WO2017125831A1 - Mono and bispecific antibodies for epidermal growth factor receptor variant iii and cd3 and their uses - Google Patents
Mono and bispecific antibodies for epidermal growth factor receptor variant iii and cd3 and their uses Download PDFInfo
- Publication number
- WO2017125831A1 WO2017125831A1 PCT/IB2017/050109 IB2017050109W WO2017125831A1 WO 2017125831 A1 WO2017125831 A1 WO 2017125831A1 IB 2017050109 W IB2017050109 W IB 2017050109W WO 2017125831 A1 WO2017125831 A1 WO 2017125831A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- cancer
- egfrvlll
- antibodies
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3053—Skin, nerves, brain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present invention relates to antibodies, e.g., full length antibodies or antigen binding fragments thereof, that specifically bind to Epidermal Growth Factor Receptor Variant III (EGFRvlll).
- the invention further relates to heteromultimeric antibodies (e.g., bispecific antibodies) and antibody conjugates (e.g., antibody-drug-conjugates).
- Compositions comprising the EGFRvlll antibodies, methods for producing and purifying such antibodies, and their use in diagnostics and therapeutics are also provided.
- EGFR variant III (EGFRvlll), a tumor specific mutant of EGFR, is a product of genomic rearrangement which is often associated with wild-type EGFR gene
- EGFRvlll is formed by an in-frame deletion of exons 2-7, leading to deletion of 267 amino acids with a glycine substitution at the junction.
- the truncated receptor loses its ability to bind ligands but acquires constitutive kinase activity.
- EGFRvlll frequently co-expresses with full length wild-type EGFR in the same tumor cells. Moreover, EGFRvlll expressing cells exhibit increased proliferation, invasion, angiogenesis and resistance to apoptosis.
- EGFRvlll is most often found in glioblastoma multiforme (GBM). It is estimated that 25-35% of GBM carries this truncated receptor. Moreover, its expression often reflects a more aggressive phenotype and poor prognosis. Besides GBM, expression of EGFRvlll has also been reported in other solid tumors such as non-small cell lung cancer, head and neck cancer, breast cancer, ovarian cancer and prostate cancer. In contrast, EGFRvlll is not expressed in healthy tissues. The lack of expression in normal tissues makes EGFRvlll an ideal target for developing tumor specific targeted therapy.
- GBM glioblastoma multiforme
- the invention disclosed herein is directed to antibodies (e.g., monospecific or bispecific antibodies) and antibody conjugates that specifically bind to Epidermal Growth Factor Receptor Variant III (EGFRvlll).
- the invention provides an isolated antibody which specifically binds to EGFRvlll, wherein the antibody comprises (a) a heavy chain variable (VH) region comprising (i) a VH complementarity determining region one (CDR1 ) comprising the sequence shown in SEQ ID NO: 62, 63, 64, 74, 75, 76, 80, 81 , 82, 88, 89, 90, 93, 94, 95, 99, 100, 101 , 109, 1 10, 1 1 1 , 1 15, 1 16, 1 17, 121 , 122, 123, 132, 133, 134, 137, 138, 139, 143, 144, or 145; (ii) a VH CDR2 comprising the sequence shown in SEQ ID NO: 65, 66, 68
- an isolated antibody which specifically binds to EGFRvlll, wherein the antibody comprises: a VH region comprising a VH CDR1 , VH CDR2, and VH CDR3 of the VH sequence shown in SEQ ID NO:1 , 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23, 25, 27, 30, 32, 34, 35, 37, 39, 41 , 43, 44, 46, 48, 50, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61 , 202, 203, 204, 205, 206, 207, 208, 209, 210, 214, 216, 217, or 218; and/or a VL region comprising VL CDR1 , VL CDR2, and VL CDR3 of the VL sequence shown in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 29, 31 , 33, 36, 38, 40, 42, 45, 47, 49, 51 , 21
- the VH region as described herein comprises a variant with one or several conservative amino acid substitutions in residues that are not within a CDR and/or the VL region as described herein comprises a variant with one or several amino acid substitutions in amino acids that are not within a CDR.
- the VH or VL region can comprise an amino acid sequence described above or a variant thereof with no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 conservative substitutions in residues that are not within a CDR.
- an isolated antibody which specifically binds to EGFRvlll, wherein the antibody comprises: a VH region comprising the sequence shown in SEQ ID NO: 5, 9, 1 1 , 15, 30, 37, or 41 ; and/or a VL region comprising the sequence shown in SEQ ID NO: 6, 10, 12, 16, 31 , 38, or 42.
- the VH region comprises the sequence shown in SEQ ID NO: 5 and the VL region comprises the sequence shown in SEQ ID NO: 6.
- the VH region comprises the sequence shown in SEQ ID NO: 9 and the VL region comprises the sequence shown in SEQ ID NO: 10.
- the VH region comprises the sequence shown in SEQ ID NO: 1 1 and the VL region comprises the sequence shown in SEQ ID NO: 12. In some embodiments, the VH region comprises the sequence shown in SEQ ID NO: 15 and the VL region comprises the sequence shown in SEQ ID NO: 16. In some embodiments, the VH region comprises the sequence shown in SEQ ID NO: 30 and the VL region comprises the sequence shown in SEQ ID NO: 31. In some embodiments, the VH region comprises the sequence shown in SEQ ID NO: 37 and the VL region comprises the sequence shown in SEQ ID NO: 38. In some embodiments, the VH region comprises the sequence shown in SEQ ID NO: 41 and the VL region comprises the sequence shown in SEQ ID NO: 42.
- a bispecific antibody wherein the bispecific antibody is a full-length human antibody, comprising a first antibody variable domain of the bispecific antibody specifically binding to a target antigen (e.g., EGFRvlll), and comprising a second antibody variable domain of the bispecific antibody capable of recruiting the activity of a human immune effector cell by specifically binding to an effector antigen (e.g., Cluster of differentiation 3 (CD3)) located on the human immune effector cell.
- a target antigen e.g., EGFRvlll
- an effector antigen e.g., Cluster of differentiation 3 (CD3)
- the first antibody variable domain comprises a heavy chain variable (VH) region comprising a VH CDR1 , VH CDR2, and VH CDR3 of the VH sequence shown in SEQ ID NO: 1 , 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23, 25, 27, 30, 32, 34, 35, 37, 39, 41 , 43, 44, 46, 48, 50, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61 , 202, 203, 204, 205, 206, 207, 208, 209, 210, 214, 216, 217, or 218; and/or a light chain variable (VL) region comprising VL CDR1 , VL CDR2, and VL CDR3 of the VL sequence shown in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 29, 31 , 33, 36, 38, 40, 42, 45, 47, 49, 51 , 21 1 , 212, 21
- VH
- the first antibody variable domain comprises (a) a heavy chain variable (VH) region comprising (i) a VH complementarity determining region one (CDR1 ) comprising the sequence shown in SEQ ID NO: 62, 63, 64, 74, 75, 76, 80, 81 , 82, 88, 89, 90, 93, 94, 95, 99, 100, 101 , 109, 1 10, 1 1 1 , 1 15, 1 16, 1 17, 121 , 122, 123, 132, 133, 134, 137, 138, 139, 143, 144, or 145; (ii) a VH CDR2 comprising the sequence shown in SEQ ID NO: 65, 66, 68, 69, 70, 71 , 77, 78, 83, 84, 86, 87, 91 , 92, 96, 97, 98, 102, 103, 105, 106, 1 12, 1 13, 1 18, 1 19, 124,
- the second antibody variable domain comprises the VH and/or VL region specific against CD3.
- the second antibody variable domain comprises a heavy chain variable (VH) region comprising a VH CDR1 , VH CDR2, and VH CDR3 of the VH sequence shown in SEQ ID NO:240 ; and/or a light chain variable (VL) region comprising a VL CDR1 , VL CDR2, and VL CDR3 of the VL sequence shown in SEQ ID NO: 241.
- the second antibody variable domain comprises (a) a VH region comprising (i) a VH CDR1 comprising the sequence shown in SEQ ID NO: 244, 1 10, or 245; (ii) a VH CDR2 comprising the sequence shown in SEQ ID NO: 246 or 247; and iii) a VH CDR3 comprising the sequence shown in SEQ ID NO: 248; and/or a VL region comprising (i) a VL CDR1 comprising the sequence shown in SEQ ID NO: 249; (ii) a VL CDR2 comprising the sequence shown in SEQ ID NO: 250; and (iii) a VL CDR3 comprising the sequence shown in SEQ ID NO: 251.
- the antibodies described herein comprise a constant region. In some embodiments, the antibodies described herein are of the human lgG1 , lgG2 or lgG2Aa, lgG3, or lgG4 subclass. In some embodiments, the antibodies described herein comprise a glycosylated constant region. In some embodiments, the antibodies described herein comprise a constant region having decreased binding affinity to one or more human Fc gamma receptor(s).
- both the first and the second antibody variable domains of the bispecific antibody comprise amino acid modifications at positions 223, 225, and 228 (e.g., (C223E or C223R), (E225R), and (P228E or P228R)) in the hinge region and at position 409 or 368 (e.g., K409R or L368E (EU numbering scheme)) in the CH3 region of human lgG2 (SEQ ID NO: 290).
- positions 223, 225, and 228 e.g., (C223E or C223R), (E225R), and (P228E or P228R)
- position 409 or 368 e.g., K409R or L368E (EU numbering scheme)
- both the first and the second antibody variable domains of the bispecific antibody comprise amino acid modifications at position 265 (e.g., D265A) of the human lgG2.
- both the first and the second antibody variable domains of the bispecific antibody comprise amino acid modifications at one or more of positions 265 (e.g., D265A), 330 (e.g., A330S), and 331 (e.g., P331 S) of the human lgG2.
- both the first and the second antibody variable domains of the bispecific antibody comprise amino acid modifications at each of positions 265 (e.g., D265A), 330 (e.g., A330S), and 331 (e.g., P331 S) of the human lgG2.
- the invention provides an isolated antibody comprising an acyl donor glutamine-containing tag engineered at a specific site of the EGFRvlll antibody of the present invention.
- the invention provides an isolated antibody comprising an acyl donor glutamine-containing tag and an amino acid modification at position 222, 340, or 370 of the EGFRvlll antibody of the present invention.
- the amino acid modification is a substitution from lysine to arginine.
- the EGFRvlll antibody of the present invention further comprises a linker.
- the invention provides a conjugate of the EGFRvlll antibody as described herein, wherein the antibody is conjugated to an agent, wherein the agent is selected from the group consisting of a cytotoxic agent, an immunomodulating agent, an imaging agent, a therapeutic protein, a biopolymer, and an oligonucleotide.
- the agent is a cytotoxic agent including, but not limited to, an anthracycline, an auristatin, a camptothecin, a combretastatin, a dolastatin, a duocarmycin, an enediyne, a geldanamycin, an indolino-benzodiazepine dimer, a maytansine, a puromycin, a pyrrolobenzodiazepine dimer, a taxane, a vinca alkaloid, a tubulysin, a hemiasterlin, a spliceostatin, a pladienolide, and stereoisomers, isosteres, analogs, or derivatives thereof.
- a cytotoxic agent including, but not limited to, an anthracycline, an auristatin, a camptothecin, a combretastatin, a dolastatin, a duocarmycin, an ened
- the cytotoxic agent is MMAD (Monomethyl Auristatin D), 0101 (2-methylalanyl-/V-[(3ft,4S,5S)-3-methoxy-1 - ⁇ (2S)-2- [(1 R,2R) ⁇ -methoxy-2-methyl-3-oxo-3- ⁇ [(1 S)-2-phenyl-1 -(1 ,3-thiazol-2- yl)ethyl]amino ⁇ propyl]pyrrolidin-1 -yl ⁇ -5-methyl-1 -oxoheptan-4-yl]-/V-methyl-L- valinamide), 3377 (N,2-dimethylalanyl-N- ⁇ (1 S,2R)-4- ⁇ (2S)-2-[(1 R,2R)-3- ⁇ [(1 S)-1 - carboxyl-2-phenylethyl]amino ⁇ -1 -methoxy-2-methyl-3-oxopropyl]pyrroli
- the present invention provides a conjugate comprising the formula: antibody-(acyl donor glutamine-containing tag)-(linker)-(cytotoxic agent).
- the invention provides pharmaceutical compositions comprising any of the antibodies or antibody conjugates described herein.
- the invention also provides cell lines that recombinantly produce any of the antibodies described herein.
- the invention also provides nucleic acids encoding any of the antibodies described herein.
- the invention also provides nucleic acids encoding a heavy chain variable region and/or a light chain variable region of any of the antibodies described herein.
- kits comprising an effective amount of any of the antibodies or antibody conjugates described herein.
- the invention also provides methods of treating subjects in need thereof comprising providing the isolated antibodies, bispecific antibodies, or antibody conjugates described herein, and administering said antibodies to said subject.
- Also provided are methods of treating a condition associated with malignant cells expressing EGFRvl ll in a subject comprising administering to a subject in need thereof an effective amount of a pharmaceutical composition comprising the antibodies or antibody conjugates as described herein.
- the condition is a cancer.
- the cancer is an EGFRvlll related cancer (e.g., any cancer with EGFRvlll expression) selected from the group consisting of glioblastoma multiform, anaplastic astrocytoma, giant cell glioblastoma, gliosarcoma, anaplastic oligodendroglioma, anaplastic ependymoma, anaplastic oligoastrocytoma, choroid plexus carcinoma, anaplastic ganglioglioma, pineoblastoma, pineocytoma, meningioma, medulloepithelioma, ependymoblastoma, medulloblastoma, supraentorial primitive neuroectodermal tumor, atypical teratoid/rhabdoid tumor, head and neck cancer, non- small cell lung cancer, breast cancer, ovarian cancer, prostate cancer, medullobastoma, colorectal cancer
- the invention provides a method of inhibiting tumor growth or progression in a subject who has malignant cells expressing EGFRvlll, comprising administering to the subject in need thereof an effective amount of a pharmaceutical composition comprising the isolated antibodies, bispecific antibodies, or antibody conjugates, as described herein.
- the invention provides a method inhibiting metastasis of malignant cells expressing EGFRvlll in a subject, comprising administering to the subject in need thereof an effective amount of the pharmaceutical composition comprising the isolated antibodies, bispecific antibodies, or antibody conjugates, as described herein.
- the invention provides a method inducing tumor regression in a subject who has malignant cells expressing EGFRvlll, comprising administering to the subject in need thereof an effective amount of the pharmaceutical composition of a pharmaceutical composition comprising the isolated antibodies, bispecific antibodies, or antibody conjugates, as described herein.
- FIGs. 1A, 1 B, and 1 C show examples of FACS binding histograms of three EGFRvlll antibodies: mAb 42G9 (FIG. 1A), 32A10 (FIG. 1 B) and 32G8 (FIG. 1 C), to the three F98 cell lines: F98 (EGFR negative), F98-EGFRwt, and F98-EGFRvlll.
- the X- axis is fluorescence intensity; the Y-axis is percentage of maximum / normalized to mode.
- FIGs. 2A, 2B and 2C depict histograms showing the expression of wild-type EGFR and EGFRvlll in GBM cell lines as measured by flow cytometry: LN229-EGFRvlll (FIG.
- EGFRvlll was detected with mAb 42G9 and EGFRwt was detected with an EGFR wild-type specific mAb.
- the X- axis is fluorescence intensity; the Y-axis is percentage of maximum / normalized to mode.
- FIGs. 3A and 3B show graphs demonstrating the cytotoxicity of three EGFRvlll- CD3 bispecific antibodies in EGFRvlll transduced LN18-EGFRvlll (FIG. 3A) and parental LN18 (FIG. 3B) cells.
- FIGs. 4A and 4B show graphs demonstrating the cytotoxicity of three EGFRvlll-
- FIG. 5 shows a graph demonstrating the cytotoxicity of three EGFRvlll-CD3 bispecific antibodies in DKMG cells, which express endogenous EGFRvlll and EGFR wild-type proteins.
- FIG. 6 shows a graph illustrating the in vivo anti-tumor activity of EGFRvlll-CD3 bispecific antibodies in a subcutaneous model of LN229-EGFRvlll GBM cell line.
- the invention disclosed herein provides antibodies (e.g., monospecific or bispecific) and antibody conjugates that specifically bind to EGFRvlll (e.g., human EGFRvlll).
- the invention also provides polynucleotides encoding these antibodies, compositions comprising these antibodies and antibody conjugates, and methods of making and using these antibodies and antibody conjugates.
- the invention also provides methods for treating a condition associated with EGFRvlll-mediated pathologies in a subject, such as cancer.
- an “antibody” is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
- a target such as a carbohydrate, polynucleotide, lipid, polypeptide, etc.
- the term encompasses not only intact polyclonal or monoclonal antibodies, but also antigen binding fragments thereof (such as Fab, Fab', F(ab') 2 , Fv), single chain (ScFv) and domain antibodies (including, for example, shark and camelid antibodies), and fusion proteins comprising an antibody, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site.
- An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
- immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2.
- the heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
- the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
- antigen binding fragment or "antigen binding portion” of an antibody, as used herein, refers to one or more fragments of an intact antibody that retain the ability to specifically bind to a given antigen (e.g., EGFRvlll). Antigen binding functions of an antibody can be performed by fragments of an intact antibody.
- binding fragments encompassed within the term "antigen binding fragment" of an antibody include Fab; Fab'; F(ab') 2 ; an Fd fragment consisting of the VH and CH1 domains; an Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a single domain antibody (dAb) fragment (Ward et al., Nature 341 :544-546, 1989), and an isolated complementarity determining region (CDR).
- telomere binding if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances.
- An antibody “specifically binds” or “preferentially binds” to a target if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances.
- an antibody that specifically or preferentially binds to an EGFRvlll epitope is an antibody that binds this epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other EGFRvlll epitopes or non-EGFRvlll epitopes. It is also understood that by reading this definition, for example, an antibody (or moiety or epitope) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding. Generally, but not necessarily, reference to binding means preferential binding.
- variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
- variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions.
- FR framework regions
- CDRs complementarity determining regions
- the CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies.
- a CDR may refer to CDRs defined by either approach or by a combination of both approaches.
- a "CDR" of a variable domain are amino acid residues within the variable region that are identified in accordance with the definitions of the Kabat, Chothia, the accumulation of both Kabat and Chothia, AbM, contact, and/or conformational definitions or any method of CDR determination well known in the art.
- Antibody CDRs may be identified as the hypervariable regions originally defined by Kabat et al. See, e.g., Kabat et al., 1992, Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, NIH, Washington D.C. The positions of the CDRs may also be identified as the structural loop structures originally described by Chothia and others.
- CDR identification includes the "AbM definition,” which is a compromise between Kabat and Chothia and is derived using Oxford Molecular's AbM antibody modeling software (now Accelrys®), or the "contact definition" of CDRs based on observed antigen contacts, set forth in MacCallum et al., J. Mol. Biol., 262:732-745, 1996.
- the positions of the CDRs may be identified as the residues that make enthalpic contributions to antigen binding.
- a CDR may refer to CDRs defined by any approach known in the art, including combinations of approaches. The methods used herein may utilize CDRs defined according to any of these approaches. For any given embodiment containing more than one CDR, the CDRs may be defined in accordance with any of Kabat, Chothia, extended, AbM, contact, and/or conformational definitions.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. , the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler and Milstein, Nature 256:495, 1975, or may be made by recombinant DNA methods such as described in U.S. Pat. No. 4,816,567.
- the monoclonal antibodies may also be isolated from phage libraries generated using the techniques described in McCafferty et al., Nature 348:552-554, 1990, for example.
- humanized antibody refers to forms of non-human (e.g. murine) antibodies that are chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab', F(ab') 2 or other antigen binding subsequences of antibodies) that contain minimal sequence derived from non-human immunoglobulin.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity.
- CDR complementary determining region
- Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- the humanized antibody may comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin.
- CDR L1 , CDR L2, CDR L3, CDR H1 , CDR H2, or CDR H3 are altered with respect to the original antibody, which are also termed one or more CDRs "derived from" one or more CDRs from the original antibody.
- human antibody means an antibody having an amino acid sequence corresponding to that of an antibody produced by a human and/or which has been made using any of the techniques for making human antibodies known to those skilled in the art or disclosed herein.
- This definition of a human antibody includes antibodies comprising at least one human heavy chain polypeptide or at least one human light chain polypeptide.
- One such example is an antibody comprising murine light chain and human heavy chain polypeptides.
- Human antibodies can be produced using various techniques known in the art. In one embodiment, the human antibody is selected from a phage library, where that phage library expresses human antibodies (Vaughan et al., Nature Biotechnology, 14:309-314, 1996; Sheets et al., Proc. Natl. Acad.
- Human antibodies can also be made by immunization of animals into which human immunoglobulin loci have been transgenically introduced in place of the endogenous loci, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. This approach is described in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625, 126; 5,633,425; and 5,661 ,016.
- the human antibody may be prepared by immortalizing human B lymphocytes that produce an antibody directed against a target antigen (such B lymphocytes may be recovered from an individual or from single cell cloning of the cDNA, or may have been immunized in vitro). See, e.g., Cole et al. Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77, 1985; Boerner et al., J. Immunol., 147 (1 ):86-95, 1991 ; and U.S. Pat. No. 5,750,373.
- chimeric antibody is intended to refer to antibodies in which the variable region sequences are derived from one species and the constant region sequences are derived from another species, such as an antibody in which the variable region sequences are derived from a mouse antibody and the constant region sequences are derived from a human antibody.
- polypeptide oligopeptide
- peptide protein
- chain may be relatively short (e.g., 10-100 amino acids), or longer.
- the chain may be linear or branched, it may comprise modified amino acids, and/or may be interrupted by non-amino acids.
- the terms also encompass an amino acid chain that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
- polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
- polypeptides can occur as single chains or associated chains.
- a “monovalent antibody” comprises one antigen binding site per molecule (e.g., IgG or Fab). In some instances, a monovalent antibody can have more than one antigen binding sites, but the binding sites are from different antigens.
- a “monospecific antibody” comprises two identical antigen binding sites per molecule (e.g. IgG) such that the two binding sites bind identical epitope on the antigen. Thus, they compete with each other on binding to one antigen molecule. Most antibodies found in nature are monospecific. In some instances, a monospecific antibody can also be a monovalent antibody (e.g. Fab)
- bivalent antibody comprises two antigen binding sites per molecule (e.g., IgG). In some instances, the two binding sites have the same antigen specificities. However, bivalent antibodies may be bispecific.
- a “bispecific” or “dual-specific” is a hybrid antibody having two different antigen binding sites.
- the two antigen binding sites of a bispecific antibody bind to two different epitopes, which may reside on the same or different protein targets.
- a “bifunctional” is antibody is an antibody having identical antigen binding sites (i.e., identical amino acid sequences) in the two arms but each binding site can recognize two different antigens.
- heteromultimer is a molecule comprising at least a first polypeptide and a second polypeptide, wherein the second polypeptide differs in amino acid sequence from the first polypeptide by at least one amino acid residue.
- the heteromultimer can comprise a "heterodimer” formed by the first and second polypeptide or can form higher order tertiary structures where polypeptides in addition to the first and second polypeptide are present.
- heterodimer is a molecule comprising a first polypeptide and a second polypeptide, wherein the second polypeptide differs in amino acid sequence from the first polypeptide by at least one amino acid residue.
- hinge region includes the meaning known in the art, which is illustrated in, for example, Janeway et al., ImmunoBiology: the immune system in health and disease, (Elsevier Science Ltd., NY) (4th ed., 1999); Bloom et al., Protein Science (1997), 6:407-415; Humphreys et al., J. Immunol. Methods (1997), 209:193-202.
- immunoglobulin-like hinge region refers to the hinge region and hinge sequence of an immunoglobulin-like or an antibody-like molecule (e.g., immunoadhesins).
- the immunoglobulin-like hinge region can be from or derived from any lgG1 , lgG2, lgG3, or lgG4 subtype, or from IgA, IgE, IgD or IgM, including chimeric forms thereof, e.g., a chimeric lgG1/2 hinge region.
- immune effector cell refers to a cell within the natural repertoire of cells in the human immune system which can be activated to affect the viability of a target cell.
- the viability of a target cell can include cell survival, proliferation, and/or ability to interact with other cells.
- Antibodies of the invention can be produced using techniques well known in the art, e.g., recombinant technologies, phage display technologies, synthetic technologies or combinations of such technologies or other technologies readily known in the art (see, for example, Jayasena, S.D., Clin. Chem., 45: 1628-50, 1999 and Fellouse, F.A., et al, J. Mol. Biol., 373(4):924-40, 2007).
- polynucleotide or “nucleic acid,” as used interchangeably herein, refer to chains of nucleotides of any length, and include DNA and RNA.
- the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a chain by DNA or RNA polymerase.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure may be imparted before or after assembly of the chain.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- Other types of modifications include, for example, "caps", substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc.) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins (e.g., nucleases, toxins, antibodies, signal peptides, poly-L-lysine, etc.), those with intercalators (e.g., acridine, psoralen, etc.), those containing chelators (e.g., metal
- any of the hydroxyl groups ordinarily present in the sugars may be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or may be conjugated to solid supports.
- the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
- Other hydroxyls may also be derivatized to standard protecting groups.
- Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-0-methyl-, 2'-0-allyl, 2'-fluoro- or 2'-azido-ribose, carbocyclic sugar analogs, alpha- or beta-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs and abasic nucleoside analogs such as methyl riboside.
- One or more phosphodiester linkages may be replaced by alternative linking groups.
- linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(0)S("thioate”), P(S)S ("dithioate”), (0)NR 2 ("amidate”), P(0)R, P(0)OR', CO or CH 2 ("formacetal”), in which each R or R' is independently H or substituted or unsubstituted alkyl (1 -20 C) optionally containing an ether (-0-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
- a "constant region" of an antibody refers to the constant region of the antibody light chain or the constant region of the antibody heavy chain, either alone or in combination.
- substantially pure refers to material which is at least 50% pure (i.e., free from contaminants), more preferably, at least 90% pure, more preferably, at least 95% pure, yet more preferably, at least 98% pure, and most preferably, at least 99% pure.
- a "host cell” includes an individual cell or cell culture that can be or has been a recipient for vector(s) for incorporation of polynucleotide inserts.
- Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation.
- a host cell includes cells transfected in vivo with a polynucleotide(s) of this invention.
- the term "Fc region” is used to define a C-terminal region of an immunoglobulin heavy chain.
- the "Fc region” may be a native sequence Fc region or a variant Fc region.
- the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl- terminus thereof.
- the numbering of the residues in the Fc region is that of the EU index as in Kabat. Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.
- the Fc region of an immunoglobulin generally comprises two constant regions, CH2 and CH3.
- Fc receptor and “FcR” describe a receptor that binds to the
- the preferred FcR is a native sequence human FcR.
- a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
- FcyRII receptors include FcyRIIA (an “activating receptor") and FcyRIIB (an "inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. FcRs are reviewed in Ravetch and Kinet, Ann. Rev.
- FcR also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol., 1 17:587, 1976; and Kim et al., J. Immunol., 24:249, 1994).
- Compet means that a first antibody, or an antigen binding fragment (or portion) thereof, binds to an epitope in a manner sufficiently similar to the binding of a second antibody, or an antigen binding portion thereof, such that the result of binding of the first antibody with its cognate epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody.
- the alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody can, but need not be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope.
- each antibody detectably inhibits the binding of the other antibody with its cognate epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to "cross-compete" with each other for binding of their respective epitope(s).
- Both competing and cross-competing antibodies are encompassed by the present invention. Regardless of the mechanism by which such competition or cross- competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof), the skilled artisan would appreciate, based upon the teachings provided herein, that such competing and/or cross-competing antibodies are encompassed and can be useful for the methods disclosed herein.
- a “functional Fc region” possesses at least one effector function of a native sequence Fc region.
- effector functions include C1q binding; complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity; phagocytosis; down-regulation of cell surface receptors (e.g. B cell receptor), etc.
- Such effector functions generally require the Fc region to be combined with a binding domain (e.g. an antibody variable domain) and can be assessed using various assays known in the art for evaluating such antibody effector functions.
- a “native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
- a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, yet retains at least one effector function of the native sequence Fc region.
- the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g. from about one to about ten amino acid substitutions, and preferably, from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
- the variant Fc region herein will preferably possess at least about 80% sequence identity with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and most preferably, at least about 90% sequence identity therewith, more preferably, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity therewith.
- effector function refers to the biological activities attributable to the Fc region of an antibody.
- antibody effector functions include, but are not limited to, antibody-dependent cell-mediated cytotoxicity (ADCC), Fc receptor binding, complement dependent cytotoxicity (CDC), phagocytosis, C1 q binding, and down regulation of cell surface receptors (e.g., B cell receptor; BCR). See, e.g., U.S. Pat No. 6,737,056.
- Such effector functions generally require the Fc region to be combined with a binding domain (e.g., an antibody variable domain) and can be assessed using various assays known in the art for evaluating such antibody effector functions.
- An exemplary measurement of effector function is through Fcy3 and/or C1 q binding.
- ADCC antibody-dependent cell-mediated cytotoxicity
- FcRs Fc receptors
- NK natural killer cells
- macrophages e.g. natural killer cells, neutrophils, and macrophages
- ADCC activity of a molecule of interest can be assessed using an in vitro ADCC assay, such as that described in U.S. Patent No. 5,500,362 or 5,821 ,337.
- Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and NK cells.
- PBMC peripheral blood mononuclear cells
- ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al., 1998, PNAS (USA), 95:652-656.
- “Complement dependent cytotoxicity” or “CDC” refers to the lysing of a target in the presence of complement.
- the complement activation pathway is initiated by the binding of the first component of the complement system (C1 q) to a molecule (e.g. an antibody) complexed with a cognate antigen.
- a CDC assay e.g. as described in Gazzano-Santoro et al., J. Immunol. Methods, 202: 163 (1996), may be performed.
- beneficial or desired clinical results include, but are not limited to, one or more of the following: reducing the proliferation of (or destroying) neoplastic or cancerous cells, inhibiting metastasis of neoplastic cells, shrinking or decreasing the size of EGFRvlll expressing tumor, remission of an EGFRvlll associated disease (e.g., cancer), decreasing symptoms resulting from an EGFRvlll associated disease (e.g., cancer), increasing the quality of life of those suffering from an EGFRvlll associated disease (e.g., cancer), decreasing the dose of other medications required to treat an EGFRvlll associated disease (e.g., cancer), delaying the progression of an EGFRvlll associated disease (e.g., cancer), curing an EGFRvlll associated disease (e.g., cancer), and/or prolong survival of patients having an EGFRvlll associated disease (e.g.
- “Ameliorating” means a lessening or improvement of one or more symptoms as compared to not administering an EGFRvlll antibody (monospecific or bispecific). “Ameliorating” also includes shortening or reduction in duration of a symptom.
- an "effective dosage” or “effective amount” of drug, compound, or pharmaceutical composition is an amount sufficient to effect any one or more beneficial or desired results.
- beneficial or desired results include eliminating or reducing the risk, lessening the severity, or delaying the outset of the disease, including biochemical, histological and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presenting during development of the disease.
- beneficial or desired results include clinical results such as reducing incidence or amelioration of one or more symptoms of various EGFRvlll associated diseases or conditions (such as for example multiple myeloma), decreasing the dose of other medications required to treat the disease, enhancing the effect of another medication, and/or delaying the progression of the EGFRvlll associated disease of patients.
- An effective dosage can be administered in one or more administrations.
- an effective dosage of drug, compound, or pharmaceutical composition is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly.
- an effective dosage of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition.
- an "effective dosage" may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
- mammals are mammals, more preferably, a human. Mammals also include, but are not limited to primates, horses, dogs, cats, mice and rats.
- vector means a construct, which is capable of delivering, and, preferably, expressing, one or more gene(s) or sequence(s) of interest in a host cell.
- vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
- expression control sequence means a nucleic acid sequence that directs transcription of a nucleic acid.
- An expression control sequence can be a promoter, such as a constitutive or an inducible promoter, or an enhancer.
- the expression control sequence is operably linked to the nucleic acid sequence to be transcribed.
- pharmaceutically acceptable carrier or “pharmaceutical acceptable excipient” includes any material which, when combined with an active ingredient, allows the ingredient to retain biological activity and is non-reactive with the subject's immune system.
- examples include, but are not limited to, any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, and various types of wetting agents.
- Preferred diluents for aerosol or parenteral administration are phosphate buffered saline (PBS) or normal (0.9%) saline.
- Compositions comprising such carriers are formulated by well known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro, ed., Mack Publishing Co., Easton, PA, 1990; and Remington, The Science and Practice of Pharmacy 21 st Ed. Mack Publishing, 2005).
- acyl donor glutamine-containing tag or "glutamine tag” as used herein refers to a polypeptide or a protein containing one or more Gin residue(s) that acts as a transglutaminase amine acceptor. See, e.g., WO2012059882 and WO2015015448.
- k on or "k a ", as used herein, refers to the rate constant for association of an antibody to an antigen. Specifically, the rate constants (k on /k a and k 0 ff/k d ) and equilibrium dissociation constants are measured using whole antibody (i.e. bivalent) and monomeric EGFRvlll proteins (e.g., Histidine-tagged EGFRvlll fusion protein).
- k off or "k d ", as used herein, refers to the rate constant for dissociation of an antibody from the antibody/antigen complex.
- K D refers to the equilibrium dissociation constant of an antibody-antigen interaction.
- references to "about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se.
- description referring to "about X” includes description of "X.”
- Numeric ranges are inclusive of the numbers defining the range.
- the term “about” refers to the indicated value of the variable and to all values of the variable that are within the experimental error of the indicated value (e.g. within the 95% confidence interval for the mean) or within 10 percent of the indicated value, whichever is greater.
- the term “about” is used within the context of a time period (years, months, weeks, days etc.)
- the term “about” means that period of time plus or minus one amount of the next subordinate time period (e.g. about 1 year means 1 1 -13 months; about 6 months means 6 months plus or minus 1 week; about 1 week means 6-8 days; etc.), or within 10 per cent of the indicated value, whichever is greater.
- the present invention encompasses not only the entire group listed as a whole, but each member of the group individually and all possible subgroups of the main group, but also the main group absent one or more of the group members.
- the present invention also envisages the explicit exclusion of one or more of any of the group members in the claimed invention.
- the present invention provides an antibody that binds to EGFRvlll [e.g., human EGFRvlll (e.g., accession number: P00533 Feature Identifier VAR_066493, or GenBank Acession No. AJN69267; mrpsgtagaallallaalcp asraleekkgny vtdhgscvracgadsyemeedgvrkckkcegpcrkvcngigigefkdslsi natnikhfknctsisgdlhilpvafrgdsfthtppldpqeldilktvkeitgflliqawpenrt dlhafenleiirgrtkqhgqfsla vslnitslglrslkeisdgdvii sgnknlcyantinwkk 1 fgtsgqktkii snrgensckatgqvchalcs
- an isolated antibody which specifically binds to EGFRvlll, wherein the antibody comprises (a) a heavy chain variable (VH) region comprising (i) a VH complementarity determining region one (CDR1 ) comprising the sequence shown in SEQ ID NO: 62, 63, 64, 74, 75, 76, 80, 81 , 82, 88, 89, 90, 93, 94, 95, 99, 100, 101 , 109, 1 10, 1 1 1 1 , 1 15, 1 16, 1 17, 121 , 122, 123, 132, 133, 134, 137, 138, 139, 143, 144, or 145; (ii) a VH CDR2 comprising the sequence shown in SEQ ID NO: 65, 66, 68, 69, 70, 71 , 77, 78, 83, 84, 86, 87, 91 , 92, 96, 97, 98, 102, 103,
- an isolated antibody which specifically binds to EGFRvlll, wherein the antibody comprises: a VH region comprising a VH CDR1 , VH CDR2, and VH CDR3 of the VH sequence shown in SEQ ID NO:1 , 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23, 25, 27, 30, 32, 34, 35, 37, 39, 41 , 43, 44, 46, 48, 50, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61 , 202, 203, 204, 205, 206, 207, 208, 209, 210, 214, 216, 217, or 218; and/or a VL region comprising VL CDR1 , VL CDR2, and VL CDR3 of the VL sequence shown in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 29, 31 , 33, 36, 38, 40, 42, 45, 47, 49, 51 , 21
- an antibody having any one of partial light chain sequence as listed in Table 1 and/or any one of partial heavy chain sequence as listed in Table 1.
- the underlined sequences are CDR sequences according to Kabat and in bold according to Chothia.
- VSS (SEQ ID NO: 1 1 )
- VSS SEQ ID NO: 19
- VSS (SEQ ID NO: 23)
- VTVSS (SEQ ID NO: 39)
- VTVSS (SEQ ID NO: 43)
- VTVSS (SEQ ID NO: 44)
- VSS wherein is R, H, K, D, E, S,
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 52)
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 53)
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 54)
- VTVSS wherein X is R, H, K, D, E,
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 55)
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, 1, L, M, F, Y, or W (SEQ ID NO: 56)
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 57)
- VSS wherein X 1 is R, H, K, D, E, S,
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 58)
- X 2 is R, H, K, D, E, S, mAb Light Chain Heavy Chain
- VTVSS wherein X is R, H, K, D, E,
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, 1, L, M, F, Y, or W (SEQ ID NO: 60)
- VTVSS wherein X is R, H, K, D, E,
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 61 )
- VTVSS wherein X is R, H, K, D, E,
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W, and X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, mAb Light Chain Heavy Chain
- VTVSS EFTLTISSLQSEDFAVYYCQDYN KDTSKSQ VVLTMTN M D PVDTATY NWPFTFGPGTKVDIK (SEQ ID YCVRX1X2SNYGGYFDYWGQGTL NO: 31 ) VTVSS, wherein is R, H, K, D, E,
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 203)
- VSS GTEFTLTISSLQSEDFAVYSCQEY DTSKSQVVLTMTNMD
- P VDTATYY NNWPFTFGQGTKVEIK SEQ ID CARX1X2SDYEGYFDYWGQGTLVT NO: 33
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 204)
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 205) mAb Light Chain Heavy Chain
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 206)
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 207)
- X- is R, H, K, D, E, S, T, VTVSS
- X is R, H, K, D, E, N, Q, C, G, P, A, V, I, L, M, F, Y, or S, T, N, Q, C, G, P, A, V, I, L, M, F, W
- X 2 is R, H, K, D, E, S, T, N, Y, or W
- X 2 is R, H, K, D, E, S, Q, C, G, P, A, V, I, L, M, F, Y, or W T, N, Q, C, G, P, A, V, I, L, M, F, Y, (SEQ ID NO: 21 1
- GSDSGTDFTLKISRVEAEDVGVY FTISRDDSKDTLYLQMNGLKTEDT YCMQALQTPITFGQGTRLEIK, AVYFCTTAPGGPFDYWGQGTLVT wherein is R, H, K, D, E, S, T, VSS, wherein X-, is R, H, K, D, E, S, N, Q, C, G, P, A, V, I, L, M, F, Y, or T, N, Q, C, G, P, A, V, I, L, M, F, Y, W, and X 2 is R, H, K, D, E, S, T, N, or W, and X 2 is R, H, K, D, E, S, T, Q, C, G, P, A, V, I, L, M, F, Y, or W N, Q, C, G, P, A, V, I, L, M, F, Y, or (SEQ ID NO: 212) W
- GSGSGIDFILKISRVEAEDVGVYY RCTISRDDSRNTLYLEMHSLKTED CMQAQQTPITFGQGTRLEIK, TAVYYCTTIPGNDDFDMWGQGRM wherein is R, H, K, D, E, S, T, VTVSS, wherein X-, is R, H, K, D, E, N, Q, C, G, P, A, V, I, L, M, F, Y, or S, T, N, Q, C, G, P, A, V, I, L, M, F, W, and X 2 is R, H, K, D, E, S, T, N, Y, or W, and X 2 is R, H, K, D, E, S, Q, C, G, P, A, V, I, L, M, F, Y, or W T, N, Q, C, G, P, A, V, I, L, M, F, Y, (SEQ ID NO: 213) or W
- Xi is R, H, K, D, E, S, T, VTVSS, wherein Xi is R, H, K, D, E, N, Q, C, G, P, A, V, I, L, M, F, Y, or S, T, N, Q, C, G, P, A, V, I, L, M, F, W, and X 2 is R, H, K, D, E, S, T, N, Y, or W, and X 2 is R, H, K, D, E, S, Q, C, G, P, A, V, I, L, M, F, Y, or W T, N, Q, C, G, P, A, V, I, L, M, F, Y, (SEQ ID NO: 215) or
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 216)
- X 2 is R, H, K, D, E, S, T, N, Q, C, G, P, A, V, I, L, M, F, Y, or W (SEQ ID NO: 217)
- CDR portions of antigen binding domains of antibodies EGFRvlll including Chothia, Kabat CDRs, and CDR contact regions. Determination CDR regions is well within the skill of the art. It is understood that in some embodiments, CDRs can be a combination of the Kabat and Chothia CDR (also termed “combined CRs" or “extended CDRs”). In some embodiments, the CDRs are the Kabat CDRs. In other embodiments, the CDRs are the Chothia CDRs. In other words, in embodiments with more than one CDR, the CDRs may be any of Kabat, Chothia, combination CDRs, or combinations thereof. Table 2 provides examples of CDR sequences provided herein.
- A10 SNARMGVS (SEQ ID NO: 80) HIFSTDEKSIRRSLRS DSSNYEGYFDY
- E10 SNARMGVS (SEQ ID NO: 80) HIFSTDEKSIRRSLRS DSSNYEGYFDYH6 (Kabat); (SEQ ID NO: 83) (SEQ ID NO: 85)
- A9 SNARMGVS (SEQ ID NO: 80) HIFSTDEKSLRLSLRS DSSNYEGYFDYE7 (Kabat); (SEQ ID NO: 98) (SEQ ID NO: 85)
- GFTFSD (SEQ ID NO: 110) (SEQ ID NO: 112) (Chothia); (Kabat)
- GFTFSYAWMS (SEQ ID NO: ID NO: 119) (Chothia)
- GFI FNNAWMS (SEQ ID NO: (SEQ ID NO: 125) 123) (extended) (Chothia)
- GFTFSYAWMS (SEQ ID NO: ID NO: 128) (Chothia) 117) (extended)
- GFTFSYAWMS (SEQ ID NO: (SEQ ID NO: 131 117) (extended) (Chothia)
- GDTFSSNAIS SEQ ID NO: 141) (Chothia)
- GFTFSNYAMS SEQ I D NO: ID NO: 147) (Chothia)
- G9-1 SNPRMGVS (SEQ I D NO: 74) HIFSTDEKSLKLSLRS XiX 2 SNYEGYFDF,
- GFSLSNPR (SEQ ID NO: 75) (Kabat) H, K, D, E, S, T, N,
- HIFSTDEKSL SEQ ID C, G, P, A, V, 1,
- GFSLSNPRMGVS (SEQ I D NO: NO: 78) (Chothia) L, M, F, Y, or W,
- A10-1 SNARMGVS (SEQ ID NO: 80) HIFSTDEKSIRRSLRS XiX 2 SNYEGYFDY,
- GFSLSNAR (SEQ ID NO: 81) (Kabat) H, K, D, E, S, T, N,
- HIFSTDEKSI SEQ ID C, G, P, A, V, 1,
- GFSLSNARMGVS (SEQ ID NO: 84) (Chothia) L, M, F, Y, or W,
- GFSLSNAR (SEQ ID NO: 81) HI FSTDEKSY (SEQ ID H, K, D, E, S, T, N,
- GFSLSNARMGVS SEQ ID NO: L, M, F, Y, or W
- X 2 is R, H, K, D, E, S, T, N, C,
- GFSLNNAR (SEQ ID NO: 89) (Kabat) H, K, D, E, S, T, N,
- HIFSTDEKSF SEQ ID C, G, P, A, V, 1,
- GFSLNNARMGVS (SEQ I D NO: 92) (Chothia) L, M, F, Y, or W,
- GFSLSNVR (SEQ ID NO: 94) (Kabat) H, K, D, E, S, T, N,
- HIFSSDEKSI SEQ ID C, G, P, A, V, 1,
- GFSLSNVRMGVS (SEQ ID NO: 97) (Chothia) L, M, F, Y, or W,
- GFSLSNVR (SEQ ID NO: 94) HIFSSDEKSI (SEQ ID H, K, D, E, S, T, N,
- GFSLSNVRMGVS (SEQ ID NO: L, M, F, Y, or W,
- GFSLSNAR (SEQ ID NO: 81) (Kabat) H, K, D, E, S, T, N,
- HIFSTDEKSI SEQ ID C, G, P, A, V, 1,
- GFSLSNARMGVS (SEQ ID NO: 84) (Chothia) L, M, F, Y, or W,
- GFSLSNAR (SEQ ID NO: 81) (Kabat) H, K, D, E, S, T, N,
- HIFSTDEKSL SEQ ID C, G, P, A, V, 1,
- GFSLSNARMGVS (SEQ ID NO: 78) (Chothia) L, M, F, Y, or W,
- GFSLSNAK (SEQ ID NO: 100) (Kabat) H, K, D, E, S, T, N,
- HIFSTDEKSI SEQ ID C, G, P, A, V, 1,
- GFSLSNAKMGVS (SEQ ID NO: 84) (Chothia) L, M, F, Y, or W,
- GFSLSNPR (SEQ ID NO: 75) (Kabat) H, K, D, E, S, T, N,
- HIFSSDEKSY SEQ ID C, G, P, A, V, 1,
- GFSLSNPRMGVS (SEQ I D NO: NO: 103) (Chothia) L, M, F, Y, or W,
- GFSLSNPR (SEQ ID NO: 75) (Kabat) H, K, D, E, S, T, N,
- HIFSSDEKSY SEQ ID C, G, P, A, V, 1,
- GFSLSNPRMGVS (SEQ I D NO: NO: 103) (Chothia) L, M, F, Y, or W,
- GFSLSNPR (SEQ ID NO: 75) (Kabat) H, K, D, E, S, T, N,
- HIFSSDEKSY SEQ ID C, G, P, A, V, 1,
- GFSLSNPRMGVS (SEQ I D NO: NO: 103) (Chothia) L, M, F, Y, or W,
- GFSLSNPR (SEQ ID NO: 75) (Kabat) H, K, D, E, S, T, N,
- GFSLSNPRMGVS (SEQ I D NO: NO: 87) (Chothia) L, M, F, Y, or W,
- GFTFSD (SEQ ID NO: 110) R, H, K, D, E, S, T, N,
- GFTFSDAWMS SEQ I D NO: M, F, Y, or W, and X 2
- W, and X 2 is R, H, K,
- GFTFSYAWMS SEQ ID NO: F, Y, or W, and X 2 is R
- W, and X 2 is R, H, K,
- GFI FNN (SEQ ID NO: 122) H, K, D, E, S, T, N, (Chothia); C, G, P, A, V, I, L, M,
- GFI FNNAWMS (SEQ ID NO: F, Y, or W, and X 2 is R,
- W, and X 2 is R, H, K,
- GFTFSY (SEQ ID NO: 116) H, K, D, E, S, T, N,
- GFTFSYAWMS (SEQ ID NO: F, Y, or W, and X 2 is R, 117) (extended) H, K, D, E, S, T, N,
- W, and X 2 is R, H, K,
- GFTFSY (SEQ ID NO: 116) H, K, D, E, S, T, N,
- GFTFSYAWMS (SEQ ID NO: F, Y, or W, and X 2 is R, 117) (extended) H, K, D, E, S, T, N,
- W, and X 2 is R, H, K,
- GFTFTN (SEQ ID NO: 133) H, K, D, E, S, T, N,
- GFTFTNAWMS SEQ I D NO: F, Y, or W, and X 2 is R,
- W, and X 2 is R, H, K,
- GDTFSS (SEQ ID NO: 138) (Kabat) Xi is R, H, K, D, E,
- VI IPIFGTADY SEQ ID S, T, N, , G, P,
- GDTFSS NAIS (SEQ ID NO: 141) (Chothia) A, V, 1, L, M, F, Y, 139) (extended) or W, and X 2 is R,
- GFTFSN (SEQ ID NO: 144) H, K, D, E, S, T, N, 148)
- GFTFSNYAMS SEQ I D NO: F, Y, or W, and X 2 is R, 145) (extended) H, K, D, E, S, T, N,
- ID NO: 190 191) I D NO: 184 ) 20G5 RSSQSLLYSDRRNYLD (SEQ LGSYRAS (SEQ ID NO: MQALQIPIT(SEQ ID NO: 192) 193) ID NO: 194 )
- F, Y, or W, and X 2 is R, H, K,
- F, Y, or W, and X 2 is R, H, K,
- the present invention provides an antibody that binds to and competes with the antibody as described herein, including m62G7, h62G7, h62G7- H14/L1-DV, h62G7-EQ/L6, 42G9, 32A10, 20B9, 14C11, 21E11, 49B11, 46E10, 12H6, 19A9, 21 E7, 11B11, 12B2, 11F10, 17G11, 29D5, 30D8, 20E12, 26B9, 32G8, 34E7, 20G5, C6, B5, 42G9-1, 32A10-1, 20B9-1, 14C11-1, 21E11-1, 49B11-1, 46E10-1, 12H6- 1, 19A9-1, 21E7-1, 11 B11-1 , 12B2-1, 11F10-1, 17G11-1, 29D5-1, 30D8-1, 20E12-1, 26B9-1, 32G8-1, 34E7-1, 20G5-1, C6-1,
- the invention also provides CDR portions of antibodies to EGFRvlll antibodies based on CDR contact regions.
- CDR contact regions are regions of an antibody that imbue specificity to the antibody for an antigen.
- CDR contact regions include the residue positions in the CDRs and Vernier zones which are constrained in order to maintain proper loop structure for the antibody to bind a specific antigen. See, e.g., Makabe et al., J. Biol. Chem., 283: 1 156-1166, 2007. Determination of CDR contact regions is well within the skill of the art.
- the binding affinity (K D ) of the EGFRvlll antibody as described herein to EGFRvlll can be about 0.001 to about 5000 nM.
- the binding affinity is about any of 5000 nM, 4500 nM, 4000 nM, 3500 nM, 3000 nM, 2500 nM, 2000 nM, 1789 nM, 1583 nM, 1540 nM, 1500 nM, 1490 nM, 1064 nM, 1000 nM, 933 nM, 894 nM, 750 nM, 705 nM, 678 nM, 532 nM, 500 nM, 494 nM, 400 nM, 349 nM, 340 nM, 353 nM, 300 nM, 250 nM, 244 nM, 231 nM, 225 nM, 207 nM, 200 nM, 186 nM, 172 nM, 136 nM, 1 13 nM, 104 nM, 101 nM, 100 nM, 90 nM, 83 nM, 79
- the binding affinity is less than about any of 5000 nM, 4000 nM, 3000 nM, 2000 nM, 1000 nM, 900 nM, 800 nM, 250 nM, 200 nM, 100 nM, 50 nM, 30 nM, 20 nM, 10 nM, 7.5 nM, 7 nM, 6.5 nM, 6 nM, 5 nM, 4.5 nM, 4 nM, 3.5 nM, 3 nM, 2.5 nM, 2 nM, 1.5 nM, 1 nM, or 0.5 nM.
- Bispecific antibodies monoclonal antibodies that have binding specificities for at least two different antigens
- Methods for making bispecific antibodies are known in the art (see, e.g., Suresh et al., Methods in Enzymology 121 :210, 1986).
- the recombinant production of bispecific antibodies was based on the coexpression of two immunoglobulin heavy chain-light chain pairs, with the two heavy chains having different specificities (Millstein and Cuello, Nature 305, 537-539, 1983).
- a bispecific antibody wherein the bispecific antibody is a full-length human antibody, comprising a first antibody variable domain of the bispecific antibody specifically binding to a target antigen (e.g., EGFRvlll), and comprising a second antibody variable domain of the bispecific antibody capable of recruiting the activity of a human immune effector cell by specifically binding to an effector antigen located on the human immune effector cell.
- a target antigen e.g., EGFRvlll
- the human immune effector cell can be any of a variety of immune effector cells known in the art.
- the immune effector cell can be a member of the human lymphoid cell lineage, including, but not limited to, a T cell (e.g., a cytotoxic T cell), a B cell, and a natural killer (NK) cell.
- the immune effector cell can also be, for example without limitation, a member of the human myeloid lineage, including, but not limited to, a monocyte, a neutrophilic granulocyte, and a dendritic cell.
- Such immune effector cells may have either a cytotoxic or an apoptotic effect on a target cell or other desired effect upon activation by binding of an effector antigen.
- the effector antigen is an antigen (e.g., a protein or a polypeptide) that is expressed on the human immune effector cell.
- antigens e.g., a protein or a polypeptide
- effector antigens that can be bound by the heterodimeric protein include, but are not limited to, human CD3 (or CD3 (Cluster of Differentiation) complex), CD16, NKG2D, NKp46, CD2, CD28, CD25, CD64, and CD89.
- the target cell can be a cell that is native or foreign to humans.
- the cell may have been transformed to be a malignant cell or pathologically modified (e.g., a native target cell infected with a virus, a Plasmodium, or a bacterium).
- a foreign target cell the cell is an invading pathogen, such as a bacterium, a Plasmodium, or a virus.
- the target antigen is expressed on a target cell in a diseased condition (e.g., an inflammatory disease, a proliferative disease (e.g., cancer), an immunological disorder, a neurological disease, a neurodegenerative disease, an autoimmune disease, an infectious disease (e.g., a viral infection or a parasitic infection), an allergic reaction, a graft-versus-host disease or a host-versus-graft disease).
- a target antigen is not effector antigen.
- the target antigen is EGFRvlll.
- a bispecific antibody wherein the bispecific antibody is a full-length human antibody, comprising a first antibody variable domain of the bispecific antibody specifically binding to a target antigen, and comprising a second antibody variable domain of the bispecific antibody capable of recruiting the activity of a human immune effector cell by specifically binding to an effector antigen located on the human immune effector cell, wherein the first antibody variable domain comprises a heavy chain variable (VH) region comprising a VH CDR1 , VH CDR2, and VH CDR3 of the VH sequence shown in SEQ ID NO: 1 , 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23, 25, 27, 30, 32, 34, 35, 37, 39, 41 , 43, 44, 46, 48, 50, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61 , 202, 203, 204, 205, 206, 207, 208, 209, 210, 214, 216, 217, or 218
- VH heavy chain
- a bispecific antibody wherein the bispecific antibody is a full-length human antibody, comprising a first antibody variable domain of the bispecific antibody specifically binding to a target antigen, and comprising a second antibody variable domain of the bispecific antibody capable of recruiting the activity of a human immune effector cell by specifically binding to an effector antigen located on the human immune effector cell, wherein the first antibody variable domain comprises (a) a heavy chain variable (VH) region comprising (i) a VH complementarity determining region one (CDR1 ) comprising the sequence shown in SEQ ID NO: 62, 63, 64, 74, 75, 76, 80, 81 , 82, 88, 89, 90, 93, 94, 95, 99, 100, 101 , 109, 1 10, 1 1 1 1 , 1 15, 1 16, 1 17, 121 , 122, 123, 132, 133, 134, 137, 138, 139, 143, 144, or 145; (ii)
- the second antibody variable domain comprises a heavy chain variable (VH) region comprising a VH CDR1 , VH CDR2, and VH CDR3 of the VH sequence shown in SEQ ID NO: 240; and/or a light chain variable (VL) region comprising VL CDR1 , VL CDR2, and VL CDR3 of the VL sequence shown in SEQ ID NO: 241.
- VH heavy chain variable
- VL light chain variable
- the second antibody variable domain comprises (a) a heavy chain variable (VH) region comprising (i) a VH complementary determining region one (CDR1 ) comprising the sequence shown in SEQ ID NO: 244, 1 10, or 245; (ii) a VH CDR2 comprising the sequence shown in SEQ ID NO: 246 or 247; and iii) a VH CDR3 comprising the sequence shown in SEQ ID NO: 248; and/or (b) a light chain variable (VL) region comprising (i) a VL CDR1 comprising the sequence shown in SEQ ID NO: 249; (ii) a VL CDR2 comprising the sequence shown in SEQ ID NO: 250; and (iii) a VL CDR3 comprising the sequence shown in SEQ ID NO: 251.
- VH heavy chain variable
- CDR1 VH complementary determining region one
- Table 3 shows the specific amino acid and nucleic acid sequences of the second antibody variable domain, which is specific to CD3.
- the underlined sequences are CDR sequences according to Kabat and in bold according to Chothia.
- Table 4 shows the examples of CDR sequences of the second antibody variable domain, which is specific to CD3.
- NPS NO: 246) Kabat (SEQ ID NO: 248)
- a bispecific antibody provided herein which contains a CD3-specific variable domain contains an anti-CD3 sequence as provided in U.S. Publication No. 20160297885, which is hereby incorporated by reference for all purposes.
- antibody variable domains with the desired binding specificities are fused to immunoglobulin constant region sequences.
- the fusion preferably is with an immunoglobulin heavy chain constant region, comprising at least part of the hinge, CH2 and CH3 regions. It is preferred to have the first heavy chain constant region (CH1 ), containing the site necessary for light chain binding, present in at least one of the fusions.
- DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are cotransfected into a suitable host organism.
- the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm.
- This asymmetric structure with an immunoglobulin light chain in only one half of the bispecific molecule, facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations.
- This approach is described in PCT Publication No. WO 94/04690.
- the bispecific antibodies are composed of amino acid modification in the first hinge region in one arm, and the substituted/replaced amino acid in the first hinge region has an opposite charge to the corresponding amino acid in the second hinge region in another arm.
- This approach is described in International Patent Application No. PCT/US201 1/036419 (WO201 1/143545).
- a desired heteromultimeric or heterodimeric protein is enhanced by altering or engineering an interface between a first and a second immunoglobulin-like Fc region (e.g., a hinge region and/or a CH3 region).
- the bispecific antibodies may be composed of a CH3 region, wherein the CH3 region comprises a first CH3 polypeptide and a second CH3 polypeptide which interact together to form a CH3 interface, wherein one or more amino acids within the CH3 interface destabilize homodimer formation and are not electrostatically unfavorable to homodimer formation.
- the bispecific antibodies can be generated using a glutamine-containing peptide tag engineered to the antibody directed to an epitope (e.g., EGFRvlll) in one arm and another peptide tag (e.g., a Lys-containing peptide tag or a reactive endogenous Lys) engineered to a second antibody directed to a second epitope in another arm in the presence of transglutaminase.
- an epitope e.g., EGFRvlll
- another peptide tag e.g., a Lys-containing peptide tag or a reactive endogenous Lys
- the heterodimeric protein as described herein comprises a full-length human antibody, wherein a first antibody variable domain of the bispecific antibody specifically binding to a target antigen (e.g., EGFRvlll), and comprising a second antibody variable domain of the bispecific antibody capable of recruiting the activity of a human immune effector cell by specifically binding to an effector antigen (e.g., CD3) located on the human immune effector cell, wherein the first and second antibody variable domain of the heterodimeric protein comprise amino acid modifications at positions 223, 225, and 228 (e.g., (C223E or C223R), (E225R), and (P228E or P228R)) in the hinge region and at position 409 or 368 (e.g., K409R or L368E (EU numbering scheme)) in the CH3 region of human lgG2 (SEQ ID NO: 290).
- a target antigen e.g., EGFRvlll
- an effector antigen e
- the first and second antibody variable domains of the heterodimeric protein comprise amino acid modifications at positions 221 and 228 (e.g., (D221 R or D221 E) and (P228R or P228E)) in the hinge region and at position 409 or 368 (e.g., K409R or L368E (EU numbering scheme)) in the CH3 region of human lgG1 (SEQ ID NO: 291 ).
- positions 221 and 228 e.g., (D221 R or D221 E) and (P228R or P228E)
- 409 or 368 e.g., K409R or L368E (EU numbering scheme)
- the first and second antibody variable domains of the heterodimeric protein comprise amino acid modifications at positions 228 (e.g., (P228E or P228R)) in the hinge region and at position 409 or 368 (e.g., R409 or L368E (EU numbering scheme)) in the CH3 region of human lgG4 (SEQ ID NO: 292).
- amino acid sequence of the wild type Fc regions of human lgG1 , lgG2, and lgG4 are listed below:
- the antibodies useful in the present invention can encompass monoclonal antibodies, polyclonal antibodies, antibody fragments (e.g., Fab, Fab', F(ab')2, Fv, Fc, etc.), chimeric antibodies, bispecific antibodies, heteroconjugate antibodies, single chain (ScFv), mutants thereof, fusion proteins comprising an antibody portion (e.g., a domain antibody), humanized antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies.
- the antibodies may be murine, rat, human, or any other origin (including chimeric or humanized antibodies).
- the EGFRvl ll antibody as described herein is a monoclonal antibody.
- the EGFRvlll antibody is a humanized monoclonal antibody or a chimeric monoclonal antibody.
- the antibody comprises a modified constant region, such as, for example without limitation, a constant region that has increased potential for provoking an immune response.
- the constant region may be modified to have increased affinity to an Fc gamma receptor such as, e.g. , FcyRI, FcyRI IA, or FCYI I I .
- the antibody comprises a modified constant region, such as a constant region that is immunologically inert, that is, having a reduced potential for provoking an immune response.
- the constant region is modified as described in Eur. J. Immunol. , 29:2613-2624, 1999; PCT Application No. PCT/GB99/01441 ; and/or UK Patent Application No. 98099518.
- the Fc can be human lgG1 , human lgG2, human lgG3, or human lgG4.
- the Fc can be human lgG2 containing the mutation A330P331 to S330S331 (lgG2Aa), in which the amino acid residues are numbered with reference to the wild type lgG2 sequence.
- the antibody comprises a constant region of lgG 4 comprising the following mutations (Armour et al. , Molecular Immunology 40 585-593, 2003): E233F234L235 to P233V234A235 (lgG4Ac), in which the numbering is with reference to wild type lgG4.
- the Fc is human lgG4 E233F234L235 to P233V234A235 with deletion G236 (lgG4Ab).
- the Fc is any human lgG4 Fc (lgG4, lgG4Ab or lgG4Ac) containing hinge stabilizing mutation S228 to P228 (Aalberse et al., Immunology 105, 9- 19, 2002).
- the Fc can be aglycosylated Fc.
- the constant region is aglycosylated by mutating the oligosaccharide attachment residue (such as Asn297) and/or flanking residues that are part of the glycosylation recognition sequence in the constant region.
- the constant region is aglycosylated for N-linked glycosylation enzymatically.
- the constant region may be aglycosylated for N-linked glycosylation enzymatically or by expression in a glycosylation deficient host cell.
- the constant region has a modified constant region that removes or reduces Fc gamma receptor binding.
- the Fc can be human lgG2 containing the mutation D265, in which the amino acid residues are numbered with reference to the wild type lgG2 sequence (SEQ ID NO: 290).
- the constant region has a modified constant region having the sequence shown in SEQ ID NO: 252:
- the constant region has a modified constant region having the sequence shown in SEQ ID NO: 254:
- SEQ ID NO: 254 The nucleic acid encoding the sequence shown in SEQ ID NO: 254 is shown in SEQ ID NO: 255:
- the amino acid of the human Kappa constant region is shown in SEQ ID NO:
- SEQ ID NO: 257 GGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAA ATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCA AAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGT CACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCT GAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAG GGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG.
- One way of determining binding affinity of antibodies to EGFRvlll is by measuring binding affinity of the bivalent antibody to monomeric EGFRvlll protein.
- the affinity of an EGFRvlll antibody can be determined by surface plasmon resonance (BiacoreTM3000TM surface plasmon resonance (SPR) system, BiacoreTM, INC, Piscataway NJ) equipped with pre-immobilized anti-mouse Fc or anti-human Fc using HBS-EP running buffer (0.01 M HEPES, pH 7.4, 0.15 NaCI, 3 mM EDTA, 0.005% v/v Surfactant P20).
- Monomeric 8-histidine tagged human EGFRvlll extracellular domain can be diluted into HBS-EP buffer to a concentration of less than 0.5 pg/mL and injected across the individual chip channels using variable contact times, to achieve two ranges of antigen density, either 50-200 response units (RU) for detailed kinetic studies or 800-1 ,000 RU for screening assays.
- Regeneration studies have shown that 25 mM NaOH in 25% v/v ethanol effectively removes the bound EGFRvlll protein while keeping the activity of EGFRvlll antibodies on the chip for over 200 injections.
- serial dilutions (spanning concentrations of 0.1 -1 Ox estimated K D ) of purified 8-histidine tagged EGFRvlll samples are injected for 1 min at 100 ⁇ _ ⁇ and dissociation times of up to 2 hours are allowed.
- concentrations of the EGFRvlll proteins are determined by absorbance at 280nm based on sequence specific extinction coefficient of the 8-histidine tagged EGFRvlll protein.
- Kinetic association rates (k on or k a ) and dissociation rates (k 0 ff or k d ) are obtained simultaneously by fitting the data globally to a 1 :1 Langmuir binding model (Karlsson, R. Roos, H. Fagerstam, L.
- the antibodies as described herein may be made by any method known in the art.
- the route and schedule of immunization of the host animal are generally in keeping with established and conventional techniques for antibody stimulation and production, as further described herein.
- General techniques for production of human and mouse antibodies are known in the art and/or are described herein.
- any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human and hybridoma cell lines.
- the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and/or intradermally with an amount of immunogen, including as described herein.
- Hybridomas can be prepared from the lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler, B. and Milstein, C, Nature 256:495-497, 1975 or as modified by Buck, D. W., et al., In Vitro, 18:377- 381 , 1982.
- Available myeloma lines including but not limited to X63-Ag8.653 and those from the Salk Institute, Cell Distribution Center, San Diego, Calif., USA, may be used in the hybridization.
- the technique involves fusing myeloma cells and lymphoid cells using a fusogen such as polyethylene glycol, or by electrical means well known to those skilled in the art.
- the cells are separated from the fusion medium and grown in a selective growth medium, such as hypoxanthine- aminopterin-thymidine (HAT) medium, to eliminate unhybridized parent cells.
- a selective growth medium such as hypoxanthine- aminopterin-thymidine (HAT) medium
- HAT hypoxanthine- aminopterin-thymidine
- Any of the media described herein, supplemented with or without serum, can be used for culturing hybridomas that secrete monoclonal antibodies.
- EBV immortalized B cells may be used to produce the monoclonal antibodies of the subject invention.
- hybridomas are expanded and subcloned, if desired, and supernatants are assayed for anti-immunogen activity by conventional immunoassay procedures (e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay).
- immunoassay procedures e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay.
- Hybridomas that may be used as source of antibodies encompass all derivatives, progeny cells of the parent hybridomas that produce monoclonal antibodies specific for EGFRvlll, or portions thereof.
- Hybridomas that produce such antibodies may be grown in vitro or in vivo using known procedures.
- the monoclonal antibodies may be isolated from the culture media or body fluids, by conventional immunoglobulin purification procedures such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography, and ultrafiltration, if desired.
- Undesired activity, if present, can be removed, for example, by running the preparation over adsorbents made of the immunogen attached to a solid phase and eluting or releasing the desired antibodies off the immunogen.
- a protein that is immunogenic in the species to be immunized e.g., keyhole limpet hemocyanin, serum albumin
- the antibody (monoclonal or polyclonal) of interest may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation.
- the sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use.
- Production of recombinant monoclonal antibodies in cell culture can be carried out through cloning of antibody genes from B cells by means known in the art. See, e.g. Tiller et al., J. Immunol. Methods 329, 1 12, 2008; U.S. Pat. No. 7,314,622.
- the polynucleotide sequence may be used for genetic manipulation to "humanize” the antibody or to improve the affinity, or other characteristics of the antibody.
- the constant region may be engineered to more nearly resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans. It may be desirable to genetically manipulate the antibody sequence to obtain greater affinity to EGFRvlll and greater efficacy in inhibiting EGFRvlll.
- a number of "humanized" antibody molecules comprising an antigen binding site derived from a non-human immunoglobulin have been described, including chimeric antibodies having rodent or modified rodent V regions and their associated CDRs fused to human constant regions. See, for example, Winter et al. Nature 349:293-299, 1991 , Lobuglio et al. Proc. Nat. Acad. Sci. USA 86:4220-4224, 1989, Shaw et al. J Immunol. 138:4534-4538, 1987, and Brown et al. Cancer Res. 47:3577-3583, 1987. Other references describe rodent CDRs grafted into a human supporting framework region (FR) prior to fusion with an appropriate human antibody constant region.
- FR human supporting framework region
- humanized antibodies discussed above are also applicable to customizing antibodies for use, for example, in dogs, cats, primate, equines and bovines. Further, one or more aspects of humanizing an antibody described herein may be combined, e.g., CDR grafting, framework mutation and CDR mutation.
- Fully human antibodies may be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins.
- Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are XenomouseTM from Abgenix, Inc. (Fremont, CA) and HuMAb-Mouse® and TC MouseTM from Medarex, Inc. (Princeton, NJ).
- antibodies may be made recombinantly and expressed using any method known in the art.
- antibodies may be made recombinantly by phage display technology. See, for example, U.S. Pat. Nos. 5,565,332; 5,580,717; 5,733,743; and 6,265,150; and Winter et al., Annu. Rev. Immunol. 12:433-455, 1994.
- the phage display technology (McCafferty et al., Nature 348:552-553, 1990) can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors.
- V immunoglobulin variable
- antibody V domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as M13 or fd, and displayed as functional antibody fragments on the surface of the phage particle.
- a filamentous bacteriophage such as M13 or fd
- selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties.
- the phage mimics some of the properties of the B cell.
- Phage display can be performed in a variety of formats; for review see, e.g., Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3:564-571 , 1993.
- V-gene segments can be used for phage display. Clackson et al., Nature 352:624-628, 1991 , isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of immunized mice. A repertoire of V genes from unimmunized human donors can be constructed and antibodies to a diverse array of antigens (including self-antigens) can be isolated essentially following the techniques described by Mark et al., J. Mol. Biol. 222:581 -597, 1991 , or Griffith et al., EMBO J. 12:725-734, 1993.
- Antibodies may be made recombinantly by first isolating the antibodies and antibody producing cells from host animals, obtaining the gene sequence, and using the gene sequence to express the antibody recombinantly in host cells (e.g., CHO cells). Another method which may be employed is to express the antibody sequence in plants (e.g., tobacco) or transgenic milk. Methods for expressing antibodies recombinantly in plants or milk have been disclosed. See, for example, Peeters, et al. Vaccine 19:2756, 2001 ; Lonberg, N. and D. Huszar Int. Rev. Immunol 13:65, 1995; and Pollock, et al., J Immunol Methods 231 : 147, 1999. Methods for making derivatives of antibodies, e.g., humanized, single chain, etc. are known in the art.
- Immunoassays and flow cytometry sorting techniques such as fluorescence activated cell sorting (FACS) can also be employed to isolate antibodies that are specific for EGFRvlll, or tumor antigens of interest.
- FACS fluorescence activated cell sorting
- Carriers can be active and/or inert.
- Examples of well-known carriers include polypropylene, polystyrene, polyethylene, dextran, nylon, amylases, glass, natural and modified celluloses, polyacrylamides, agaroses, and magnetite.
- the nature of the carrier can be either soluble or insoluble for purposes of the invention. Those skilled in the art will know of other suitable carriers for binding antibodies, or will be able to ascertain such, using routine experimentation.
- the carrier comprises a moiety that targets the myocardium.
- DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies).
- the hybridoma cells serve as a preferred source of such DNA.
- the DNA may be placed into expression vectors (such as expression vectors disclosed in PCT Publication No. WO 87/04462), which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
- expression vectors such as expression vectors disclosed in PCT Publication No. WO 87/04462
- host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells
- the DNA also may be modified, for example, by substituting the coding sequence for human heavy and light chain constant regions in place of the homologous murine sequences, Morrison et al., Proc. Nat. Acad. Sci. 81 :6851 , 1984, or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. In that manner, "chimeric" or “hybrid” antibodies are prepared that have the binding specificity of a monoclonal antibody herein.
- the EGFRvlll antibodies as described herein can be identified or characterized using methods known in the art, whereby reduction of EGFRvlll expression levels are detected and/or measured.
- an EGFRvlll antibody is identified by incubating a candidate agent with EGFRvlll and monitoring binding and/or attendant reduction of EGFRvlll expression levels.
- the binding assay may be performed with purified EGFRvlll polypeptide(s), or with cells naturally expressing, or transfected to express, EGFRvlll polypeptide(s).
- the binding assay is a competitive binding assay, where the ability of a candidate antibody to compete with a known EGFRvlll antibody for EGFRvlll binding is evaluated.
- the assay may be performed in various formats, including the ELISA format.
- bioassays known to test the targeted biological activities.
- bioassays can be used to screen candidates directly.
- EGFRvlll antibodies may be characterized using methods well known in the art. For example, one method is to identify the epitope to which it binds, or "epitope mapping.” There are many methods known in the art for mapping and characterizing the location of epitopes on proteins, including solving the crystal structure of an antibody-antigen complex, competition assays, gene fragment expression assays, and synthetic peptide-based assays, as described, for example, in Chapter 1 1 of Harlow and Lane, Using Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1999. In an additional example, epitope mapping can be used to determine the sequence to which an antibody binds.
- Epitope mapping is commercially available from various sources, for example, Pepscan Systems (Edelhertweg 15, 8219 PH Lelystad, The Netherlands).
- the epitope can be a linear epitope, i.e., contained in a single stretch of amino acids, or a conformational epitope formed by a three-dimensional interaction of amino acids that may not necessarily be contained in a single stretch.
- Peptides of varying lengths e.g., at least 4-6 amino acids long
- the epitope to which the EGFRvlll antibody binds can be determined in a systematic screening by using overlapping peptides derived from the EGFRvlll sequence and determining binding by the EGFRvlll antibody.
- the open reading frame encoding EGFRvlll is fragmented either randomly or by specific genetic constructions and the reactivity of the expressed fragments of EGFRvlll with the antibody to be tested is determined.
- the gene fragments may, for example, be produced by PCR and then transcribed and translated into protein in vitro, in the presence of radioactive amino acids.
- the binding of the antibody to the radioactively labeled EGFRvlll is then determined by immunoprecipitation and gel electrophoresis.
- Certain epitopes can also be identified by using large libraries of random peptide sequences displayed on the surface of phage particles (phage libraries). Alternatively, a defined library of overlapping peptide fragments can be tested for binding to the test antibody in simple binding assays.
- mutagenesis of an antigen binding domain, domain swapping experiments and alanine scanning mutagenesis can be performed to identify residues required, sufficient, and/or necessary for epitope binding.
- domain swapping experiments can be performed using a mutant EGFRvlll in which various fragments of the EGFRvlll protein have been replaced (swapped) with sequences from EGFRvlll from another species (e.g., mouse), or a closely related, but antigenically distinct protein (e.g., Trop-1 ).
- EGFRvlll specific antibody i.e. antibody that does not bind EGFRwt (wild type) or any other proteins
- epitope can be deduced from the sequence alignment of EGFRvlll to EGFRwt.
- Yet another method which can be used to characterize an EGFRvlll antibody is to use competition assays with other antibodies known to bind to the same antigen, i.e., various fragments on EGFRvlll, to determine if the EGFRvlll antibody binds to the same epitope as other antibodies.
- Competition assays are well known to those of skill in the art.
- An expression vector can be used to direct expression of an EGFRvlll antibody.
- One skilled in the art is familiar with administration of expression vectors to obtain expression of an exogenous protein in vivo. See, e.g., U.S. Pat. Nos. 6,436,908; 6,413,942; and 6,376,471.
- Administration of expression vectors includes local or systemic administration, including injection, oral administration, particle gun or catheterized administration, and topical administration.
- the expression vector is administered directly to the sympathetic trunk or ganglion, or into a coronary artery, atrium, ventrical, or pericardium.
- Targeted delivery of therapeutic compositions containing an expression vector, or subgenomic polynucleotides can also be used.
- Receptor-mediated DNA delivery techniques are described in, for example, Findeis et al., Trends Biotechnol., 1993, 1 1 :202; Chiou et al., Gene Therapeutics: Methods And Applications Of Direct Gene Transfer, J.A. Wolff, ed., 1994; Wu et al., J. Biol. Chem., 263:621 , 1988; Wu et al., J. Biol. Chem., 269:542, 1994; Zenke et al., Proc. Natl. Acad. Sci. USA, 87:3655, 1990; and Wu et al., J. Biol. Chem., 266:338, 1991.
- compositions containing a polynucleotide are administered in a range of about 100 ng to about 200 mg of DNA for local administration in a gene therapy protocol. Concentration ranges of about 500 ng to about 50 mg, about 1 ⁇ g to about 2 mg, about 5 ⁇ g to about 500 ⁇ g, and about 20 ⁇ g to about 100 ⁇ g of DNA can also be used during a gene therapy protocol.
- the therapeutic polynucleotides and polypeptides can be delivered using gene delivery vehicles.
- the gene delivery vehicle can be of viral or non-viral origin (see generally, Jolly, Cancer Gene Therapy,1 :51 , 1994; Kimura, Human Gene Therapy, 5:845, 1994; Connelly, Human Gene Therapy, 1995, 1 :185; and Kaplitt, Nature Genetics, 6:148, 1994). Expression of such coding sequences can be induced using endogenous mammalian or heterologous promoters. Expression of the coding sequence can be either constitutive or regulated.
- Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art.
- Exemplary viral-based vehicles include, but are not limited to, recombinant retroviruses (see, e.g., PCT Publication Nos. WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/1 1230; WO 93/10218; WO 91/02805; U.S. Pat. Nos. 5, 219,740 and 4,777, 127; GB Pat. No. 2,200,651 ; and EP Pat. No.
- alphavirus-based vectors e.g., Sindbis virus vectors, Semliki forest virus (ATCC VR-67; ATCC VR-1247), Ross River virus (ATCC VR-373; ATCC VR-1246) and Venezuelan equine encephalitis virus (ATCC VR-923; ATCC VR-1250; ATCC VR 1249; ATCC VR-532)
- AAV adeno-associated virus
- Non-viral delivery vehicles and methods can also be employed, including, but not limited to, polycationic condensed DNA linked or unlinked to killed adenovirus alone (see, e.g., Curiel, Hum. Gene Then, 3: 147, 1992); ligand-linked DNA (see, e.g., Wu, J. Biol. Chem., 264:16985, 1989); eukaryotic cell delivery vehicles cells (see, e.g., U.S. Pat. No.5,814,482; PCT Publication Nos. WO 95/07994; WO 96/17072; WO 95/30763; and WO 97/42338) and nucleic charge neutralization or fusion with cell membranes. Naked DNA can also be employed.
- Exemplary naked DNA introduction methods are described in PCT Publication No. WO 90/11092 and U.S. Pat. No. 5,580,859.
- Liposomes that can act as gene delivery vehicles are described in U.S. Pat. No. 5,422,120; PCT Publication Nos. WO 95/13796; WO 94/23697; WO 91/14445; and EP 0524968. Additional approaches are described in Philip, Mol. Cell Biol., 14:2411, 1994 and in Woffendin, Proc. Natl. Acad. Sci., 91:1581, 1994.
- compositions comprising antibodies described herein or made by the methods and having the characteristics described herein.
- compositions comprise one or more antibodies that bind to EGFRvlll, and/or one or more polynucleotides comprising sequences encoding one or more these antibodies.
- compositions may further comprise suitable excipients, such as pharmaceutically acceptable excipients including buffers, which are well known in the art.
- the invention also provides methods of making any of these antibodies.
- the antibodies of this invention can be made by procedures known in the art.
- the polypeptides can be produced by proteolytic or other degradation of the antibodies, by recombinant methods (i.e., single or fusion polypeptides) as described above or by chemical synthesis.
- Polypeptides of the antibodies, especially shorter polypeptides up to about 50 amino acids, are conveniently made by chemical synthesis. Methods of chemical synthesis are known in the art and are commercially available.
- an antibody could be produced by an automated polypeptide synthesizer employing the solid phase method. See also, U.S. Pat. Nos.5,807,715; 4,816,567; and 6,331,415.
- a polynucleotide comprises a sequence encoding the heavy chain and/or the light chain variable regions of antibody m62G7, h62G7, h62G7-H14/L1-DV, h62G7-EQ/L6, 42G9, 32A10, 20B9, 14C11, 21E11, 49B11, 46E10, 12H6, 19A9, 21E7, 11B11, 12B2, 11F10, 17G11, 29D5, 30D8, 20E12, 26B9, 32G8, 34E7, 20G5, C6, B5, 42G9-1, 32A10-1, 20B9-1, 14C11-1, 21E11-1, 49B11-1, 46E10-1, 12H6-1, 19A9-1, 21E7-1, 11B11-1, 12B2-1, 11F10-1, 17G11-1, 29D5-1, 30D8-1,
- Heteroconjugate antibodies comprising two covalently joined antibodies, are also within the scope of the invention. Such antibodies have been used to target immune system cells to unwanted cells (U.S. Pat. No. 4,676,980), and for treatment of HIV infection (PCT Publication Nos. WO 91/00360 and WO 92/200373; EP 03089). Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents and techniques are well known in the art, and are described in U.S. Pat. No. 4,676,980.
- Chimeric or hybrid antibodies also may be prepared in vitro using known methods of synthetic protein chemistry, including those involving cross-linking agents.
- immunotoxins may be constructed using a disulfide exchange reaction or by forming a thioether bond.
- suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
- the Fey portion can be modified to avoid interaction with Fey receptor and the complement and immune systems.
- the techniques for preparation of such antibodies are described in WO 99/58572.
- the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans. See, for example, U.S. Pat. Nos. 5,997,867 and 5,866,692.
- the invention encompasses modifications to the antibodies and polypeptides of the invention including variants shown in Table 5, including functionally equivalent antibodies which do not significantly affect their properties and variants which have enhanced or decreased activity and/or affinity.
- the amino acid sequence may be mutated to obtain an antibody with the desired binding affinity to EGFRvlll.
- Modification of polypeptides is routine practice in the art and need not be described in detail herein. Examples of modified polypeptides include polypeptides with conservative substitutions of amino acid residues, one or more deletions or additions of amino acids which do not significantly deleteriously change the functional activity, or which mature (enhance) the affinity of the polypeptide for its ligand, or use of chemical analogs.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to an epitope tag.
- Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody of an enzyme or a polypeptide which increases the half-life of the antibody in the blood circulation.
- substitution variants have at least one amino acid residue in the antibody molecule removed and a different residue inserted in its place.
- the sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated.
- Conservative substitutions are shown in Table 5 under the heading of "conservative substitutions.” If such substitutions result in a change in biological activity, then more substantial changes, denominated "exemplary substitutions" in Table 5, or as further described below in reference to amino acid classes, may be introduced and the products screened.
- substitution variants of antibodies provided herein have no more than 15, 14, 13, 12, 1 1 , 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 conservative substitution in the VH or VL region as compared to the reference parent antibody. In some embodiments, the substitutions are not within a CDR of the VH or VL region.
- Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- Naturally occurring amino acid residues are divided into groups based on common side-chain properties:
- Non-conservative substitutions are made by exchanging a member of one of these classes for another class.
- cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant cross-linking.
- cysteine bond(s) may be added to the antibody to improve its stability, particularly where the antibody is an antibody fragment such as an Fv fragment.
- Amino acid modifications can range from changing or modifying one or more amino acids to complete redesign of a region, such as the variable region. Changes in the variable region can alter binding affinity and/or specificity. In some embodiments, no more than one to five conservative amino acid substitutions are made within a CDR domain. In other embodiments, no more than one to three conservative amino acid substitutions are made within a CDR domain. In still other embodiments, the CDR domain is CDR H3 and/or CDR L3.
- Modifications also include glycosylated and nonglycosylated polypeptides, as well as polypeptides with other post-translational modifications, such as, for example, glycosylation with different sugars, acetylation, and phosphorylation.
- Antibodies are glycosylated at conserved positions in their constant regions (Jefferis and Lund, Chem. Immunol. 65: 1 1 1-128, 1997; Wright and Morrison, TibTECH 15:26-32, 1997).
- the oligosaccharide side chains of the immunoglobulins affect the protein's function (Boyd et al., Mol. Immunol. 32:131 1 -1318, 1996; Wittwe and Howard, Biochem.
- Oligosaccharides may also serve to target a given glycoprotein to certain molecules based upon specific recognition structures. Glycosylation of antibodies has also been reported to affect antibody-dependent cellular cytotoxicity (ADCC).
- CHO cells with tetracycline-regulated expression of ⁇ (1 ,4)- ⁇ - acetylglucosaminyltransferase III (GnTIII), a glycosyltransferase catalyzing formation of bisecting GlcNAc, was reported to have improved ADCC activity (Umana et al., Mature Biotech. 17: 176-180, 1999).
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine, asparagine-X-threonine, and asparagine-X-cysteine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- O-linked glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above- described tripeptide sequences (for N-linked glycosylation sites).
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
- glycosylation pattern of antibodies may also be altered without altering the underlying nucleotide sequence. Glycosylation largely depends on the host cell used to express the antibody. Since the cell type used for expression of recombinant glycoproteins, e.g. antibodies, as potential therapeutics is rarely the native cell, variations in the glycosylation pattern of the antibodies can be expected (see, e.g. Hse et al., J. Biol. Chem. 272:9062-9070, 1997).
- factors that affect glycosylation during recombinant production of antibodies include growth mode, media formulation, culture density, oxygenation, pH, purification schemes and the like.
- Various methods have been proposed to alter the glycosylation pattern achieved in a particular host organism including introducing or overexpressing certain enzymes involved in oligosaccharide production (U.S. Pat. Nos. 5,047,335; 5,510,261 and 5,278,299).
- Glycosylation or certain types of glycosylation, can be enzymatically removed from the glycoprotein, for example, using endoglycosidase H (Endo H), N-glycosidase F, endoglycosidase F1 , endoglycosidase F2, endoglycosidase F3.
- Endo H endoglycosidase H
- N-glycosidase F N-glycosidase F
- endoglycosidase F1 endoglycosidase F2
- endoglycosidase F3 endoglycosidase F3
- the recombinant host cell can be genetically engineered to be defective in processing certain types of polysaccharides.
- Modifications include using coupling techniques known in the art, including, but not limited to, enzymatic means, oxidative substitution and chelation. Modifications can be used, for example, for attachment of labels for immunoassay. Modified polypeptides are made using established procedures in the art and can be screened using standard assays known in the art, some of which are described below and in the Examples.
- antibody modifications include antibodies that have been modified as described in PCT Publication No. WO 99/58572. These antibodies comprise, in addition to a binding domain directed at the target molecule, an effector domain having an amino acid sequence substantially homologous to all or part of a constant region of a human immunoglobulin heavy chain. These antibodies are capable of binding the target molecule without triggering significant complement dependent lysis, or cell- mediated destruction of the target. In some embodiments, the effector domain is capable of specifically binding FcRn and/or FcYRIIb. These are typically based on chimeric domains derived from two or more human immunoglobulin heavy chain CH2 domains. Antibodies modified in this manner are particularly suitable for use in chronic antibody therapy, to avoid inflammatory and other adverse reactions to conventional antibody therapy.
- affinity matured antibodies can be produced by procedures known in the art (Marks et al., Bio/Technology, 10:779-783, 1992; Barbas et al., Proc Nat. Acad. Sci, USA 91 :3809- 3813, 1994; Schier et al., Gene, 169:147-155, 1995; Yelton et al., J. Immunol., 155:1994-2004, 1995; Jackson et al., J. Immunol., 154(7):3310-9, 1995, Hawkins et al., J. Mol. Biol., 226:889-896, 1992; and PCT Publication No. WO2004/058184).
- library scanning mutagenesis One way of characterizing a CDR of an antibody and/or altering (such as improving) the binding affinity of a polypeptide, such as an antibody, termed "library scanning mutagenesis".
- library scanning mutagenesis works as follows. One or more amino acid positions in the CDR are replaced with two or more (such as 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids using art recognized methods. This generates small libraries of clones (in some embodiments, one for every amino acid position that is analyzed), each with a complexity of two or more members (if two or more amino acids are substituted at every position).
- the library also includes a clone comprising the native (unsubstituted) amino acid.
- a small number of clones, e.g., about 20-80 clones (depending on the complexity of the library), from each library are screened for binding affinity to the target polypeptide (or other binding target), and candidates with increased, the same, decreased, or no binding are identified.
- Methods for determining binding affinity are well-known in the art. Binding affinity may be determined using BiacoreTM surface plasmon resonance analysis, which detects differences in binding affinity of about 2-fold or greater. BiacoreTM is particularly useful when the starting antibody already binds with a relatively high affinity, for example a K D of about 10 nM or lower. Screening using BiacoreTM surface plasmon resonance is described in the Examples, herein.
- Binding affinity may be determined using Kinexa Biocensor, scintillation proximity assays, ELISA, ORIGEN immunoassay (IGEN), fluorescence quenching, fluorescence transfer, and/or yeast display. Binding affinity may also be screened using a suitable bioassay.
- every amino acid position in a CDR is replaced (in some embodiments, one at a time) with all 20 natural amino acids using art recognized mutagenesis methods (some of which are described herein). This generates small libraries of clones (in some embodiments, one for every amino acid position that is analyzed), each with a complexity of 20 members (if all 20 amino acids are substituted at every position).
- the library to be screened comprises substitutions in two or more positions, which may be in the same CDR or in two or more CDRs.
- the library may comprise substitutions in two or more positions in one CDR.
- the library may comprise substitution in two or more positions in two or more CDRs.
- the library may comprise substitution in 3, 4, 5, or more positions, said positions found in two, three, four, five or six CDRs.
- the substitution may be prepared using low redundancy codons. See, e.g., Table 2 of Balint et al., Gene 137(1 ): 109-18, 1993.
- the CDR may be CDRH3 and/or CDRL3.
- the CDR may be one or more of CDRL1 , CDRL2, CDRL3, CDRH1 , CDRH2, and/or CDRH3.
- the CDR may be a Kabat CDR, a Chothia CDR, or an extended CDR.
- Candidates with improved binding may be sequenced, thereby identifying a CDR substitution mutant which results in improved affinity (also termed an "improved" substitution).
- Candidates that bind may also be sequenced, thereby identifying a CDR substitution which retains binding.
- candidates each comprising an amino acid substitution at one or more position of one or more CDR
- candidate binding are also useful for the design of a second library containing at least the original and substituted amino acid at each improved CDR position (i.e., amino acid position in the CDR at which a substitution mutant showed improved binding).
- Preparation, and screening or selection of this library is discussed further below.
- Library scanning mutagenesis also provides a means for characterizing a CDR, in so far as the frequency of clones with improved binding, the same binding, decreased binding or no binding also provide information relating to the importance of each amino acid position for the stability of the antibody-antigen complex.
- the library scanning mutagenesis methods generate information regarding positions in the CDRs that can be changed to many different amino acids (including all 20 amino acids), and positions in the CDRs which cannot be changed or which can only be changed to a few amino acids.
- Candidates with improved affinity may be combined in a second library, which includes the improved amino acid, the original amino acid at that position, and may further include additional substitutions at that position, depending on the complexity of the library that is desired, or permitted using the desired screening or selection method.
- adjacent amino acid position can be randomized to at least two or more amino acids. Randomization of adjacent amino acids may permit additional conformational flexibility in the mutant CDR, which may in turn, permit or facilitate the introduction of a larger number of improving mutations.
- the library may also comprise substitution at positions that did not show improved affinity in the first round of screening.
- the second library is screened or selected for library members with improved and/or altered binding affinity using any method known in the art, including screening using BiacoreTM surface plasmon resonance analysis, and selection using any method known in the art for selection, including phage display, yeast display, and ribosome display.
- fusion proteins comprising one or more fragments or regions from the antibodies of this invention.
- a fusion polypeptide is provided that comprises at least 10 contiguous amino acids of the variable light chain region shown in SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 29, 31 , 33, 36, 38, 40, 42, 45, 47, 49, 51 , 21 1 , 212, 213, or 215, and/or at least 10 amino acids of the variable heavy chain region shown in SEQ ID NOs: 1 , 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23, 25, 27, 30, 32, 34, 35, 37, 39, 41 , 43, 44, 46, 48, 50, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61 , 202, 203, 204, 205, 206, 207, 208, 209, 210, 214, 216, 217, or 218.
- a fusion polypeptide comprises at least about 10, at least about 15, at least about 20, at least about 25, or at least about 30 contiguous amino acids of the variable light chain region and/or at least about 10, at least about 15, at least about 20, at least about 25, or at least about 30 contiguous amino acids of the variable heavy chain region.
- the fusion polypeptide comprises one or more CDR(s).
- the fusion polypeptide comprises CDR H3 (VH CDR3) and/or CDR L3 (VL CDR3).
- a fusion protein contains one or more antibodies and another amino acid sequence to which it is not attached in the native molecule, for example, a heterologous sequence or a homologous sequence from another region.
- heterologous sequences include, but are not limited to a "tag" such as a FLAG tag or a 6His tag. Tags are well known in the art.
- a fusion polypeptide can be created by methods known in the art, for example, synthetically or recombinantly.
- the fusion proteins of this invention are made by preparing an expressing a polynucleotide encoding them using recombinant methods described herein, although they may also be prepared by other means known in the art, including, for example, chemical synthesis.
- compositions comprising antibodies conjugated (for example, linked) to an agent that facilitate coupling to a solid support (such as biotin or avidin).
- a solid support such as biotin or avidin.
- Conjugation generally refers to linking these components as described herein.
- the linking (which is generally fixing these components in proximate association at least for administration) can be achieved in any number of ways. For example, a direct reaction between an agent and an antibody is possible when each possesses a substituent capable of reacting with the other.
- a nucleophilic group such as an amino or sulfhydryl group
- a carbonyl-containing group such as an anhydride or an acid halide, or with an alkyl group containing a good leaving group (e.g., a halide) on the other.
- the invention also provides isolated polynucleotides encoding the antibodies of the invention, and vectors and host cells comprising the polynucleotide. Accordingly, the invention provides polynucleotides (or compositions, including pharmaceutical compositions), comprising polynucleotides encoding any of the following: m62G7, h62G7, h62G7-H14/L1 -DV, h62G7-EQ/L6, 42G9, 32A10, 20B9, 14C1 1 , 21 E1 1 , 49B1 1 , 46E10, 12H6, 19A9, 21 E7, 1 1 B1 1 , 12B2, 1 1 F10, 17G1 1 , 29D5, 30D8, 20E12, 26B9, 32G8, 34E7, 20G5, C6, B5, 42G9-1 , 32A10-1 , 20B9-1 , 14C1 1 -1 , 21 E1 1 -1 , 49B1 1-1 , 46E10-1
- the invention provides polynucleotides encoding any of the antibodies (including antibody fragments) and polypeptides described herein, such as antibodies and polypeptides having impaired effector function.
- Polynucleotides can be made and expressed by procedures known in the art.
- the invention provides compositions (such as a pharmaceutical compositions) comprising any of the polynucleotides of the invention.
- the composition comprises an expression vector comprising a polynucleotide encoding any of the antibodies described herein.
- the invention provides a method of making any of the polynucleotides described herein.
- Polynucleotides complementary to any such sequences are also encompassed by the present invention.
- Polynucleotides may be single-stranded (coding or antisense) or double-stranded, and may be DNA (genomic, cDNA or synthetic) or RNA molecules.
- RNA molecules include HnRNA molecules, which contain introns and correspond to a DNA molecule in a one-to-one manner, and mRNA molecules, which do not contain introns. Additional coding or non-coding sequences may, but need not, be present within a polynucleotide of the present invention, and a polynucleotide may, but need not, be linked to other molecules and/or support materials.
- Polynucleotides may comprise a native sequence (i.e., an endogenous sequence that encodes an antibody or a portion thereof) or may comprise a variant of such a sequence.
- Polynucleotide variants contain one or more substitutions, additions, deletions and/or insertions such that the immunoreactivity of the encoded polypeptide is not diminished, relative to a native immunoreactive molecule. The effect on the immunoreactivity of the encoded polypeptide may generally be assessed as described herein.
- Variants preferably exhibit at least about 70% identity, more preferably, at least about 80% identity, yet more preferably, at least about 90% identity, and most preferably, at least about 95% identity to a polynucleotide sequence that encodes a native antibody or a portion thereof.
- Two polynucleotide or polypeptide sequences are said to be “identical” if the sequence of nucleotides or amino acids in the two sequences is the same when aligned for maximum correspondence as described below. Comparisons between two sequences are typically performed by comparing the sequences over a comparison window to identify and compare local regions of sequence similarity.
- a “comparison window” as used herein refers to a segment of at least about 20 contiguous positions, usually 30 to about 75, or 40 to about 50, in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- the "percentage of sequence identity” is determined by comparing two optimally aligned sequences over a window of comparison of at least 20 positions, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less, usually 5 to 15 percent, or 10 to 12 percent, as compared to the reference sequences (which does not comprise additions or deletions) for optimal alignment of the two sequences.
- the percentage is calculated by determining the number of positions at which the identical nucleic acid bases or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the reference sequence (i.e. the window size) and multiplying the results by 100 to yield the percentage of sequence identity.
- Variants may also, or alternatively, be substantially homologous to a native gene, or a portion or complement thereof.
- Such polynucleotide variants are capable of hybridizing under moderately stringent conditions to a naturally occurring DNA sequence encoding a native antibody (or a complementary sequence).
- Suitable “moderately stringent conditions” include prewashing in a solution of 5 X SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0); hybridizing at 50°C-65°C, 5 X SSC, overnight; followed by washing twice at 65°C for 20 minutes with each of 2X, 0.5X and 0.2X SSC containing 0.1 % SDS.
- highly stringent conditions or “high stringency conditions” are those that: (1 ) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1 % sodium dodecyl sulfate at 50°C; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1 % bovine serum albumin/0.1 % Ficoll/0.1 % polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42°C; or (3) employ 50% formamide, 5 x SSC (0.75 M NaCI, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1 % sodium pyrophosphate, 5 x Denhardt's solution, sonicated salmon sperm DNA (50 pg/ml), 0.1 % SDS,
- formamide for example
- nucleotide sequences that encode a polypeptide as described herein. Some of these polynucleotides bear minimal homology to the nucleotide sequence of any native gene. Nonetheless, polynucleotides that vary due to differences in codon usage are specifically contemplated by the present invention. Further, alleles of the genes comprising the polynucleotide sequences provided herein are within the scope of the present invention. Alleles are endogenous genes that are altered as a result of one or more mutations, such as deletions, additions and/or substitutions of nucleotides. The resulting mRNA and protein may, but need not, have an altered structure or function. Alleles may be identified using standard techniques (such as hybridization, amplification and/or database sequence comparison).
- polynucleotides of this invention can be obtained using chemical synthesis, recombinant methods, or PCR. Methods of chemical polynucleotide synthesis are well known in the art and need not be described in detail herein. One of skill in the art can use the sequences provided herein and a commercial DNA synthesizer to produce a desired DNA sequence.
- a polynucleotide comprising a desired sequence can be inserted into a suitable vector, and the vector in turn can be introduced into a suitable host cell for replication and amplification, as further discussed herein.
- Polynucleotides may be inserted into host cells by any means known in the art. Cells are transformed by introducing an exogenous polynucleotide by direct uptake, endocytosis, transfection, F-mating or electroporation. Once introduced, the exogenous polynucleotide can be maintained within the cell as a non-integrated vector (such as a plasmid) or integrated into the host cell genome.
- the polynucleotide so amplified can be isolated from the host cell by methods well known within the art. See, e.g., Sambrook et al., 1989.
- PCR allows reproduction of DNA sequences.
- PCR technology is well known in the art and is described in U.S. Patent Nos. 4,683, 195, 4,800,159, 4,754,065 and 4,683,202, as well as PCR: The Polymerase Chain Reaction, Mullis et al. eds., Birkauswer Press, Boston, 1994.
- RNA can be obtained by using the isolated DNA in an appropriate vector and inserting it into a suitable host cell. When the cell replicates and the DNA is transcribed into RNA, the RNA can then be isolated using methods well known to those of skill in the art, as set forth in Sambrook et al., 1989, supra, for example.
- Suitable cloning vectors may be constructed according to standard techniques, or may be selected from a large number of cloning vectors available in the art. While the cloning vector selected may vary according to the host cell intended to be used, useful cloning vectors will generally have the ability to self-replicate, may possess a single target for a particular restriction endonuclease, and/or may carry genes for a marker that can be used in selecting clones containing the vector.
- Suitable examples include plasmids and bacterial viruses, e.g., pUC18, pUC19, Bluescript (e.g., pBS SK+) and its derivatives, mp18, mp19, pBR322, pMB9, ColE1 , pCR1 , RP4, phage DNAs, and shuttle vectors such as pSA3 and pAT28.
- Bluescript e.g., pBS SK+
- shuttle vectors such as pSA3 and pAT28.
- Expression vectors generally are replicable polynucleotide constructs that contain a polynucleotide according to the invention. It is implied that an expression vector must be replicable in the host cells either as episomes or as an integral part of the chromosomal DNA. Suitable expression vectors include but are not limited to plasmids, viral vectors, including adenoviruses, adeno-associated viruses, retroviruses, cosmids, and expression vector(s) disclosed in PCT Publication No. WO 87/04462.
- Vector components may generally include, but are not limited to, one or more of the following: a signal sequence; an origin of replication; one or more marker genes; suitable transcriptional controlling elements (such as promoters, enhancers and terminator). For expression (i.e., translation), one or more translational controlling elements are also usually required, such as ribosome binding sites, translation initiation sites, and stop codons.
- the vectors containing the polynucleotides of interest can be introduced into the host cell by any of a number of appropriate means, including electroporation, transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE- dextran, or other substances; microprojectile bombardment; lipofection; and infection (e.g., where the vector is an infectious agent such as vaccinia virus).
- electroporation employing calcium chloride, rubidium chloride, calcium phosphate, DEAE- dextran, or other substances
- microprojectile bombardment e.g., where the vector is an infectious agent such as vaccinia virus.
- infection e.g., where the vector is an infectious agent such as vaccinia virus.
- the choice of introducing vectors or polynucleotides will often depend on features of the host cell.
- the invention also provides host cells comprising any of the polynucleotides described herein. Any host cells capable of over-expressing heterologous DNAs can be used for the purpose of isolating the genes encoding the antibody, polypeptide or protein of interest.
- mammalian host cells include but not limited to COS, HeLa, and CHO cells. See also PCT Publication No. WO 87/04462.
- Suitable non-mammalian host cells include prokaryotes (such as E. coli or B. subtillis) and yeast (such as S. cerevisae, S. pombe; or K. lactis).
- the host cells express the cDNAs at a level of about 5 fold higher, more preferably, 10 fold higher, even more preferably, 20 fold higher than that of the corresponding endogenous antibody or protein of interest, if present, in the host cells.
- Screening the host cells for a specific binding to EGFRvlll is effected by an immunoassay or FACS.
- a cell overexpressing the antibody or protein of interest can be identified.
- the present invention also provides a conjugate (or immunoconjugate) of the EGFRvlll antibody as described herein, wherein the antibody is conjugated to an agent (e.g., a cytotoxic agent) for targeted immunotherapy (e.g., antibody-drug conjugates) either directly or indirectly via a linker.
- an agent e.g., a cytotoxic agent
- targeted immunotherapy e.g., antibody-drug conjugates
- a cytotoxic agent can be linked or conjugated to the EGFRvlll antibody as described herein for targeted local delivery of the cytotoxic agent moiety to tumors (e.g., EGFRvlll expressing tumor).
- the EGFRvlll antibody or the conjugate as described herein comprises an acyl donor glutamine-containing tag engineered at a specific site of the antibody (e.g., a carboxyl terminus, an amino terminus, or at another site in the EGFRvlll antibody).
- the tag comprises an amino acid glutamine (Q) or an amino acid sequence LQG, LLQGG (SEQ ID NO: 258), LLQG (SEQ ID NO: 259), LSLSQG (SEQ ID NO: 260), GGGLLQGG (SEQ ID NO: 261 ), GLLQG (SEQ ID NO: 262), LLQ, GSPLAQSHGG (SEQ ID NO: 263), GLLQGGG (SEQ ID NO: 264), GLLQGG (SEQ ID NO: 265), GLLQ (SEQ ID NO: 266), LLQLLQGA (SEQ ID NO: 267), LLQGA (SEQ ID NO: 268), LLQYQGA (SEQ ID NO: 269), LLQGSG (SEQ ID NO: 270), LLQYQG (SEQ ID NO: 271 ), LLQLLQG (SEQ ID NO: 272), SLLQG (SEQ ID NO: 273), LLQ
- an isolated antibody comprising an acyl donor glutamine- containing tag and an amino acid modification at position 222, 340, or 370 of the antibody (EU numbering scheme) wherein the modification is an amino acid deletion, insertion, substitution, mutation, or any combination thereof.
- the amino acid modification is a substitution from lysine to arginine (e.g., K222R, K340R, or K370R).
- agents that can be conjugated to the EGFRvlll antibodies of the present invention include, but are not limited to, cytotoxic agents, immunomodulating agents, imaging agents, therapeutic proteins, biopolymers, or oligonucleotides.
- cytotoxic agent examples include, but are not limited to, anthracycline, an auristatin, a dolastatin, a combretastatin, a duocarmycin, a pyrrolobenzodiazepine dimer, an indolino-benzodiazepine dimer, an enediyne, a geldanamycin, a maytansine, a puromycin, a taxane, a vinca alkaloid, a camptothecin, a tubulysin, a hemiasterlin, a spliceostatin, a pladienolide, and stereoisomers, isosteres, analogs, or derivatives thereof.
- the anthracyclines are derived from bacteria Strepomyces and have been used to treat a wide range of cancers, such as leukemias, lymphomas, breast, uterine, ovarian, and lung cancers.
- exemplary anthracyclines include, but are not limited to, daunorubicin, doxorubicin (i.e., adriamycin), epirubicin, idarubicin, valrubicin, and mitoxantrone.
- Dolastatins and their peptidic analogs and derivatives, auristatins are highly potent antimitotic agents that have been shown to have anticancer and antifungal activity. See, e.g., U.S. Pat. No. 5,663,149 and Pettit et al., Antimicrob. Agents
- dolastatins and auristatins include, but are not limited to, dolastatin 10, auristatin E, auristatin EB (AEB), auristatin EFP
- MMAD Monomethyl Auristatin D or monomethyl dolastatin 10
- MMAE Monomethyl Auristatin E or N-methylvaline-valine- dolaisoleuine-dolaproine-norephedrine
- 5-benzoylvaleric acid-AE ester AEVB
- other novel auristatins such as the ones described in U.S. Publication No.
- the auristatin is 0101 (2-methylalanyl-/V- [(3 4S,5S)-3-methoxy-1 - ⁇ (2S)-2-[(1 R,2R) ⁇ -methoxy-2-methyl-3-oxo-3- ⁇ [(1 S)-2- phenyl-1 -(1 ,3-thiazol-2-yl)ethyl]amino ⁇ propyl]pyrrolidin-1 -yl ⁇ -5-methyl-1 -oxoheptan-4-yl]- /V-methyl-L-valinamide) having the following structure:
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Animal Behavior & Ethology (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Oncology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Hematology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES17700749T ES2904593T3 (es) | 2016-01-21 | 2017-01-10 | Anticuerpos monoespecíficos y biespecíficos para la variante III del receptor del factor de crecimiento epidérmico y CD3 y sus usos |
| JP2018538177A JP2019506398A (ja) | 2016-01-21 | 2017-01-10 | 上皮増殖因子受容体変異体iiiおよびcd3の単一および二重特異性抗体およびそれらの使用 |
| EP17700749.9A EP3405490B1 (en) | 2016-01-21 | 2017-01-10 | Mono and bispecific antibodies for epidermal growth factor receptor variant iii and cd3 and their uses |
| DK17700749.9T DK3405490T3 (da) | 2016-01-21 | 2017-01-10 | Mono- og bispecifikke antistoffer mod epidermal vækstfaktorreceptor variant iii og cd3 og anvendelser deraf |
| CN201780015091.8A CN109219618B (zh) | 2016-01-21 | 2017-01-10 | 针对表皮生长因子受体变体iii和cd3的单特异性和双特异性抗体及其用途 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662281543P | 2016-01-21 | 2016-01-21 | |
| US62/281,543 | 2016-01-21 | ||
| US201662431766P | 2016-12-08 | 2016-12-08 | |
| US62/431,766 | 2016-12-08 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017125831A1 true WO2017125831A1 (en) | 2017-07-27 |
Family
ID=57838442
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2017/050109 Ceased WO2017125831A1 (en) | 2016-01-21 | 2017-01-10 | Mono and bispecific antibodies for epidermal growth factor receptor variant iii and cd3 and their uses |
Country Status (9)
| Country | Link |
|---|---|
| US (2) | US10221242B2 (https=) |
| EP (1) | EP3405490B1 (https=) |
| JP (2) | JP2019506398A (https=) |
| CN (1) | CN109219618B (https=) |
| CA (1) | CA2954802C (https=) |
| DK (1) | DK3405490T3 (https=) |
| ES (1) | ES2904593T3 (https=) |
| TW (2) | TWI657096B (https=) |
| WO (1) | WO2017125831A1 (https=) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109265561A (zh) * | 2018-09-25 | 2019-01-25 | 山东兴瑞生物科技有限公司 | 抗EGFRvⅢ安全型嵌合抗原受体、其制备方法、利用其修饰的NK细胞及应用 |
| WO2019152705A1 (en) * | 2018-02-01 | 2019-08-08 | Pfizer Inc. | Antibodies specific for cd70 and their uses |
| CN111936516A (zh) * | 2018-03-19 | 2020-11-13 | 上海药明生物技术有限公司 | 新型抗egfr抗体多肽 |
| WO2022074206A1 (en) | 2020-10-08 | 2022-04-14 | Affimed Gmbh | Trispecific binders |
| JP2022530301A (ja) * | 2019-02-22 | 2022-06-29 | 武▲漢▼友芝友生物制▲薬▼有限公司 | Cd3抗原結合性断片及びその使用 |
| US11396551B2 (en) | 2018-02-01 | 2022-07-26 | Pfizer Inc. | Chimeric antigen receptors targeting CD70 |
| WO2023007023A1 (en) | 2021-07-30 | 2023-02-02 | Affimed Gmbh | Duplexbodies |
| WO2023078968A1 (en) | 2021-11-03 | 2023-05-11 | Affimed Gmbh | Bispecific cd16a binders |
| US12460002B2 (en) | 2019-03-29 | 2025-11-04 | Merus N.V. | CD3 binding molecules |
| WO2025257588A1 (en) | 2024-06-10 | 2025-12-18 | Affimed Gmbh | Cd16a/tumor antigen polyspecific binder for use in the treatment of immune checkpoint inhibitor resistance |
Families Citing this family (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| UA117466C2 (uk) | 2012-12-13 | 2018-08-10 | Мерк Шарп Енд Доме Корп. | СТАБІЛЬНИЙ СКЛАД У ВИГЛЯДІ РОЗЧИНУ АНТИТІЛА ДО IL-23p19 |
| CN109219618B (zh) | 2016-01-21 | 2022-08-09 | 辉瑞大药厂 | 针对表皮生长因子受体变体iii和cd3的单特异性和双特异性抗体及其用途 |
| TWI755547B (zh) | 2016-01-21 | 2022-02-21 | 美商輝瑞股份有限公司 | 靶向表皮生長因子受體變異體iii之嵌合型抗原受體 |
| WO2018119142A1 (en) | 2016-12-21 | 2018-06-28 | Amgen Inc. | Anti-tnf alpha antibody formulations |
| JOP20190260A1 (ar) | 2017-05-02 | 2019-10-31 | Merck Sharp & Dohme | صيغ ثابتة لأجسام مضادة لمستقبل الموت المبرمج 1 (pd-1) وطرق استخدامها |
| JP7382232B2 (ja) | 2017-05-02 | 2023-11-16 | メルク・シャープ・アンド・ドーム・エルエルシー | 抗lag3抗体の製剤および抗lag3抗体と抗pd-1抗体との共製剤 |
| EP3753952A4 (en) * | 2017-12-13 | 2022-04-13 | XDCExplorer (Shanghai) Co., Ltd. | EGFRVIII ANTIBODY AND CONJUGATE, AND METHODS FOR ITS PRODUCTION AND USE |
| MX2020012607A (es) * | 2018-05-23 | 2021-01-29 | Pfizer | Anticuerpos especificos para gucy2c y sus usos. |
| CN119405832A (zh) | 2018-06-01 | 2025-02-11 | 卫材R&D管理有限公司 | 剪接调节抗体-药物缀合物及其使用方法 |
| US12331320B2 (en) | 2018-10-10 | 2025-06-17 | The Research Foundation For The State University Of New York | Genome edited cancer cell vaccines |
| WO2020081408A1 (en) | 2018-10-18 | 2020-04-23 | Merck Sharp & Dohme Corp. | Formulations of anti-rsv antibodies and methods of use thereof |
| MX2021004928A (es) | 2018-10-31 | 2021-06-08 | Merck Sharp & Dohme Llc | Cristales de anticuerpo anti-pd-1 humano y metodos de uso de los mismos. |
| EP3876990A4 (en) | 2018-11-07 | 2023-09-06 | Merck Sharp & Dohme LLC | CO-FORMULATIONS OF ANTI-LAG3 ANTIBODIES AND ANTI-PD-1 ANTIBODIES |
| EP3897719A4 (en) * | 2018-12-21 | 2022-11-02 | Zhejiang Shimai Pharmaceutical Co., Ltd. | Protease cleavable bispecific antibodies and uses thereof |
| JP7638989B2 (ja) | 2019-11-21 | 2025-03-04 | ユニティ バイオテクノロジー インコーポレイテッド | Tie-2に対する抗体および使用方法 |
| CN111072772B (zh) * | 2019-12-31 | 2023-08-04 | 上海良润生物医药科技有限公司 | 一种肽标签及其在检测或纯化融合蛋白质的应用 |
| AU2021246485A1 (en) * | 2020-04-01 | 2022-11-17 | The Regents Of The University Of California | Immunotheranostic agent targeting mesenchymal stem cell-derived cancer cells and mesenchymal stem cell associated disease |
| CN112661844B (zh) * | 2020-11-18 | 2022-05-03 | 贵州医科大学 | 一种靶向EGFRvIII的单链抗体及应用 |
| CN114539418A (zh) * | 2020-11-26 | 2022-05-27 | 上海华奥泰生物药业股份有限公司 | 双特异性抗体及其用途 |
| US20250121002A1 (en) * | 2021-07-16 | 2025-04-17 | Noile-Immune Biotech Inc. | ANTI-EGFRviii ANTIBODY, POLYPEPTIDE, CELL CAPABLE OF EXPRESSING SAID POLYPEPTIDE, PHARMACEUTICAL COMPOSITION COMPRISING SAID CELL, METHOD FOR PRODUCING SAID CELL, AND POLYNUCLEOTIDE OR VECTOR COMPRISING NUCLEOTIDE SEQUENCE ENCODING SAID POLYPEPTIDE |
| WO2023052816A1 (en) * | 2021-09-29 | 2023-04-06 | National Research Council Of Canada | Humanized anti-egfrviii antibodies and antigen-binding fragments thereof |
| CN116333117B (zh) * | 2021-12-16 | 2024-04-26 | 徕特康(苏州)生物制药有限公司 | 抗表皮生长因子受体抗体及其制备方法和用途 |
| CN116047081B (zh) * | 2023-01-10 | 2024-02-13 | 北京新源长青生物科技有限公司 | 检测Aβ40、Aβ42的试剂盒与方法 |
| WO2025149667A1 (en) | 2024-01-12 | 2025-07-17 | Pheon Therapeutics Ltd | Antibody drug conjugates and uses thereof |
Citations (84)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0003089A1 (fr) | 1978-01-06 | 1979-07-25 | Bernard David | Séchoir pour feuilles imprimées par sérigraphie |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4754065A (en) | 1984-12-18 | 1988-06-28 | Cetus Corporation | Precursor to nucleic acid probe |
| GB2200651A (en) | 1987-02-07 | 1988-08-10 | Al Sumidaie Ayad Mohamed Khala | A method of obtaining a retrovirus-containing fraction from retrovirus-containing cells |
| US4777127A (en) | 1985-09-30 | 1988-10-11 | Labsystems Oy | Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus |
| US4800159A (en) | 1986-02-07 | 1989-01-24 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0345242A2 (fr) | 1988-06-03 | 1989-12-06 | Smithkline Biologicals S.A. | Expression de protéines gag de rétrovirus dans les cellules eucaryotes |
| WO1990007936A1 (en) | 1989-01-23 | 1990-07-26 | Chiron Corporation | Recombinant therapies for infection and hyperproliferative disorders |
| WO1990011092A1 (en) | 1989-03-21 | 1990-10-04 | Vical, Inc. | Expression of exogenous polynucleotide sequences in a vertebrate |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| WO1991002805A2 (en) | 1989-08-18 | 1991-03-07 | Viagene, Inc. | Recombinant retroviruses delivering vector constructs to target cells |
| US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
| WO1991014445A1 (en) | 1990-03-21 | 1991-10-03 | Research Development Foundation | Heterovesicular liposomes |
| WO1992000373A1 (en) | 1990-06-29 | 1992-01-09 | Biosource Genetics Corporation | Melanin production by transformed microorganisms |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1993003769A1 (en) | 1991-08-20 | 1993-03-04 | THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES | Adenovirus mediated transfer of genes to the gastrointestinal tract |
| WO1993006213A1 (en) | 1991-09-23 | 1993-04-01 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1993010218A1 (en) | 1991-11-14 | 1993-05-27 | The United States Government As Represented By The Secretary Of The Department Of Health And Human Services | Vectors including foreign genes and negative selective markers |
| WO1993011230A1 (en) | 1991-12-02 | 1993-06-10 | Dynal As | Modified mammalian stem cell blocking viral replication |
| US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
| WO1993019191A1 (fr) | 1992-03-16 | 1993-09-30 | Centre National De La Recherche Scientifique | Adenovirus recombinants defectifs exprimant des cytokines pour traitement antitumoral |
| WO1993025234A1 (en) | 1992-06-08 | 1993-12-23 | The Regents Of The University Of California | Methods and compositions for targeting specific tissue |
| WO1993025698A1 (en) | 1992-06-10 | 1993-12-23 | The United States Government As Represented By The | Vector particles resistant to inactivation by human serum |
| US5278299A (en) | 1991-03-18 | 1994-01-11 | Scripps Clinic And Research Foundation | Method and composition for synthesizing sialylated glycosyl compounds |
| WO1994003622A1 (en) | 1992-07-31 | 1994-02-17 | Imperial College Of Science, Technology & Medicine | D-type retroviral vectors, based on mpmv |
| WO1994004690A1 (en) | 1992-08-17 | 1994-03-03 | Genentech, Inc. | Bispecific immunoadhesins |
| WO1994012649A2 (en) | 1992-12-03 | 1994-06-09 | Genzyme Corporation | Gene therapy for cystic fibrosis |
| WO1994023697A1 (en) | 1993-04-22 | 1994-10-27 | Depotech Corporation | Cyclodextrin liposomes encapsulating pharmacologic compounds and methods for their use |
| WO1994028938A1 (en) | 1993-06-07 | 1994-12-22 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy sponsorship |
| WO1995000655A1 (en) | 1993-06-24 | 1995-01-05 | Mc Master University | Adenovirus vectors for gene therapy |
| WO1995007994A2 (en) | 1993-09-15 | 1995-03-23 | Viagene, Inc. | Recombinant alphavirus vectors |
| WO1995011984A2 (en) | 1993-10-25 | 1995-05-04 | Canji, Inc. | Recombinant adenoviral vector and methods of use |
| WO1995013796A1 (en) | 1993-11-16 | 1995-05-26 | Depotech Corporation | Vesicles with controlled release of actives |
| US5422120A (en) | 1988-05-30 | 1995-06-06 | Depotech Corporation | Heterovesicular liposomes |
| WO1995030763A2 (en) | 1994-05-09 | 1995-11-16 | Chiron Viagene, Inc. | Retroviral vectors having a reduced recombination rate |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5510261A (en) | 1991-11-21 | 1996-04-23 | The Board Of Trustees Of The Leland Stanford Juniot University | Method of controlling the degradation of glycoprotein oligosaccharides produced by cultured Chinese hamster ovary cells |
| WO1996017072A2 (en) | 1994-11-30 | 1996-06-06 | Chiron Viagene, Inc. | Recombinant alphavirus vectors |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5580859A (en) | 1989-03-21 | 1996-12-03 | Vical Incorporated | Delivery of exogenous DNA sequences in a mammal |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| WO1997042338A1 (en) | 1996-05-06 | 1997-11-13 | Chiron Corporation | Crossless retroviral vectors |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5814482A (en) | 1993-09-15 | 1998-09-29 | Dubensky, Jr.; Thomas W. | Eukaryotic layered vector initiation systems |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5866692A (en) | 1991-09-18 | 1999-02-02 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing humanized chimera antibody |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| US5997867A (en) | 1991-07-16 | 1999-12-07 | Waldmann; Herman | Method of using humanized antibody against CD18 |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US6180377B1 (en) | 1993-06-16 | 2001-01-30 | Celltech Therapeutics Limited | Humanized antibodies |
| US6210671B1 (en) | 1992-12-01 | 2001-04-03 | Protein Design Labs, Inc. | Humanized antibodies reactive with L-selectin |
| WO2001027160A1 (en) | 1999-10-14 | 2001-04-19 | Applied Molecular Evolution, Inc. | Methods of optimizing antibody variable region binding affinity |
| US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
| US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
| US6376471B1 (en) | 1997-10-10 | 2002-04-23 | Johns Hopkins University | Gene delivery compositions and methods |
| US6413942B1 (en) | 1989-03-21 | 2002-07-02 | Vical, Inc. | Methods of delivering a physiologically active polypeptide to a mammal |
| US6436908B1 (en) | 1995-05-30 | 2002-08-20 | Duke University | Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2004058184A2 (en) | 2002-12-24 | 2004-07-15 | Rinat Neuroscience Corp. | Anti-ngf antibodies and methods using same |
| US7314622B2 (en) | 2005-04-15 | 2008-01-01 | Neogenix Oncology, Inc. | Recombinant monoclonal antibodies and corresponding antigens for colon and pancreatic cancers |
| WO2011143545A1 (en) | 2010-05-14 | 2011-11-17 | Rinat Neuroscience Corporation | Heterodimeric proteins and methods for producing and purifying them |
| WO2012059882A2 (en) | 2010-11-05 | 2012-05-10 | Rinat Neuroscience Corporation | Engineered polypeptide conjugates and methods for making thereof using transglutaminase |
| US20120189630A1 (en) * | 2010-12-03 | 2012-07-26 | Duke University | BISPECIFIC EGFRvIII ANTIBODY ENGAGING MOLECULES |
| US20130129753A1 (en) | 2011-11-17 | 2013-05-23 | Pfizer Inc. | Cytotoxic peptides and antibody drug conjugates thereof |
| WO2013185010A1 (en) * | 2012-06-07 | 2013-12-12 | Duke University | HUMAN BISPECIFIC EGFRvIII ANTIBODY ENGAGING MOLECULES |
| WO2014153002A1 (en) * | 2013-03-14 | 2014-09-25 | The California Institute For Biomedical Research | Bispecific antibodies and uses thereof |
| WO2015006482A1 (en) * | 2013-07-09 | 2015-01-15 | Duke University | CERTAIN IMPROVED HUMAN BISPECIFIC EGFRvIII ANTIBODY ENGAGING MOLECULES |
| WO2015015448A2 (en) | 2013-07-31 | 2015-02-05 | Rinat Neuroscience Corp. | Engineered polypeptide conjugates |
| US20160297885A1 (en) | 2015-04-13 | 2016-10-13 | Pfizer Inc. | Therapeutic antibodies and their uses |
| WO2017021370A1 (en) * | 2015-07-31 | 2017-02-09 | Amgen Research (Munich) Gmbh | Bispecific antibody constructs binding egfrviii and cd3 |
Family Cites Families (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU687010B2 (en) | 1992-07-17 | 1998-02-19 | Dana-Farber Cancer Institute | Method of intracellular binding of target molecules |
| KR20130065723A (ko) * | 2003-06-27 | 2013-06-19 | 암젠 프레몬트 인코포레이티드 | 상피 성장 인자 수용체의 결실 돌연변이체 지향 항체 및 그 용도 |
| RU2429014C2 (ru) * | 2006-03-31 | 2011-09-20 | Массачусетс Инститьют Оф Текнолоджи | Лечение опухолей, экспрессирующих мутантные рецепторы egf |
| WO2008045437A2 (en) | 2006-10-09 | 2008-04-17 | The General Hospital Corporation | Chimeric t-cell receptors and t-cells targeting egfrviii on tumors |
| PH12013501201A1 (en) | 2010-12-09 | 2013-07-29 | Univ Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
| CA2832540C (en) | 2011-04-08 | 2020-09-15 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer |
| PE20141937A1 (es) * | 2011-11-16 | 2014-12-18 | Amgen Inc | Metodos para tratar trastornos relacionados con mutante viii de eliminacion de factor de crecimiento epidermico |
| JP2015524255A (ja) | 2012-07-13 | 2015-08-24 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | 二重特異性抗体を共導入することによってcart細胞の活性を強化する方法 |
| MX367730B (es) | 2012-09-04 | 2019-09-04 | Cellectis | Receptor de antigeno quimerico multi-cadena y usos del mismo. |
| JP6647868B2 (ja) | 2013-02-20 | 2020-02-14 | ノバルティス アーゲー | ヒト化抗EGFRvIIIキメラ抗原受容体を用いたがんの処置 |
| LT3030581T (lt) | 2013-08-07 | 2021-05-25 | Affimed Gmbh | Antikūno surišimo vietos specifiškos egfrviii |
| WO2015092024A2 (en) | 2013-12-20 | 2015-06-25 | Cellectis | Method of engineering multi-input signal sensitive t cell for immunotherapy |
| WO2016016341A1 (en) | 2014-07-29 | 2016-02-04 | Cellectis | EGFRvIII SPECIFIC CHIMERIC ANTIGEN RECEPTORS FOR CANCER IMMUNOTHERAPY |
| CN109219618B (zh) | 2016-01-21 | 2022-08-09 | 辉瑞大药厂 | 针对表皮生长因子受体变体iii和cd3的单特异性和双特异性抗体及其用途 |
| TWI755547B (zh) | 2016-01-21 | 2022-02-21 | 美商輝瑞股份有限公司 | 靶向表皮生長因子受體變異體iii之嵌合型抗原受體 |
-
2017
- 2017-01-10 CN CN201780015091.8A patent/CN109219618B/zh active Active
- 2017-01-10 TW TW106100739A patent/TWI657096B/zh not_active IP Right Cessation
- 2017-01-10 TW TW108104245A patent/TW201936640A/zh unknown
- 2017-01-10 ES ES17700749T patent/ES2904593T3/es active Active
- 2017-01-10 JP JP2018538177A patent/JP2019506398A/ja active Pending
- 2017-01-10 EP EP17700749.9A patent/EP3405490B1/en active Active
- 2017-01-10 DK DK17700749.9T patent/DK3405490T3/da active
- 2017-01-10 US US15/402,807 patent/US10221242B2/en active Active
- 2017-01-10 WO PCT/IB2017/050109 patent/WO2017125831A1/en not_active Ceased
- 2017-01-12 CA CA2954802A patent/CA2954802C/en active Active
-
2018
- 2018-10-17 US US16/163,243 patent/US11279764B2/en not_active Expired - Fee Related
-
2021
- 2021-06-04 JP JP2021094240A patent/JP7222024B2/ja active Active
Patent Citations (93)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0003089A1 (fr) | 1978-01-06 | 1979-07-25 | Bernard David | Séchoir pour feuilles imprimées par sérigraphie |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US6331415B1 (en) | 1983-04-08 | 2001-12-18 | Genentech, Inc. | Methods of producing immunoglobulins, vectors and transformed host cells for use therein |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US4754065A (en) | 1984-12-18 | 1988-06-28 | Cetus Corporation | Precursor to nucleic acid probe |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4683202B1 (https=) | 1985-03-28 | 1990-11-27 | Cetus Corp | |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4777127A (en) | 1985-09-30 | 1988-10-11 | Labsystems Oy | Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4683195B1 (https=) | 1986-01-30 | 1990-11-27 | Cetus Corp | |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4800159A (en) | 1986-02-07 | 1989-01-24 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| GB2200651A (en) | 1987-02-07 | 1988-08-10 | Al Sumidaie Ayad Mohamed Khala | A method of obtaining a retrovirus-containing fraction from retrovirus-containing cells |
| US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
| US5422120A (en) | 1988-05-30 | 1995-06-06 | Depotech Corporation | Heterovesicular liposomes |
| EP0345242A2 (fr) | 1988-06-03 | 1989-12-06 | Smithkline Biologicals S.A. | Expression de protéines gag de rétrovirus dans les cellules eucaryotes |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| WO1990007936A1 (en) | 1989-01-23 | 1990-07-26 | Chiron Corporation | Recombinant therapies for infection and hyperproliferative disorders |
| WO1990011092A1 (en) | 1989-03-21 | 1990-10-04 | Vical, Inc. | Expression of exogenous polynucleotide sequences in a vertebrate |
| US6413942B1 (en) | 1989-03-21 | 2002-07-02 | Vical, Inc. | Methods of delivering a physiologically active polypeptide to a mammal |
| US5580859A (en) | 1989-03-21 | 1996-12-03 | Vical Incorporated | Delivery of exogenous DNA sequences in a mammal |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| WO1991002805A2 (en) | 1989-08-18 | 1991-03-07 | Viagene, Inc. | Recombinant retroviruses delivering vector constructs to target cells |
| EP0524968A1 (en) | 1990-03-21 | 1993-02-03 | Res Dev Foundation | HETEROVESICULAR LIPOSOMES. |
| WO1991014445A1 (en) | 1990-03-21 | 1991-10-03 | Research Development Foundation | Heterovesicular liposomes |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992000373A1 (en) | 1990-06-29 | 1992-01-09 | Biosource Genetics Corporation | Melanin production by transformed microorganisms |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5278299A (en) | 1991-03-18 | 1994-01-11 | Scripps Clinic And Research Foundation | Method and composition for synthesizing sialylated glycosyl compounds |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5997867A (en) | 1991-07-16 | 1999-12-07 | Waldmann; Herman | Method of using humanized antibody against CD18 |
| WO1993003769A1 (en) | 1991-08-20 | 1993-03-04 | THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES | Adenovirus mediated transfer of genes to the gastrointestinal tract |
| US5866692A (en) | 1991-09-18 | 1999-02-02 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing humanized chimera antibody |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1993006213A1 (en) | 1991-09-23 | 1993-04-01 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1993010218A1 (en) | 1991-11-14 | 1993-05-27 | The United States Government As Represented By The Secretary Of The Department Of Health And Human Services | Vectors including foreign genes and negative selective markers |
| US5510261A (en) | 1991-11-21 | 1996-04-23 | The Board Of Trustees Of The Leland Stanford Juniot University | Method of controlling the degradation of glycoprotein oligosaccharides produced by cultured Chinese hamster ovary cells |
| WO1993011230A1 (en) | 1991-12-02 | 1993-06-10 | Dynal As | Modified mammalian stem cell blocking viral replication |
| US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
| WO1993019191A1 (fr) | 1992-03-16 | 1993-09-30 | Centre National De La Recherche Scientifique | Adenovirus recombinants defectifs exprimant des cytokines pour traitement antitumoral |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1993025234A1 (en) | 1992-06-08 | 1993-12-23 | The Regents Of The University Of California | Methods and compositions for targeting specific tissue |
| WO1993025698A1 (en) | 1992-06-10 | 1993-12-23 | The United States Government As Represented By The | Vector particles resistant to inactivation by human serum |
| WO1994003622A1 (en) | 1992-07-31 | 1994-02-17 | Imperial College Of Science, Technology & Medicine | D-type retroviral vectors, based on mpmv |
| WO1994004690A1 (en) | 1992-08-17 | 1994-03-03 | Genentech, Inc. | Bispecific immunoadhesins |
| US6210671B1 (en) | 1992-12-01 | 2001-04-03 | Protein Design Labs, Inc. | Humanized antibodies reactive with L-selectin |
| WO1994012649A2 (en) | 1992-12-03 | 1994-06-09 | Genzyme Corporation | Gene therapy for cystic fibrosis |
| WO1994023697A1 (en) | 1993-04-22 | 1994-10-27 | Depotech Corporation | Cyclodextrin liposomes encapsulating pharmacologic compounds and methods for their use |
| WO1994028938A1 (en) | 1993-06-07 | 1994-12-22 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy sponsorship |
| US6180377B1 (en) | 1993-06-16 | 2001-01-30 | Celltech Therapeutics Limited | Humanized antibodies |
| WO1995000655A1 (en) | 1993-06-24 | 1995-01-05 | Mc Master University | Adenovirus vectors for gene therapy |
| WO1995007994A2 (en) | 1993-09-15 | 1995-03-23 | Viagene, Inc. | Recombinant alphavirus vectors |
| US5814482A (en) | 1993-09-15 | 1998-09-29 | Dubensky, Jr.; Thomas W. | Eukaryotic layered vector initiation systems |
| WO1995011984A2 (en) | 1993-10-25 | 1995-05-04 | Canji, Inc. | Recombinant adenoviral vector and methods of use |
| WO1995013796A1 (en) | 1993-11-16 | 1995-05-26 | Depotech Corporation | Vesicles with controlled release of actives |
| WO1995030763A2 (en) | 1994-05-09 | 1995-11-16 | Chiron Viagene, Inc. | Retroviral vectors having a reduced recombination rate |
| WO1996017072A2 (en) | 1994-11-30 | 1996-06-06 | Chiron Viagene, Inc. | Recombinant alphavirus vectors |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US6436908B1 (en) | 1995-05-30 | 2002-08-20 | Duke University | Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function |
| US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
| WO1997042338A1 (en) | 1996-05-06 | 1997-11-13 | Chiron Corporation | Crossless retroviral vectors |
| US6376471B1 (en) | 1997-10-10 | 2002-04-23 | Johns Hopkins University | Gene delivery compositions and methods |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2001027160A1 (en) | 1999-10-14 | 2001-04-19 | Applied Molecular Evolution, Inc. | Methods of optimizing antibody variable region binding affinity |
| WO2004058184A2 (en) | 2002-12-24 | 2004-07-15 | Rinat Neuroscience Corp. | Anti-ngf antibodies and methods using same |
| US7314622B2 (en) | 2005-04-15 | 2008-01-01 | Neogenix Oncology, Inc. | Recombinant monoclonal antibodies and corresponding antigens for colon and pancreatic cancers |
| US20130115208A1 (en) | 2010-05-14 | 2013-05-09 | Rinat Neuroscience Corp. | Heterodimeric proteins and methods for producing and purifying them |
| WO2011143545A1 (en) | 2010-05-14 | 2011-11-17 | Rinat Neuroscience Corporation | Heterodimeric proteins and methods for producing and purifying them |
| WO2012059882A2 (en) | 2010-11-05 | 2012-05-10 | Rinat Neuroscience Corporation | Engineered polypeptide conjugates and methods for making thereof using transglutaminase |
| US20120189630A1 (en) * | 2010-12-03 | 2012-07-26 | Duke University | BISPECIFIC EGFRvIII ANTIBODY ENGAGING MOLECULES |
| US20130129753A1 (en) | 2011-11-17 | 2013-05-23 | Pfizer Inc. | Cytotoxic peptides and antibody drug conjugates thereof |
| WO2013185010A1 (en) * | 2012-06-07 | 2013-12-12 | Duke University | HUMAN BISPECIFIC EGFRvIII ANTIBODY ENGAGING MOLECULES |
| WO2014153002A1 (en) * | 2013-03-14 | 2014-09-25 | The California Institute For Biomedical Research | Bispecific antibodies and uses thereof |
| WO2015006482A1 (en) * | 2013-07-09 | 2015-01-15 | Duke University | CERTAIN IMPROVED HUMAN BISPECIFIC EGFRvIII ANTIBODY ENGAGING MOLECULES |
| WO2015015448A2 (en) | 2013-07-31 | 2015-02-05 | Rinat Neuroscience Corp. | Engineered polypeptide conjugates |
| US20160297885A1 (en) | 2015-04-13 | 2016-10-13 | Pfizer Inc. | Therapeutic antibodies and their uses |
| WO2017021370A1 (en) * | 2015-07-31 | 2017-02-09 | Amgen Research (Munich) Gmbh | Bispecific antibody constructs binding egfrviii and cd3 |
Non-Patent Citations (129)
| Title |
|---|
| "Methods in Enzymology", ACADEMIC PRESS, INC |
| "Methods in Molecular Biology", HUMANA PRESS |
| "Remington, The Science and Practice of Pharmacy, 21st ed.", 2005, MACK PUBLISHING |
| "Remington's Pharmaceutical Sciences, 19th ed.", 1995, MACK PUBLISHING COMPANY |
| "Short Protocols in Molecular Biology", 1999, WILEY AND SONS |
| A. DOYLE, J.B. GRIFFITHS, AND D.G. NEWELL: "Cell and Tissue Culture: Laboratory Procedures", 1993, J. WILEY AND SONS |
| A. GENNARO: "Remington's Pharmaceutical Sciences, 18th ed.", 1990, MACK PUBLISHING CO. |
| AALBERSE ET AL., IMMUNOLOGY, vol. 105, 2002, pages 9 - 19 |
| AL-LAZIKANI ET AL., J. MOLEC. BIOL., vol. 273, 1997, pages 927 - 948 |
| ARMOUR ET AL., MOLECULAR IMMUNOLOGY, vol. 40, 2003, pages 585 - 593 |
| B. D. CHOI ET AL: "Systemic administration of a bispecific antibody targeting EGFRvIII successfully treats intracerebral glioma", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 110, no. 1, 17 December 2012 (2012-12-17), pages 270 - 275, XP055156305, ISSN: 0027-8424, DOI: 10.1073/pnas.1219817110 * |
| BALINT ET AL., GENE, vol. 137, no. 1, 1993, pages 109 - 18 |
| BARBAS ET AL., PROC NAT. ACAD. SCI, USA, vol. 91, 1994, pages 3809 - 3813 |
| BLOOM ET AL., PROTEIN SCIENCE, vol. 6, 1997, pages 407 - 415 |
| BOERNER ET AL., J. IMMUNOL., vol. 147, no. 1, 1991, pages 86 - 95 |
| BOGER; JOHNSON, PNAS, vol. 92, 1995, pages 3642 - 3649 |
| BOYD ET AL., MOL. IMMUNOL., vol. 32, 1996, pages 1311 - 1318 |
| BROWN ET AL., CANCER RES., vol. 47, 1987, pages 3577 - 3583 |
| BRYAN D. CHOI ET AL: "A novel bispecific antibody recruits T cells to eradicate tumors in the "immunologically privileged" central nervous system", ONCOIMMUNOLOGY, vol. 2, no. 4, 27 April 2013 (2013-04-27), pages e23639, XP055306563, ISSN: 2162-4011, DOI: 10.4161/onci.23639 * |
| BUCK, D. W. ET AL., VITRO, vol. 18, 1982, pages 377 - 381 |
| C.A. JANEWAY; P. TRAVERS, IMMUNOBIOLOGY, 1997 |
| CAPEL ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34 |
| CHAN-JUAN SHEN ET AL: "Chimeric antigen receptor containing ICOS signaling domain mediates specific and efficient antitumor effect of T cells against EGFRvIII expressing glioma", JOURNAL OF HEMATOLOGY & ONCOLOGY, BIOMED CENTRAL LTD, LONDON UK, vol. 6, no. 1, 9 May 2013 (2013-05-09), pages 33, XP021151586, ISSN: 1756-8722, DOI: 10.1186/1756-8722-6-33 * |
| CHIOU ET AL.: "Gene Therapeutics: Methods And Applications Of Direct Gene Transfer", 1994 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CLYNES ET AL., PNAS (USA), vol. 95, 1998, pages 652 - 656 |
| COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77 |
| CONNELLY, HUMAN GENE THERAPY, vol. 1, 1995, pages 185 |
| CURIEL, HUM. GENE THER., vol. 3, 1992, pages 147 |
| D. CATTY: "Antibodies: a practical approach", 1988, IRL PRESS |
| D.M. WEIR AND C.C. BLACKWELL: "Handbook of Experimental Immunology", . |
| DAUGHERTY ET AL., NUCL. ACIDS RES., vol. 19, 1991, pages 2471 - 2476 |
| DAYHOFF, M.O.: "Atlas of Protein Sequence and Structure", vol. 5, 1978, NATIONAL BIOMEDICAL RESEARCH FOUNDATION, article DAYHOFF, M.O.: "A model of evolutionary change in proteins - Matrices for detecting distant relationships", pages: 345 - 358 |
| DE HAAS ET AL., J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41 |
| E. HARLOW; D. LANE: "Using antibodies: a laboratory manual", 1999, COLD SPRING HARBOR LABORATORY PRESS |
| EUR. J. IMMUNOL., vol. 29, 1999, pages 2613 - 2624 |
| F.M. AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1987 |
| FELLOUSE, F.A. ET AL., J. MOL. BIOL., vol. 373, no. 4, 2007, pages 924 - 40 |
| FINDEIS ET AL., TRENDS BIOTECHNOL., vol. 11, 1993, pages 202 |
| GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163 |
| GENTLE ET AL., BIOCONJUGATE CHEM., vol. 15, 2004, pages 658 - 663 |
| GRIFFITH ET AL., EMBO J., vol. 12, 1993, pages 725 - 734 |
| GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587 |
| HARLOW; LANE: "Using Antibodies, a Laboratory Manual", 1999, COLD SPRING HARBOR LABORATORY PRESS, article "chapter 11" |
| HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896 |
| HEIN J.: "Methods in Enzymology", vol. 183, 1990, ACADEMIC PRESS, INC., article "Unified Approach to Alignment and Phylogenes", pages: 626 - 645 |
| HIGGINS, D.G.; SHARP, P.M., CABIOS, vol. 5, 1989, pages 151 - 153 |
| HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1991, pages 381 |
| HSE ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 9062 - 9070 |
| HUMPHREYS ET AL., J. IMMUNOL. METHODS, vol. 209, 1997, pages 193 - 202 |
| IAN M ZITRON ET AL: "Targeting and killing of glioblastoma with activated T cells armed with bispecific antibodies", BMC CANCER, BIOMED CENTRAL, LONDON, GB, vol. 13, no. 1, 22 February 2013 (2013-02-22), pages 83, XP021141258, ISSN: 1471-2407, DOI: 10.1186/1471-2407-13-83 * |
| J MOL BIOL, vol. 3, 2012, pages 204 - 219 |
| J.E. CELLIS: "Cell Biology: A Laboratory Notebook", 1998, ACADEMIC PRESS |
| J.E. COLIGAN ET AL.: "Current Protocols in Immunology", 1991 |
| J.M. MILLER AND M.P. CALOS: "Gene Transfer Vectors for Mammalian Cells", 1987 |
| J.P. MATHER; P.E. ROBERTS: "Introduction to Cell and Tissue Culture", 1998, PLENUM PRESS |
| JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 9 |
| JANEWAY ET AL.: "ImmunoBiology: the immune system in health and disease, 4th ed.", 1999, ELSEVIER SCIENCE LTD. |
| JAYASENA, S.D., CLIN. CHEM., vol. 45, 1999, pages 1628 - 50 |
| JEFFERIS; LUND, CHEM. IMMUNOL., vol. 65, 1997, pages 111 - 128 |
| JOHNSON, KEVIN S; CHISWELL, DAVID J., CURRENT OPINION IN STRUCTURAL BIOLOGY, vol. 3, 1993, pages 564 - 571 |
| JOLLY, CANCER GENE THERAPY, vol. 1, 1994, pages 51 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| JUNUTULA ET AL., NATURE BIOTECHNOLOGY, vol. 26, 2008, pages 925 - 932 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1991, NATIONAL INSTITUTES OF HEALTH |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1992, NIH |
| KAPLITT, NATURE GENETICS, vol. 6, 1994, pages 148 |
| KARLSSON, R; ROOS, H; FAGERSTAM, L; PETERSSON, B, METHODS ENZYMOLOGY, vol. 6, 1994, pages 99 - 110 |
| KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249 |
| KIMURA, HUMAN GENE THERAPY, vol. 5, 1994, pages 845 |
| KOHLER, B.; MILSTEIN, C., NATURE, vol. 256, 1975, pages 495 - 497 |
| KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| LOBUGLIO ET AL., PROC. NAT. ACAD. SCI. USA, vol. 86, 1989, pages 4220 - 4224 |
| LONBERG, N.; D. HUSZAR, INT. REV. IMMUNOL, vol. 13, 1995, pages 65 |
| M. ZANETTI AND J.D. CAPRA: "The Antibodies", 1995, HARWOOD ACADEMIC PUBLISHERS |
| M.J. GAIT: "Oligonucleotide Synthesis", 1984 |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745 |
| MAKABE ET AL., J. BIOL. CHEM., vol. 283, 2007, pages 1156 - 1166 |
| MAKABE ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 283, 2008, pages 1156 - 1166 |
| MARK ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597 |
| MARKS ET AL., BIO/TECHNOL., vol. 10, 1992, pages 779 - 783 |
| MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 553 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554 |
| MILLSTEIN; CUELLO, NATURE, vol. 305, 1983, pages 537 - 539 |
| MORRISON ET AL., PROC. NAT. ACAD. SCI., vol. 81, 1984, pages 6851 |
| MULLIS ET AL.: "PCR: The Polymerase Chain Reaction", 1994 |
| MULLIS ET AL.: "PCR: The Polymerase Chain Reaction", 1994, BIRKAUSWER PRESS |
| MYERS, E.W.; MULLER W., CABIOS, vol. 4, 1988, pages 11 - 17 |
| P. FINCH, ANTIBODIES, 1997 |
| P. SHEPHERD AND C. DEAN: "Monoclonal antibodies: a practical approach", 2000, OXFORD UNIVERSITY PRESS |
| PEETERS ET AL., VACCINE, vol. 19, 2001, pages 2756 |
| PETTIT ET AL., ANTIMICROB. AGENTS CHEMOTHER, vol. 42, 1998, pages 2961 - 2965 |
| PHILIP, MOL. CELL BIOL., vol. 14, 1994, pages 2411 |
| POLLOCK ET AL., J IMMUNOL METHODS, vol. 231, 1999, pages 147 |
| R.I. FRESHNEY: "Animal Cell Culture", 1987 |
| RAVETCH; KINET, ANN. REV. IMMUNOL., vol. 9, 1991, pages 457 - 92 |
| REMILLARD ET AL., SCIENCE, vol. 189, 1975, pages 1002 - 1005 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| ROBINSON, E.D., COMB. THEOR., vol. 11, 1971, pages 105 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, 2nd ed.", 1989, COLD SPRING HARBOR PRESS |
| SANTOU, N.; NES, M., MOL. BIOL. EVOL., vol. 4, 1987, pages 406 - 425 |
| SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155 |
| SHAW ET AL., J IMMUNOL., vol. 138, 1987, pages 4534 - 4538 |
| SHEETS ET AL., PROC. NATL. ACAD. SCI. (USA, vol. 95, 1998, pages 6157 - 6162 |
| SNEATH, P.H.A.; SOKAL, R.R.: "Numerical Taxonomy the Principles and Practice of Numerical Taxonomy", 1973, FREEMAN PRESS |
| SURESH ET AL., METHODS IN ENZYMOLOGY, vol. 121, 1986, pages 210 |
| TANAKA ET AL., FEBS LETTERS, vol. 579, 2005, pages 2092 - 2096 |
| TILLER ET AL., J. IMMUNOL. METHODS, vol. 329, 2008, pages 112 |
| UMANA ET AL., MATURE BIOTECH., vol. 17, 1999, pages 176 - 180 |
| VAUGHAN ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 309 - 314 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WATERHOUSE ET AL., NUCL. ACIDS RES., vol. 21, 1993, pages 2265 - 2266 |
| WILBUR, W.J.; LIPMAN, D.J., PROC. NATL. ACAD. SCI. USA, vol. 80, 1983, pages 726 - 730 |
| WINTER ET AL., ANNU. REV. IMMUNOL, vol. 12, 1994, pages 433 - 455 |
| WINTER ET AL., NATURE, vol. 349, 1991, pages 293 - 299 |
| WITTWE; HOWARD, BIOCHEM., vol. 29, 1990, pages 4175 - 4180 |
| WOFFENDIN, PROC. NATL. ACAD. SCI., vol. 91, 1994, pages 1581 |
| WRIGHT; MORRISON, TIBTECH, vol. 15, 1997, pages 26 - 32 |
| WU ET AL., J. BIOL. CHEM., vol. 263, 1988, pages 621 |
| WU ET AL., J. BIOL. CHEM., vol. 266, 1991, pages 338 |
| WU ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 542 |
| WU, J. BIOL. CHEM., vol. 264, 1989, pages 16985 |
| WYSS; WAGNER, CURRENT OPIN. BIOTECH., vol. 7, 1996, pages 409 - 416 |
| YELTON ET AL., J. IMMUNOL., vol. 155, 1995, pages 1994 - 2004 |
| ZENKE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 3655 |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11987634B2 (en) | 2018-02-01 | 2024-05-21 | Pfizer Inc. | Antibodies specific for CD70 and their uses |
| WO2019152705A1 (en) * | 2018-02-01 | 2019-08-08 | Pfizer Inc. | Antibodies specific for cd70 and their uses |
| JP2021511811A (ja) * | 2018-02-01 | 2021-05-13 | ファイザー・インク | Cd70に特異的な抗体およびその使用 |
| US11377500B2 (en) | 2018-02-01 | 2022-07-05 | Pfizer Inc. | Antibodies specific for CD70 and their uses |
| US11396551B2 (en) | 2018-02-01 | 2022-07-26 | Pfizer Inc. | Chimeric antigen receptors targeting CD70 |
| US12152081B2 (en) | 2018-02-01 | 2024-11-26 | Pfizer Inc. | Chimeric antigen receptors targeting CD70 |
| CN111936516A (zh) * | 2018-03-19 | 2020-11-13 | 上海药明生物技术有限公司 | 新型抗egfr抗体多肽 |
| CN111936516B (zh) * | 2018-03-19 | 2023-03-03 | 上海药明生物技术有限公司 | 新型抗egfr抗体多肽 |
| US11773172B2 (en) | 2018-03-19 | 2023-10-03 | WuXi Biologics Ireland Limited | Anti-EGFR antibody polypeptide |
| CN109265561A (zh) * | 2018-09-25 | 2019-01-25 | 山东兴瑞生物科技有限公司 | 抗EGFRvⅢ安全型嵌合抗原受体、其制备方法、利用其修饰的NK细胞及应用 |
| JP2022530301A (ja) * | 2019-02-22 | 2022-06-29 | 武▲漢▼友芝友生物制▲薬▼有限公司 | Cd3抗原結合性断片及びその使用 |
| US12460002B2 (en) | 2019-03-29 | 2025-11-04 | Merus N.V. | CD3 binding molecules |
| WO2022074206A1 (en) | 2020-10-08 | 2022-04-14 | Affimed Gmbh | Trispecific binders |
| WO2023007023A1 (en) | 2021-07-30 | 2023-02-02 | Affimed Gmbh | Duplexbodies |
| WO2023078968A1 (en) | 2021-11-03 | 2023-05-11 | Affimed Gmbh | Bispecific cd16a binders |
| WO2025257588A1 (en) | 2024-06-10 | 2025-12-18 | Affimed Gmbh | Cd16a/tumor antigen polyspecific binder for use in the treatment of immune checkpoint inhibitor resistance |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2954802C (en) | 2025-09-16 |
| US20170210812A1 (en) | 2017-07-27 |
| TW201738271A (zh) | 2017-11-01 |
| JP7222024B2 (ja) | 2023-02-14 |
| ES2904593T3 (es) | 2022-04-05 |
| DK3405490T3 (da) | 2022-01-10 |
| TWI657096B (zh) | 2019-04-21 |
| EP3405490A1 (en) | 2018-11-28 |
| CN109219618B (zh) | 2022-08-09 |
| CA2954802A1 (en) | 2017-07-21 |
| US10221242B2 (en) | 2019-03-05 |
| TW201936640A (zh) | 2019-09-16 |
| CN109219618A (zh) | 2019-01-15 |
| JP2019506398A (ja) | 2019-03-07 |
| JP2021129602A (ja) | 2021-09-09 |
| US20190194335A1 (en) | 2019-06-27 |
| EP3405490B1 (en) | 2021-10-20 |
| US11279764B2 (en) | 2022-03-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11279764B2 (en) | Antibodies specific for epidermal growth factor receptor variant III and their uses | |
| US20240018252A1 (en) | Therapeutic antibodies and their uses | |
| CA2854720C (en) | Antibodies specific for trop-2 and their uses | |
| CA3090032A1 (en) | Antibodies specific for cd70 and their uses | |
| HK40000515B (en) | Mono and bispecific antibodies for epidermal growth factor receptor variant iii and cd3 and their uses |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17700749 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2018538177 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017700749 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2017700749 Country of ref document: EP Effective date: 20180821 |