second Cys residue provide for a disulfide linkage between the first MHC polypeptide and the second MHC polypeptide.
- the present disclosure provides recombinant expression vectors comprising nucleic acids of the present disclosure.
- the recombinant expression vector is a non-viral vector.
- the recombinant expression vector is a viral construct, e.g., a recombinant adeno-associated virus construct (see, e.g., U.S. Patent No. 7,078,387), a recombinant adenoviral construct, a recombinant lentiviral construct, a recombinant retroviral construct, a non-integrating viral vector, etc.
- Suitable expression vectors include, but are not limited to, viral vectors (e.g. viral
- a retroviral vector e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, human immunodeficiency virus, myeloproliferative sarcoma virus, and mammary tumor virus; and the like.
- Suitable expression vectors are known to those of skill in the art, and many are commercially available.
- the following vectors are provided by way of example; for eukaryotic host cells: pXTl, pSG5 (Stratagene), pSVK3, pBPV, pMSG, and pSVLSV40 (Pharmacia).
- any other vector may be used so long as it is compatible with the host cell.
- any of a number of suitable transcription and translation control elements including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc. may be used in the expression vector (see e.g., Bitter et al. (1987) Methods in Enzymology, 153:516-544).
- a nucleotide sequence encoding a DNA-targeting RNA and/or a site -directed modifying polypeptide is operably linked to a control element, e.g., a transcriptional control element, such as a promoter.
- the transcriptional control element may be functional in either a eukaryotic cell, e.g., a mammalian cell; or a prokaryotic cell (e.g., bacterial or archaeal cell).
- a nucleotide sequence encoding a DNA-targeting RNA and/or a site -directed modifying polypeptide is operably linked to multiple control elements that allow expression of the nucleotide sequence encoding a DNA-targeting RNA and/or a site -directed modifying polypeptide in both prokaryotic and eukaryotic cells.
- Non-limiting examples of suitable eukaryotic promoters include those from cytomegalovirus (CMV) immediate early, herpes simplex virus (HSV) thymidine kinase, early and late SV40, long terminal repeats (LTRs) from retrovirus, and mouse metallothionein-I. Selection of the appropriate vector and promoter is well within the level of ordinary skill in the art.
- the expression vector may also contain a ribosome binding site for translation initiation and a transcription terminator.
- the expression vector may also include appropriate sequences for amplifying expression.
- the present disclosure provides a genetically modified host cell, where the host cell is genetically modified with a nucleic acid of the present disclosure.
- Suitable host cells include eukaryotic cells, such as yeast cells, insect cells, and
- the host cell is a cell of a mammalian cell line.
- Suitable mammalian cell lines include human cell lines, non-human primate cell lines, rodent (e.g., mouse, rat) cell lines, and the like.
- Suitable mammalian cell lines include, but are not limited to, HeLa cells (e.g., American Type Culture Collection (ATCC) No. CCL-2), CHO cells (e.g., ATCC Nos. CRL9618, CCL61, CRL9096), 293 cells (e.g., ATCC No. CRL-1573), Vero cells, NIH 3T3 cells (e.g., ATCC No.
- Huh-7 cells BHK cells (e.g., ATCC No. CCL10), PC12 cells (ATCC No. CRL1721), COS cells, COS-7 cells (ATCC No. CRL1651), RATI cells, mouse L cells (ATCC No. CCLI.3), human embryonic kidney (HEK) cells (ATCC No.
- the host cell is a mammalian cell that has been genetically modified such that it does not synthesize endogenous MHC ⁇ 2- ⁇ .
- the present disclosure provides methods of producing a multimeric polypeptide of the present disclosure.
- the methods generally involve culturing, in a culture medium, a host cell that is genetically modified with a recombinant expression vector comprising a nucleotide sequence encoding the multimeric polypeptide; and isolating the multimeric polypeptide from the genetically modified host cell and/or the culture medium.
- a host cell that is genetically modified with a recombinant expression vector comprising a nucleotide sequence encoding the multimeric polypeptide is also referred to as an "expression host.”
- the individual polypeptide chains of a multimeric polypeptide of the present disclosure are encoded in separate recombinant expression vectors.
- all polypeptide chains of a multimeric polypeptide of the present disclosure are encoded in a single recombinant expression vector.
- Isolation of the multimeric polypeptide from the expression host cell e.g., from a lysate of the expression host cell
- the culture medium in which the host cell is cultured can be carried out using standard methods of protein purification.
- a lysate may be prepared of the expression host and the lysate purified using high performance liquid chromatography (HPLC), exclusion chromatography, gel electrophoresis, affinity chromatography, or other purification technique.
- HPLC high performance liquid chromatography
- exclusion chromatography gel electrophoresis
- affinity chromatography affinity chromatography
- the multimeric polypeptide can be purified from the culture medium using HPLC, exclusion chromatography, gel electrophoresis, affinity chromatography, or other purification technique.
- compositions which are used will comprise at least 80% by weight of the desired product, at least about 85% by weight, at least about 95% by weight, or at least about 99.5% by weight, in relation to contaminants related to the method of preparation of the product and its purification.
- the percentages can be based upon total protein.
- the multimeric polypeptide can be purified using an immobilized binding partner of the affinity tag.
- compositions including pharmaceutical compositions, comprising a variant CD80 polypeptide of the present disclosure.
- compositions including pharmaceutical compositions, comprising a multimeric polypeptide of the present disclosure.
- compositions comprising a multimeric polypeptide
- composition of the present disclosure can comprise, in addition to a multimeric
- polypeptide of the present disclosure one or more of: a salt, e.g., NaCl, MgCl 2 , KC1, MgS0 4 , etc.; a buffering agent, e.g., a Tris buffer, N-(2-Hydroxyethyl)piperazine-N'-(2-ethanesulfonic acid) (HEPES), 2-(N-Morpholino)ethanesulfonic acid (MES), 2-(N-Morpholino)ethanesulfonic acid sodium salt (MES), 3-(N-Morpholino)propanesulfonic acid (MOPS), N- tris[Hydroxymethyl]methyl-3-aminopropanesulfonic acid (TAPS), etc.; a solubilizing agent; a detergent, e.g., a non-ionic detergent such as Tween-20, etc.; a protease inhibitor; glycerol; and the like.
- the composition may comprise a pharmaceutically acceptable excipient, a variety of which are known in the art and need not be discussed in detail herein.
- Pharmaceutically acceptable excipients have been amply described in a variety of publications, including, for example, "Remington: The Science and Practice of Pharmacy", 19 th Ed. (1995), or latest edition, Mack Publishing Co; A. Gennaro (2000) “Remington: The Science and Practice of Pharmacy", 20th edition, Lippincott, Williams, & Wilkins; Pharmaceutical Dosage Forms and Drug Delivery Systems (1999) H.C. Ansel et al., eds 7 th ed., Lippincott, Williams, & Wilkins; and Handbook of Pharmaceutical Excipients (2000) A.H. Kibbe et al., eds., 3 rd ed. Amer. Pharmaceutical Assoc.
- a pharmaceutical composition can comprise a multimeric polypeptide of the present disclosure, and a pharmaceutically acceptable excipient.
- a subject pharmaceutical composition will be suitable for administration to a subject, e.g., will be sterile.
- a subject pharmaceutical composition will be suitable for administration to a human subject, e.g., where the composition is sterile and is free of detectable pyrogens and/or other toxins.
- the protein compositions may comprise other components, such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium, carbonate, and the like.
- the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate, hydrochloride, sulfate salts, solvates (e.g., mixed ionic salts, water, organics), hydrates (e.g., water), and the like.
- compositions may include aqueous solution, powder form, granules, tablets, pills, suppositories, capsules, suspensions, sprays, and the like.
- the composition may be formulated according to the various routes of administration described below.
- a formulation can be provided as a ready-to-use dosage form, or as non-aqueous form (e.g. a reconstitutable storage-stable powder) or aqueous form, such as liquid composed of pharmaceutically acceptable carriers and excipients.
- the protein-containing formulations may also be provided so as to enhance serum half -life of the subject protein following administration.
- the protein may be provided in a liposome formulation, prepared as a colloid, or other conventional techniques for extending serum half-life.
- liposomes A variety of methods are available for preparing liposomes, as described in, e.g., Szoka et al. 1980 Ann. Rev. Biophys. Bioeng. 9:467, U.S. Pat. Nos. 4,235,871, 4,501,728 and 4,837,028.
- the preparations may also be provided in controlled release or slow-release forms.
- formulations suitable for parenteral administration include isotonic sterile injection solutions, anti-oxidants, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
- a subject pharmaceutical composition can be present in a container, e.g., a sterile container, such as a syringe.
- the formulations can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials, and can be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid excipient, for example, water, for injections, immediately prior to use.
- sterile liquid excipient for example, water
- Extemporaneous injection solutions and suspensions can be prepared from sterile powders, granules, and tablets.
- concentration of a multimeric polypeptide of the present disclosure in a formulation can vary widely (e.g., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight) and will usually be selected primarily based on fluid volumes, viscosities, and patient-based factors in accordance with the particular mode of administration selected and the patient's needs.
- the present disclosure provides a container comprising a composition of the present disclosure, e.g., a liquid composition.
- the container can be, e.g., a syringe, an ampoule, and the like.
- the container is sterile.
- both the container and the composition are sterile.
- compositions comprising a variant CD80 polypeptide of the present disclosure.
- a composition can comprise: a) a variant CD80 polypeptide of the present disclosure; and b) an excipient, as described above for the multimeric polypeptides.
- the excipient is a pharmaceutically acceptable excipient.
- compositions comprising a nucleic acid or a recombinant expression vector
- compositions e.g., pharmaceutical compositions
- nucleic acid or a recombinant expression vector of the present disclosure comprising a nucleic acid or a recombinant expression vector of the present disclosure.
- pharmaceutically acceptable excipients have been amply described in a variety of publications, including, for example, A. Gennaro (2000) "Remington: The Science and Practice of Pharmacy", 20th edition, Lippincott, Williams, & Wilkins; Pharmaceutical Dosage Forms and Drug Delivery Systems (1999) H. C. Ansel et al., eds 7 th ed., Lippincott, Williams, & Wilkins; and Handbook of Pharmaceutical Excipients (2000) A. H. Kibbe et al., eds., 3 rd ed. Amer. Pharmaceutical Assoc.
- a composition of the present disclosure can include: a) a subject nucleic acid or
- recombinant expression vector b) one or more of: a buffer, a surfactant, an antioxidant, a hydrophilic polymer, a dextrin, a chelating agent, a suspending agent, a solubilizer, a thickening agent, a stabilizer, a bacteriostatic agent, a wetting agent, and a preservative.
- a buffer a surfactant, an antioxidant, a hydrophilic polymer, a dextrin, a chelating agent, a suspending agent, a solubilizer, a thickening agent, a stabilizer, a bacteriostatic agent, a wetting agent, and a preservative.
- Suitable buffers include, but are not limited to, (such as N,N-bis(2-hydroxyethyl)-2-aminoethanesulfonic acid (BES), bis(2-hydroxyethyl)amino-tris(hydroxymethyl)methane (BIS-Tris), N-(2- hydroxyethyl)piperazine-N'3-propanesulfonic acid (EPPS or HEPPS), glycylglycine, N-2- hydroxyehtylpiperazine-N'-2-ethanesulfonic acid (HEPES), 3-(N-morpholino)propane sulfonic acid (MOPS), piperazine-N,N'-bis(2-ethane-sulfonic acid) (PIPES), sodium bicarbonate, 3-(N- tris(hydroxymethyl)-methyl-amino)-2-hydroxy-propanesulfonic acid) TAPSO, (N- tris(hydroxymethyl)methyl-2-aminoethanes
- a pharmaceutical formulation of the present disclosure can include a nucleic acid or recombinant expression vector of the present disclosure in an amount of from about 0.001% to about 90% (w/w).
- subject nucleic acid or recombinant expression vector will be understood to include a nucleic acid or recombinant expression vector of the present disclosure.
- a subject formulation comprises a nucleic acid or recombinant expression vector of the present disclosure.
- a subject nucleic acid or recombinant expression vector can be admixed, encapsulated, conjugated or otherwise associated with other compounds or mixtures of compounds; such compounds can include, e.g., liposomes or receptor-targeted molecules.
- a subject nucleic acid or recombinant expression vector can be combined in a formulation with one or more components that assist in uptake, distribution and/or absorption.
- a subject nucleic acid or recombinant expression vector composition can be formulated into any of many possible dosage forms such as, but not limited to, tablets, capsules, gel capsules, liquid syrups, soft gels, suppositories, and enemas.
- a subject nucleic acid or recombinant expression vector composition can also be formulated as suspensions in aqueous, non-aqueous or mixed media.
- Aqueous suspensions may further contain substances which increase the viscosity of the suspension including, for example, sodium carboxymethylcellulose, sorbitol and/or dextran.
- the suspension may also contain stabilizers.
- a formulation comprising a subject nucleic acid or recombinant expression vector can be a liposomal formulation.
- liposome means a vesicle composed of amphiphilic lipids arranged in a spherical bilayer or bilayers. Liposomes are unilamellar or multilamellar vesicles which have a membrane formed from a lipophilic material and an aqueous interior that contains the composition to be delivered. Cationic liposomes are positively charged liposomes that can interact with negatively charged DNA molecules to form a stable complex. Liposomes that are pH sensitive or negatively charged are believed to entrap DNA rather than complex with it. Both cationic and noncationic liposomes can be used to deliver a subject nucleic acid or recombinant expression vector.
- Liposomes also include "sterically stabilized" liposomes, a term which, as used herein, refers to liposomes comprising one or more specialized lipids that, when incorporated into liposomes, result in enhanced circulation lifetimes relative to liposomes lacking such specialized lipids.
- sterically stabilized liposomes are those in which part of the vesicle -forming lipid portion of the liposome comprises one or more glycolipids or is derivatized with one or more hydrophilic polymers, such as a polyethylene glycol (PEG) moiety.
- PEG polyethylene glycol
- formulations and compositions of the present disclosure may also include
- surfactants are used in drug products, formulations and in emulsions. Surfactants and their uses are further described in U.S. Pat. No. 6,287,860.
- various penetration enhancers are included, to effect the efficient delivery of nucleic acids.
- penetration enhancers also enhance the permeability of lipophilic drugs.
- Penetration enhancers may be classified as belonging to one of five broad categories, i.e., surfactants, fatty acids, bile salts, chelating agents, and non-chelating non-surfactants. Penetration enhancers and their uses are further described in U.S. Pat. No. 6,287,860, which is incorporated herein by reference in its entirety.
- compositions and formulations for oral administration include powders or granules, microparticulates, nanoparticulates, suspensions or solutions in water or non-aqueous media, capsules, gel capsules, sachets, tablets, or minitablets. Thickeners, flavoring agents, diluents, emulsifiers, dispersing aids or binders may be desirable.
- Suitable oral formulations include those in which a subject antisense nucleic acid is administered in conjunction with one or more penetration enhancers surfactants and chelators.
- Suitable surfactants include, but are not limited to, fatty acids and/or esters or salts thereof, bile acids and/or salts thereof.
- Suitable bile acids/salts and fatty acids and their uses are further described in U.S. Pat. No. 6,287,860.
- Also suitable are combinations of penetration enhancers, for example, fatty acids/salts in combination with bile acids/salts.
- An exemplary suitable combination is the sodium salt of lauric acid, capric acid, and UDCA.
- Further penetration enhancers include, but are not limited to, polyoxyethylene- 9-lauryl ether, and polyoxyethylene-20-cetyl ether.
- Suitable penetration enhancers also include propylene glycol, dime thylsulf oxide, triethanoiamine, N,N-dimethylacetamide, N,N- dimethylformamide, 2-pyrrolidone and derivatives thereof, tetrahydrofurfuryl alcohol, and AZONETM.
- the present disclosure provides a method of selectively modulating the activity of an epitope-specific T cell, the method comprising contacting the T cell with a multimeric polypeptide of the present disclosure, where contacting the T cell with a multimeric polypeptide of the present disclosure selectively modulates the activity of the epitope-specific T cell.
- the contacting occurs in vitro. In some cases, the contacting occurs in vivo. In some cases, the contacting occurs ex vivo.
- the multimeric polypeptide comprises Class I MHC polypeptides (e.g., 2-microglobulin and Class I MHC heavy chain).
- the multimeric polypeptide comprises Class II MHC polypeptides (e.g., Class II MHC a chain; Class II MHC ⁇ chain).
- the epitope-specific T cell is a T cell that is specific for an epitope present on a cancer cell, and contacting the epitope-specific T cell with the multimeric polypeptide increases cytotoxic activity of the T cell toward the cancer cell.
- the epitope-specific T cell is a T cell that is specific for an epitope present on a cancer cell, and contacting the epitope-specific T cell with the multimeric polypeptide increases the number of the epitope-specific T cells.
- the epitope-specific T cell is a T cell that is specific for an epitope present on a virus-infected cell, and contacting the epitope-specific T cell with the multimeric polypeptide increases cytotoxic activity of the T cell toward the virus-infected cell.
- the epitope-specific T cell is a T cell that is specific for an epitope present on a virus- infected cell, and contacting the epitope-specific T cell with the multimeric polypeptide increases the number of the epitope-specific T cells.
- the immunomodulatory polypeptide that is an inhibiting polypeptide, contacting the T cell with the multimeric inhibits the epitope-specific T cell.
- the epitope-specific T cell is a self-reactive T cell that is specific for an epitope present in a self antigen, and the contacting reduces the number of the self-reactive T cells.
- the present invention provides a method of selectively modulating the activity of an epitope-specific T cell in an individual, the method comprising administering to the individual an amount of the multimeric polypeptide of the present disclosure, or one or more nucleic acids encoding the multimeric polypeptide, effective to selectively modulate the activity of an epitope- specific T cell in an individual.
- a treatment method of the present disclosure comprises administering to an individual in need thereof one or more recombinant expression vectors comprising nucleotide sequences encoding a multimeric polypeptide of the present disclosure.
- a treatment method of the present disclosure comprises administering to an individual in need thereof one or more mRNA molecules comprising nucleotide sequences encoding a multimeric polypeptide of the present disclosure. In some cases, a treatment method of the present disclosure comprises administering to an individual in need thereof a multimeric polypeptide of the present disclosure.
- the present disclosure provides a method of selectively modulating the activity of an epitope-specific T cell in an individual, the method comprising administering to the individual an effective amount of a multimeric polypeptide of the present disclosure, or one or more nucleic acids (e.g., expression vectors; mRNA; etc.) comprising nucleotide sequences encoding the multimeric polypeptide, where the multimeric polypeptide selectively modulates the activity of the epitope-specific T cell in the individual.
- Selectively modulating the activity of an epitope- specific T cell can treat a disease or disorder in the individual.
- the present disclosure provides a treatment method comprising administering to an individual in need thereof an effective amount of a multimeric polypeptide of the present disclosure.
- the immunomodulatory polypeptide is an activating polypeptide, and the multimeric polypeptide activates the epitope-specific T cell.
- the epitope is a cancer-associated epitope, and the multimeric polypeptide increases the activity of a T cell specific for the cancer-associate epitope.
- the present disclosure provides a method of treating cancer in an individual, the method comprising administering to the individual an effective amount of a multimeric polypeptide of the present disclosure, or one or more nucleic acids (e.g., expression vectors; mRNA; etc.) comprising nucleotide sequences encoding the multimeric polypeptide, where the multimeric polypeptide comprises a T-cell epitope that is a cancer epitope, and where the multimeric polypeptide comprises a stimulatory immunomodulatory polypeptide.
- an "effective amount" of a multimeric polypeptide is an amount that, when administered in one or more doses to an individual in need thereof, reduces the number of cancer cells in the individual.
- an "effective amount" of a multimeric polypeptide of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, reduces the number of cancer cells in the individual by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to the number of cancer cells in the individual before administration of the multimeric polypeptide, or in the absence of administration with the multimeric polypeptide.
- an "effective amount" of a multimeric polypeptide of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, reduces the number of cancer cells in the individual to undetectable levels. In some cases, an "effective amount” of a multimeric polypeptide of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, reduces the tumor mass in the individual.
- an "effective amount" of a multimeric polypeptide of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, reduces the tumor mass (or tumor volume) in the individual by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to the tumor mass (or tumor volume) in the individual before administration of the multimeric polypeptide, or in the absence of administration with the multimeric polypeptide.
- an "effective amount" of a multimeric polypeptide of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, increases survival time of the individual.
- an "effective amount” of a multimeric polypeptide of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, increases survival time of the individual by at least 1 month, at least 2 months, at least 3 months, from 3 months to 6 months, from 6 months to 1 year, from 1 year to 2 years, from 2 years to 5 years, from 5 years to 10 years, or more than 10 years, compared to the expected survival time of the individual in the absence of administration with the multimeric polypeptide.
- the epitope-specific T cell is a T cell that is specific for an epitope present on a virus-infected cell, and contacting the epitope-specific T cell with the multimeric polypeptide increases cytotoxic activity of the T cell toward the virus-infected cell.
- the epitope-specific T cell is a T cell that is specific for an epitope present on a virus- infected cell, and contacting the epitope-specific T cell with the multimeric polypeptide increases the number of the epitope-specific T cells.
- the present disclosure provides a method of treating a virus infection in an
- an "effective amount" of a multimeric polypeptide is an amount that, when administered in one or more doses to an individual in need thereof, reduces the number of virus-infected cells in the individual.
- an "effective amount" of a multimeric polypeptide of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, reduces the number of virus-infected cells in the individual by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to the number of virus-infected cells in the individual before administration of the multimeric polypeptide, or in the absence of administration with the multimeric polypeptide.
- an "effective amount" of a multimeric polypeptide of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, reduces the number of virus-infected cells in the individual to undetectable levels.
- the present disclosure provides a method of treating an infection in an individual, the method comprising administering to the individual an effective amount of a multimeric polypeptide of the present disclosure, or one or more nucleic acids comprising nucleotide sequences encoding the multimeric polypeptide, where the multimeric polypeptide comprises a T-cell epitope that is a pathogen-associated epitope, and where the multimeric polypeptide comprises a stimulatory immunomodulatory polypeptide.
- an "effective amount" of a multimeric polypeptide is an amount that, when administered in one or more doses to an individual in need thereof, reduces the number of pathogens in the individual.
- an "effective amount" of a multimeric polypeptide of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, reduces the number of pathogens in the individual by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to the number of pathogens in the individual before administration of the multimeric polypeptide, or in the absence of administration with the multimeric polypeptide.
- an "effective amount" of a multimeric polypeptide of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, reduces the number of pathogens in the individual to undetectable levels.
- Pathogens include viruses, bacteria, protozoans, and the like.
- the immunomodulatory polypeptide is an inhibitory polypeptide, and the multimeric polypeptide inhibits activity of the epitope-specific T cell.
- the epitope is a self-epitope, and the multimeric polypeptide selectively inhibits the activity of a T cell specific for the self-epitope.
- the present disclosure provides a method of treating an autoimmune disorder in an individual, the method comprising administering to the individual an effective amount of a multimeric polypeptide of the present disclosure, or one or more nucleic acids comprising nucleotide sequences encoding the multimeric polypeptide, where the multimeric polypeptide comprises a T-cell epitope that is a self epitope, and where the multimeric polypeptide comprises an inhibitory immunomodulatory polypeptide.
- an "effective amount" of a multimeric polypeptide is an amount that, when administered in one or more doses to an individual in need thereof, reduces the number self-reactive T cells by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to number of self -reactive T cells in the individual before administration of the multimeric polypeptide, or in the absence of
- an "effective amount" of a multimeric polypeptide is an amount that, when administered in one or more doses to an individual in need thereof, reduces production of Th2 cytokines in the individual. In some cases, an "effective amount” of a multimeric polypeptide is an amount that, when administered in one or more doses to an individual in need thereof, ameliorates one or more symptoms associated with an autoimmune disease in the individual.
- a multimeric polypeptide of the present disclosure is administered to an individual in need thereof, as the polypeptide per se.
- one or more nucleic acids comprising nucleotide sequences encoding a multimeric polypeptide of the present disclosure is/are administering to an individual in need thereof.
- one or more nucleic acids of the present disclosure e.g., one or more recombinant expression vectors of the present disclosure, is/are administered to an individual in need thereof.
- Suitable formulations are described above, where suitable formulations include a
- a suitable formulation comprises: a) a multimeric polypeptide of the present disclosure; and b) a pharmaceutically acceptable excipient.
- a suitable formulation comprises: a) a nucleic acid comprising a nucleotide sequence encoding a multimeric polypeptide of the present disclosure; and b) a pharmaceutically acceptable excipient; in some instances, the nucleic acid is an mRNA.
- a suitable formulation comprises: a) a first nucleic acid comprising a nucleotide sequence encoding the first polypeptide of a multimeric polypeptide of the present disclosure; b) a second nucleic acid comprising a nucleotide sequence encoding the second polypeptide of a multimeric polypeptide of the present disclosure; and c) a pharmaceutically acceptable excipient.
- a suitable formulation comprises: a) a recombinant expression vector comprising a nucleotide sequence encoding a multimeric polypeptide of the present disclosure; and b) a pharmaceutically acceptable excipient.
- a suitable formulation comprises: a) a first recombinant expression vector comprising a nucleotide sequence encoding the first polypeptide of a multimeric polypeptide of the present disclosure; b) a second recombinant expression vector comprising a nucleotide sequence encoding the second polypeptide of a multimeric polypeptide of the present disclosure; and c) a pharmaceutically acceptable excipient.
- a suitable dosage can be determined by an attending physician or other qualified
- a multimeric polypeptide of the present disclosure may be administered in amounts between 1 ng/kg body weight and 20 mg/kg body weight per dose, e.g. between 0.1 mg/kg body weight to 10 mg/kg body weight, e.g. between 0.5 mg/kg body weight to 5 mg/kg body weight; however, doses below or above this exemplary range are envisioned, especially considering the aforementioned factors. If the regimen is a continuous infusion, it can also be in the range of 1 ⁇ g to 10 mg per kilogram of body weight per minute.
- a suitable dose of a multimeric polypeptide of the present disclosure is from 0.01 ⁇ g to 100 g per kg of body weight, from 0.1 ⁇ g to 10 g per kg of body weight, from 1 ⁇ g to 1 g per kg of body weight, from 10 ⁇ g to 100 mg per kg of body weight, from 100 ⁇ g to 10 mg per kg of body weight, or from 100 ⁇ g to 1 mg per kg of body weight.
- Persons of ordinary skill in the art can easily estimate repetition rates for dosing based on measured residence times and concentrations of the administered agent in bodily fluids or tissues.
- a multimeric polypeptide of the present disclosure is administered in maintenance doses, ranging from 0.01 ⁇ g to 100 g per kg of body weight, from 0.1 ⁇ g to 10 g per kg of body weight, from 1 ⁇ g to 1 g per kg of body weight, from 10 ⁇ g to 100 mg per kg of body weight, from 100 ⁇ g to 10 mg per kg of body weight, or from 100 ⁇ g to 1 mg per kg of body weight.
- Preferred dosages for a given compound are readily determinable by those of skill in the art by a variety of means.
- a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure are administered.
- the frequency of administration of a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure can vary depending on any of a variety of factors, e.g., severity of the symptoms, etc.
- a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure is administered once per month, twice per month, three times per month, every other week (qow), once per week (qw), twice per week (biw), three times per week (tiw), four times per week, five times per week, six times per week, every other day (qod), daily (qd), twice a day (qid), or three times a day (tid).
- the duration of administration of a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure can vary, depending on any of a variety of factors, e.g., patient response, etc.
- a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure can be administered over a period of time ranging from about one day to about one week, from about two weeks to about four weeks, from about one month to about two months, from about two months to about four months, from about four months to about six months, from about six months to about eight months, from about eight months to about 1 year, from about 1 year to about 2 years, or from about 2 years to about 4 years, or more.
- An active agent (a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure) is administered to an individual using any available method and route suitable for drug delivery, including in vivo and ex vivo methods, as well as systemic and localized routes of administration.
- a multimeric polypeptide of the present disclosure or a nucleic acid or recombinant expression vector of the present disclosure, can be administered in a single dose or in multiple doses.
- a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure is administered intravenously. In some embodiments, a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure is administered intramuscularly. In some embodiments, a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure is administered locally.
- a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure is administered intratumorally. In some embodiments, a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure is administered peritumorally. In some embodiments, a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure is administered intracranially. In some embodiments, a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure is administered subcutaneously.
- a multimeric polypeptide of the present disclosure is
- a multimeric polypeptide of the present disclosure is administered intravenously. In some embodiments, a multimeric polypeptide of the present disclosure is administered intramuscularly. In some embodiments, a multimeric polypeptide of the present disclosure is administered locally. In some embodiments, a multimeric polypeptide of the present disclosure is administered intratumorally. In some embodiments, a multimeric polypeptide of the present disclosure is administered peritumorally. In some embodiments, a multimeric polypeptide of the present disclosure is administered intracranially. In some embodiments, a multimeric polypeptide is administered subcutaneously.
- a multimeric polypeptide of the present disclosure a nucleic acid of the present
- routes of administration contemplated by the invention include, but are not necessarily limited to, enteral, parenteral, or inhalational routes.
- Parenteral routes of administration other than inhalation administration include, but are not necessarily limited to, topical, transdermal, subcutaneous, intramuscular, intraorbital, intracapsular, intraspinal, intrasternal, intratumoral, peritumoral, and intravenous routes, i.e., any route of administration other than through the alimentary canal.
- Parenteral administration can be carried to effect systemic or local delivery of a multimeric polypeptide of the present disclosure, a nucleic acid of the present disclosure, or a recombinant expression vector of the present disclosure. Where systemic delivery is desired, administration typically involves invasive or systemically absorbed topical or mucosal administration of pharmaceutical preparations.
- Subjects suitable for treatment with a method of the present disclosure include
- Subjects suitable for treatment with a method of the present disclosure include individuals who have an infection (e.g., an infection with a pathogen such as a bacterium, a virus, a protozoan, etc.), including individuals who have been diagnosed as having an infection, and individuals who have been treated for an infection but who failed to respond to the treatment.
- an infection e.g., an infection with a pathogen such as a bacterium, a virus, a protozoan, etc.
- Subjects suitable for treatment with a method of the present disclosure include individuals who have bacterial infection, including individuals who have been diagnosed as having a bacterial infection, and individuals who have been treated for a bacterial infection but who failed to respond to the treatment.
- Subjects suitable for treatment with a method of the present disclosure include individuals who have a viral infection, including individuals who have been diagnosed as having a viral infection, and individuals who have been treated for a viral infection but who failed to respond to the treatment.
- Subjects suitable for treatment with a method of the present disclosure include individuals who have an autoimmune disease, including individuals who have been diagnosed as having an autoimmune disease, and individuals who have been treated for a autoimmune disease but who failed to respond to the treatment.
- Standard abbreviations may be used, e.g., bp, base pair(s); kb, kilobase(s); pi, picoliter(s); s or sec, second(s); min, minute(s); h or hr, hour(s); aa, amino acid(s); kb, kilobase(s); bp, base pair(s); nt, nucleotide(s); i.m., intramuscular(ly); i.p., intraperitoneal(ly); s.c, subcutaneous(ly); and the like.
- Example 1 Generation and characterization of synTac polypeptides with variant CD80
- synTac multimeric polypeptides were generated, in which a first polypeptide (“Syn289”) was heterodimerized with a second polypeptide ("Syn290,” “Syn291,” “Syn292,” “Syn293,” “Syn294,” “Syn295,” or “Syn296”).
- Syn289 comprises, in order from N-terminus to C-terminus: a) an ovalbumin (OVA) T- cell epitope; and b) a ⁇ 2 ⁇ polypeptide.
- OVA ovalbumin
- the second polypeptide of the synTac comprised an MHC Class I heavy chain; thus, the second polypeptide was referred to as the "heavy chain" (H chain) of the synTac.
- the second polypeptide comprised, in order from N-terminus to C-terminus: a) a CD80 ectodomain; b) an MHC Class I heavy chain; and c) an IgG2a Fc polypeptide.
- the CD80 ectodomain polypeptide present in Syn290 was wild-type CD80 ectodomain (SEQ ID NO: l).
- the CD80 ectodomain polypeptide present in Syn 291, Syn292, Syn293, Syn294, Syn295, and Syn296 comprised a single amino acid substitution compared to wild-type CD80 ectodomain.
- the single amino acid substitutions are set out in Table 1.
- the first and the second polypeptide chains were disulfide linked to one another via Cys-
- synTac heterodimers were cultured in vitro with ovalbumin-specific T cells for 3 days, at concentrations of 0, 1, 3.17, 10.01, 31.65, and 100 nM synTac.
- Controls included: a) medium alone; b) phorbol 12-myristate 13-acetate (PMA) and the ionophore
- synTac polypeptides that include variant CD80 polypeptide induce production of IL-2 (a cellular fitness cytokine); induce production of cytotoxic cytokines TNFa and IFN- ⁇ ; and also induce proliferation and enhance viability of epitope-specific T cells.
- IL-2 a cellular fitness cytokine
- Example 2 In vivo effect of a CD80/synTac
- a synTac comprising a human papilloma virus (HPV) E7 antigenic peptide and a CD80
- K86A variant of the present disclosure (referred to as "CUE:CD80 (K86A)" in FIG. 20) was administered at 2.5 mg/kg by intraperitoneal (IP) injection into mice bearing flank engrafted HPV + TC-1 lung carcinoma.
- IP intraperitoneal
- PBS phosphate buffered saline
- tumor volume was decreased in mice treated with CUE:CD80 (K86A), compared to mice treated with PBS.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biomedical Technology (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Oncology (AREA)
- Biophysics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- General Engineering & Computer Science (AREA)
- Communicable Diseases (AREA)
- Mycology (AREA)
- Hematology (AREA)
- Virology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3014458A CA3014458A1 (en) | 2016-03-02 | 2017-03-01 | T-cell modulatory multimeric polypeptides and methods of use thereof |
| JP2018546587A JP2019516665A (ja) | 2016-03-02 | 2017-03-01 | T細胞調節多量体ポリペプチド及びその使用方法 |
| CN201780027232.8A CN109311945A (zh) | 2016-03-02 | 2017-03-01 | T细胞调节性多聚体多肽及其使用方法 |
| EP17760749.6A EP3423108A4 (en) | 2016-03-02 | 2017-03-01 | T CELL MODULATING MULTIPLE POLYPEPTIDES AND METHOD OF USE THEREOF |
| US16/077,420 US20190062400A1 (en) | 2016-03-02 | 2017-03-01 | T-cell modulatory multimeric polypeptides and methods of use thereof |
| AU2017226269A AU2017226269B2 (en) | 2016-03-02 | 2017-03-01 | T-cell modulatory multimeric polypeptides and methods of use thereof |
| KR1020187028428A KR20180132663A (ko) | 2016-03-02 | 2017-03-01 | T-세포 조절 다량체 폴리펩타이드 및 이의 사용 방법 |
| IL261401A IL261401A (en) | 2016-03-02 | 2018-08-27 | T-cell modulatory multimeric polypeptides and methods of using them |
| US17/887,199 US20230227530A1 (en) | 2016-03-02 | 2022-08-12 | T-cell modulatory multimeric polypeptides and methods of use thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662302654P | 2016-03-02 | 2016-03-02 | |
| US62/302,654 | 2016-03-02 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/077,420 A-371-Of-International US20190062400A1 (en) | 2016-03-02 | 2017-03-01 | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US17/887,199 Continuation US20230227530A1 (en) | 2016-03-02 | 2022-08-12 | T-cell modulatory multimeric polypeptides and methods of use thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2017151818A2 true WO2017151818A2 (en) | 2017-09-08 |
| WO2017151818A3 WO2017151818A3 (en) | 2017-10-26 |
Family
ID=59743228
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/020276 Ceased WO2017151818A2 (en) | 2016-03-02 | 2017-03-01 | T-cell modulatory multimeric polypeptides and methods of use thereof |
Country Status (9)
| Country | Link |
|---|---|
| US (2) | US20190062400A1 (https=) |
| EP (1) | EP3423108A4 (https=) |
| JP (1) | JP2019516665A (https=) |
| KR (1) | KR20180132663A (https=) |
| CN (1) | CN109311945A (https=) |
| AU (1) | AU2017226269B2 (https=) |
| CA (1) | CA3014458A1 (https=) |
| IL (1) | IL261401A (https=) |
| WO (1) | WO2017151818A2 (https=) |
Cited By (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019051094A1 (en) * | 2017-09-07 | 2019-03-14 | Cue Biopharma, Inc. | ANTIGEN PRESENTATION POLYPEPTIDES AND METHODS OF USE |
| US10273281B2 (en) | 2015-11-02 | 2019-04-30 | Five Prime Therapeutics, Inc. | CD80 extracellular domain polypeptides and their use in cancer treatment |
| CN111010875A (zh) * | 2017-03-15 | 2020-04-14 | 库尔生物制药有限公司 | 用于调节免疫应答的方法 |
| CN111315768A (zh) * | 2017-09-07 | 2020-06-19 | 库尔生物制药有限公司 | 具有缀合位点的t细胞调节性多聚体多肽及其使用方法 |
| WO2020181272A1 (en) * | 2019-03-06 | 2020-09-10 | Cue Biopharma, Inc. | Antigen-presenting polypeptides with chemical conjugation sites and methods of use thereof |
| US10927158B2 (en) | 2016-12-22 | 2021-02-23 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11078282B2 (en) | 2016-04-15 | 2021-08-03 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11096988B2 (en) | 2017-03-16 | 2021-08-24 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| WO2021181233A3 (en) * | 2020-03-09 | 2021-11-04 | Pfizer Inc. | Cd80-fc fusion protein and uses thereof |
| US20210393693A1 (en) * | 2018-12-19 | 2021-12-23 | Cue Biopharma, Inc. | T-Cell Modulatory Multimeric Polypeptides with Conjugation Sites and Methods of Use Thereof |
| US11226339B2 (en) | 2012-12-11 | 2022-01-18 | Albert Einstein College Of Medicine | Methods for high throughput receptor:ligand identification |
| CN114423284A (zh) * | 2019-09-20 | 2022-04-29 | 库尔生物制药有限公司 | T细胞调节多肽及其使用方法 |
| US11319359B2 (en) | 2015-04-17 | 2022-05-03 | Alpine Immune Sciences, Inc. | Immunomodulatory proteins with tunable affinities |
| US11339201B2 (en) | 2016-05-18 | 2022-05-24 | Albert Einstein College Of Medicine | Variant PD-L1 polypeptides, T-cell modulatory multimeric polypeptides, and methods of use thereof |
| US11505591B2 (en) | 2016-05-18 | 2022-11-22 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11702461B2 (en) | 2018-01-09 | 2023-07-18 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides |
| US11789010B2 (en) | 2017-04-28 | 2023-10-17 | Five Prime Therapeutics, Inc. | Methods of treatment with CD80 extracellular domain polypeptides |
| US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12029782B2 (en) | 2020-09-09 | 2024-07-09 | Cue Biopharma, Inc. | MHC class II T-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (T1D) and methods of use thereof |
| US12589132B2 (en) | 2019-02-22 | 2026-03-31 | Five Prime Therapeutics, Inc. | CD80 extracellular domain Fc fusion proteins for treating PD-L1 negative tumors |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20220015382A (ko) * | 2019-05-29 | 2022-02-08 | 큐 바이오파마, 인크. | 다량체 t-세포 조절 폴리펩타이드 및 이의 사용 방법 |
| DK4034170T3 (da) | 2019-10-23 | 2026-03-30 | Cue Biopharma Inc | Tgf-beta-polypeptider |
| US20230126784A1 (en) * | 2020-03-06 | 2023-04-27 | Albert Einstein College Of Medicine | A method to generate chimeric antigen receptor (car) t-cells (car-t cells) from pathogen-specific cytotoxic lymphocytes to enable the subsequent in vivo modulation of their functional activity |
| US20230218731A1 (en) * | 2020-05-26 | 2023-07-13 | Cue Biopharma, Inc. | Antigen Presenting Polypeptide Complexes and Methods of Use Thereof |
| WO2021242935A1 (en) * | 2020-05-26 | 2021-12-02 | Cue Biopharma, Inc. | Antigen presenting polypeptide complexes and methods of use thereof |
| IL299834A (en) * | 2020-07-14 | 2023-03-01 | Cue Biopharma Inc | with binding sites and methods for using them T - cellular modulatory polypeptides |
| CA3216273A1 (en) * | 2021-04-21 | 2022-10-27 | Ronald D. SEIDEL III | Antigen presenting polypeptide complexes bearing tgf-beta and methods of use thereof |
| WO2022251552A2 (en) * | 2021-05-26 | 2022-12-01 | Cue Biopharma, Inc. | Antigen presenting polypeptide complexes and methods of use thereof |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PL202844B1 (pl) * | 1998-04-07 | 2009-07-31 | Corixa Corp | Immunogeniczny polipeptyd, polinukleotyd, polipeptyd, kompozycja farmaceutyczna, wektor ekspresji, kompozycja szczepionki, polipeptyd do stosowania w leczeniu lub zapobieganiu infekcjom Mycobacterium tuberculosis, polinukleotyd do stosowania w leczeniu lub zapobieganiu infekcjom Mycobacterium tuberculosis i sposób wytwarzania polipeptydu |
| CN103796681B (zh) * | 2011-06-30 | 2018-07-20 | 建新公司 | T细胞活化的抑制剂 |
| CN102898504B (zh) * | 2012-10-23 | 2014-08-06 | 中国农业大学 | 抗氧化活性合成肽及其用途 |
| WO2015195531A2 (en) * | 2014-06-18 | 2015-12-23 | Albert Einstein College Of Medicine, Inc. | Syntac polypeptides and uses thereof |
-
2017
- 2017-03-01 WO PCT/US2017/020276 patent/WO2017151818A2/en not_active Ceased
- 2017-03-01 CA CA3014458A patent/CA3014458A1/en not_active Abandoned
- 2017-03-01 AU AU2017226269A patent/AU2017226269B2/en not_active Expired - Fee Related
- 2017-03-01 KR KR1020187028428A patent/KR20180132663A/ko not_active Ceased
- 2017-03-01 JP JP2018546587A patent/JP2019516665A/ja active Pending
- 2017-03-01 CN CN201780027232.8A patent/CN109311945A/zh active Pending
- 2017-03-01 US US16/077,420 patent/US20190062400A1/en not_active Abandoned
- 2017-03-01 EP EP17760749.6A patent/EP3423108A4/en not_active Withdrawn
-
2018
- 2018-08-27 IL IL261401A patent/IL261401A/en unknown
-
2022
- 2022-08-12 US US17/887,199 patent/US20230227530A1/en active Pending
Cited By (58)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11226339B2 (en) | 2012-12-11 | 2022-01-18 | Albert Einstein College Of Medicine | Methods for high throughput receptor:ligand identification |
| US12486312B2 (en) | 2015-04-17 | 2025-12-02 | Alpine Immune Sciences, Inc. | Immunomodulatory proteins with tunable affinities |
| US11319359B2 (en) | 2015-04-17 | 2022-05-03 | Alpine Immune Sciences, Inc. | Immunomodulatory proteins with tunable affinities |
| US10273281B2 (en) | 2015-11-02 | 2019-04-30 | Five Prime Therapeutics, Inc. | CD80 extracellular domain polypeptides and their use in cancer treatment |
| US11098103B2 (en) | 2015-11-02 | 2021-08-24 | Five Prime Therapeutics, Inc. | CD80 extracellular domain polypeptides and their use in cancer treatment |
| US11498967B2 (en) | 2016-04-15 | 2022-11-15 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11359022B2 (en) | 2016-04-15 | 2022-06-14 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11479609B2 (en) | 2016-04-15 | 2022-10-25 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11078282B2 (en) | 2016-04-15 | 2021-08-03 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11339201B2 (en) | 2016-05-18 | 2022-05-24 | Albert Einstein College Of Medicine | Variant PD-L1 polypeptides, T-cell modulatory multimeric polypeptides, and methods of use thereof |
| US11505591B2 (en) | 2016-05-18 | 2022-11-22 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US10927158B2 (en) | 2016-12-22 | 2021-02-23 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11505588B2 (en) | 2016-12-22 | 2022-11-22 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11117945B2 (en) | 2016-12-22 | 2021-09-14 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851467B2 (en) | 2016-12-22 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11739133B2 (en) | 2016-12-22 | 2023-08-29 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11708400B2 (en) | 2016-12-22 | 2023-07-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11530248B2 (en) | 2016-12-22 | 2022-12-20 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11905320B2 (en) | 2016-12-22 | 2024-02-20 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11987610B2 (en) | 2016-12-22 | 2024-05-21 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12421287B2 (en) | 2016-12-22 | 2025-09-23 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12145973B2 (en) | 2016-12-22 | 2024-11-19 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12152061B2 (en) | 2016-12-22 | 2024-11-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12180258B2 (en) | 2016-12-22 | 2024-12-31 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11370821B2 (en) | 2016-12-22 | 2022-06-28 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11377478B2 (en) | 2016-12-22 | 2022-07-05 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11401314B2 (en) | 2016-12-22 | 2022-08-02 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| CN111010875B (zh) * | 2017-03-15 | 2024-04-05 | 库尔生物制药有限公司 | 用于调节免疫应答的方法 |
| US11767355B2 (en) | 2017-03-15 | 2023-09-26 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| CN111010875A (zh) * | 2017-03-15 | 2020-04-14 | 库尔生物制药有限公司 | 用于调节免疫应答的方法 |
| US11104712B2 (en) | 2017-03-15 | 2021-08-31 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US10927161B2 (en) | 2017-03-15 | 2021-02-23 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11958893B2 (en) | 2017-03-15 | 2024-04-16 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11993641B2 (en) | 2017-03-15 | 2024-05-28 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11479595B2 (en) | 2017-03-15 | 2022-10-25 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11096988B2 (en) | 2017-03-16 | 2021-08-24 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11117950B2 (en) | 2017-03-16 | 2021-09-14 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11117949B2 (en) | 2017-03-16 | 2021-09-14 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11117948B2 (en) | 2017-03-16 | 2021-09-14 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11639375B2 (en) | 2017-03-16 | 2023-05-02 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11230588B2 (en) | 2017-03-16 | 2022-01-25 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11789010B2 (en) | 2017-04-28 | 2023-10-17 | Five Prime Therapeutics, Inc. | Methods of treatment with CD80 extracellular domain polypeptides |
| WO2019051094A1 (en) * | 2017-09-07 | 2019-03-14 | Cue Biopharma, Inc. | ANTIGEN PRESENTATION POLYPEPTIDES AND METHODS OF USE |
| CN111278864A (zh) * | 2017-09-07 | 2020-06-12 | 库尔生物制药有限公司 | 抗原呈递多肽及其使用方法 |
| CN111315768A (zh) * | 2017-09-07 | 2020-06-19 | 库尔生物制药有限公司 | 具有缀合位点的t细胞调节性多聚体多肽及其使用方法 |
| US12006348B2 (en) | 2017-09-07 | 2024-06-11 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptide with conjugation sites and methods of use thereof |
| US11702461B2 (en) | 2018-01-09 | 2023-07-18 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides |
| US20210393693A1 (en) * | 2018-12-19 | 2021-12-23 | Cue Biopharma, Inc. | T-Cell Modulatory Multimeric Polypeptides with Conjugation Sites and Methods of Use Thereof |
| US12589132B2 (en) | 2019-02-22 | 2026-03-31 | Five Prime Therapeutics, Inc. | CD80 extracellular domain Fc fusion proteins for treating PD-L1 negative tumors |
| WO2020181272A1 (en) * | 2019-03-06 | 2020-09-10 | Cue Biopharma, Inc. | Antigen-presenting polypeptides with chemical conjugation sites and methods of use thereof |
| CN114423284A (zh) * | 2019-09-20 | 2022-04-29 | 库尔生物制药有限公司 | T细胞调节多肽及其使用方法 |
| WO2021181233A3 (en) * | 2020-03-09 | 2021-11-04 | Pfizer Inc. | Cd80-fc fusion protein and uses thereof |
| US12257311B2 (en) | 2020-05-12 | 2025-03-25 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12485183B2 (en) | 2020-05-12 | 2025-12-02 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12485184B2 (en) | 2020-05-12 | 2025-12-02 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12029782B2 (en) | 2020-09-09 | 2024-07-09 | Cue Biopharma, Inc. | MHC class II T-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (T1D) and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2017226269B2 (en) | 2021-10-28 |
| JP2019516665A (ja) | 2019-06-20 |
| CA3014458A1 (en) | 2017-09-08 |
| AU2017226269A1 (en) | 2018-09-06 |
| US20190062400A1 (en) | 2019-02-28 |
| IL261401A (en) | 2018-10-31 |
| US20230227530A1 (en) | 2023-07-20 |
| EP3423108A2 (en) | 2019-01-09 |
| CN109311945A (zh) | 2019-02-05 |
| WO2017151818A3 (en) | 2017-10-26 |
| EP3423108A4 (en) | 2019-10-02 |
| KR20180132663A (ko) | 2018-12-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230227530A1 (en) | T-cell modulatory multimeric polypeptides and methods of use thereof | |
| US12180258B2 (en) | T-cell modulatory multimeric polypeptides and methods of use thereof | |
| US11851471B2 (en) | T-cell modulatory multimeric polypeptides and methods of use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 3014458 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 261401 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2018546587 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017226269 Country of ref document: AU Date of ref document: 20170301 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20187028428 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017760749 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2017760749 Country of ref document: EP Effective date: 20181002 |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17760749 Country of ref document: EP Kind code of ref document: A2 |