WO2017060728A1 - Compounds and therapeutic uses thereof - Google Patents

Compounds and therapeutic uses thereof Download PDF

Info

Publication number
WO2017060728A1
WO2017060728A1 PCT/GB2016/053133 GB2016053133W WO2017060728A1 WO 2017060728 A1 WO2017060728 A1 WO 2017060728A1 GB 2016053133 W GB2016053133 W GB 2016053133W WO 2017060728 A1 WO2017060728 A1 WO 2017060728A1
Authority
WO
WIPO (PCT)
Prior art keywords
compound
nhco
integer selected
groups
conh
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2016/053133
Other languages
English (en)
French (fr)
Inventor
Christopher PICKFORD
Christine Watson
Melanie Glossop
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Avvinity Therapeutics Ltd
Original Assignee
Avvinity Therapeutics Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Avvinity Therapeutics Ltd filed Critical Avvinity Therapeutics Ltd
Publication of WO2017060728A1 publication Critical patent/WO2017060728A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/549Sugars, nucleosides, nucleotides or nucleic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/542Carboxylic acids, e.g. a fatty acid or an amino acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/545Heterocyclic compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents

Definitions

  • the invention relates to novel compounds with the ability to link an immune response to a defined therapeutic target, to the use of said compounds in treating cancer, to compositions containing said compounds, processes for their preparation and to novel intermediates used in said process.
  • Cancer is a group of diseases involving abnormal cell growth with the potential to invade or spread to other parts of the body. In 2012, cancer occurred in about 14.1 million people. It caused about 8.2 million deaths or 14.6% of all human deaths. The most common types of cancer in males are lung cancer, prostate cancer, colorectal cancer and stomach cancer. In females the most common types are breast cancer, colorectal cancer, lung cancer, and cervical cancer. It is well established that the immune response plays a vital role in the identification and elimination of cancerous cells. Drugs exist that fight cancer by boosting an individual's immune system to help fight the cancer. There is a need to be able to better target the immune response specifically to the cancer cell and to generate a broader range of the patient's own tumour associated antigens. Targeting pre-existing natural antibodies to the patient's own tumour could meet this need.
  • WO 2005/079423 describes an immunity linker which contains two binding moieties.
  • the first binding moiety is capable of binding to an immune response component of an individual.
  • the second binding moiety is capable of binding to any compound or foreign material such as antigens, pathogens, chemicals, or endogenous materials such as altered cells found in cancer.
  • the resultant effect of said immunity linker molecule is that the pre-existing immune response of the individual is diverted towards the target, i.e. the cancer cell.
  • said first binding moieties include compounds or agents which are recognised by the immune system of said individual as foreign and which would therefore trigger an immune response.
  • first binding moiety is a carbohydrate molecule capable of binding to a human serum antibody anti-alpha-galactosyl (i.e. galactosyl-alpha-1 ,3-galactosyl-beta-1 ,4-N- acetylglucosamine).
  • second binding moieties include antibodies and nucleic acid aptamer molecules that bind to a specific target molecule.
  • the principle of the method disclosed in WO 2005/079423 is that the second binding moiety (e.g. nucleic acid aptamer) of the linker molecule will bind to a cancer cell and the presence of the first binding moiety (i.e. the carbohydrate molecule capable of binding to a human anti-alpha-galactosyl antibody) on the linker molecule will divert an immune response to the cancer cell resulting in effective destruction of the cancer cell.
  • the epidermal growth factor receptor also known as ErbB-1 or HER1 in humans, is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands.
  • EGFR is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4).
  • Mutations affecting EGFR expression or activity could result in cancer.
  • mutations that lead to EGFR overexpression have been associated with a number of cancers, including lung cancer, anal cancers (such as colorectal cancer) and glioblastoma multiforme.
  • upregulation a mutation of EGFR
  • glioblastoma multiforme a mutation of EGFR
  • EGFRvlll a more or less specific mutation of EGFR, called EGFRvlll is often observed.
  • Mutations, amplifications or misregulations of EGFR or family members are implicated in about 30% of all epithelial cancers.
  • L represents a binding moiety which is an Epidermal Growth Factor Receptor (EGFR) binding nucleic acid aptamer;
  • EGFR Epidermal Growth Factor Receptor
  • Si represents a spacer selected from a -(CH2) a - or -(CH2)b-(CH2-CH2-0) c -(CH2)d- group, wherein one to five of said -CH2- groups may optionally be substituted by one or more groups selected from -0-, -C(0)NH-, -NHC(O)- and phenyl;
  • a represents an integer selected from 1 to 35;
  • b represents an integer selected from 0 to 5;
  • c represents an integer selected from 1 to 20;
  • d represents an integer selected from 1 to 20;
  • S2 represents a spacer selected from a -(CH2)e- or -(CH2)f-(CH2-CH2-0) g -(CH2)h- group, wherein one to three of said -CH2- groups may optionally be substituted by one or more groups selected from -N(H)-, -C(0)NH- and -NHC(O)-;
  • e represents an integer selected from 1 to 15;
  • f represents an integer selected from 1 to 10;
  • g represents an integer selected from 1 to 20;
  • h represents an integer selected from 1 to 5;
  • Xi represents -0-
  • Yi and Y 2 independently represent a bond, -0-, -S-, -NH-, -NHC(O)-, -C(0)NH-, -OC(O)-, - C(0)0-, -SC(O)-, -C(0)S-, -NHSO2-, -SO2NH- or -NHC(0)NH- group;
  • F represents a carbohydrate molecule capable of binding to a human anti-alpha-galactosyl antibody
  • n an integer selected from 1 to 5;
  • Cy represents phenyl, biphenyl, triphenyl or a bicyclic heteroaromatic ring system, such that when Cy represents biphenyl or triphenyl, said -Y1-S1-X1-L group may be present on any of said phenyl rings and said [F-S2-Y2]m- group or groups may be present on any of said phenyl rings.
  • Figure 1 Flow cytometry assay results which demonstrate the capture of anti-alpha galactosyl IgG antibodies to the cell surface using Example 1 (Figure 1A), Example 2 ( Figure 1A), and
  • Figure 2 Dose titration of Examples 1-3 in the Flow Cytometry assay which demonstrate a difference in recruitment of anti-galactosyl antibodies by Examples 1-3 to the human cancer cell line A431.
  • Figure 3 demonstrates the capture of anti-alpha galactosyl antibodies to the cell surface using Example 18 (Figure 3A), Example 19 (Figure 3B), Example 20 (Figure 3C) and
  • Example 21 ( Figure 3D).
  • Figure 4 is a dose titration of Examples 18-21 using the Flow Cytometry assay described.
  • Figure 5 Flow cytometry assay results which demonstrate the capture of anti-alpha galactosyl IgM antibodies to the cell surface using Example 1 (Figure 5A), Example 2 ( Figure 5B) and Example 3 ( Figure 5C).
  • Si represents a spacer selected from:
  • -(CH2)a- wherein one to four of said -CH2- groups are optionally substituted by one or more groups selected from -C(0)NH- and -NHC(O)- (such as -(CH 2 ) 2 -, -CH2-CONH-
  • Si represents a spacer selected from -(CH 2 ) a -, wherein one or two of said -CH 2 - groups are optionally substituted by a -C(0)NH- or -NHC(O)- group (such as - (CH 2 ) 2 -, -CH 2 -CONH-(CH 2 ) 2 -, -CH 2 -NHCO-(CH 2 ) 4 -CONH-(CH 2 ) 2 - or -(CH 2 ) 6 -) or -(CH 2 ) b - (CH 2 -CH 2 -0)c-(CH 2 )d-, wherein one or two of said -CH 2 - groups are optionally substituted by a -C(0)NH- or -NHC(O)- group (such as -(CH 2 ) 2 -NHCO-(CH 2 CH 2 0)i 2 -(CH 2 ) 2 -).
  • Si represents a spacer selected from -(CH 2
  • a, b, c, d, e, f, g and h are selected to maintain a suitable linker length between groups F and L.
  • suitable linker lengths between F and L range from about 5A to about 50A or more in length, about 6A to about 45A, about 7A to about 40A, about 8A to about 35A, about 9A to about 30A, about 10A to about 25A, about 11A to about 20A, about 12A to about 15A.
  • a, b, c, d, e, f, g and h represent a total integer of no more than 45, such as between 5 and 45, such as between 7 and 42, such as no more than 30, such as between 5 and 30, such as between 7 and 29.
  • a represents an integer selected from 1 to 30.
  • a represents an integer selected from 2 to 30.
  • a represents an integer selected from 2, 4, 6, 9, 18 or 30.
  • a represents an integer selected from 6 to 30.
  • a represents an integer selected from 6, 18 or 30.
  • a represents an integer selected from 1 to 10.
  • a represents an integer selected from 2 to 9.
  • a represents an integer selected from 2, 4, 6 or 9.
  • b represents an integer selected from 0 to 3. In a further embodiment, b represents an integer selected from 0 or 3. In a further embodiment, b represents an integer selected from 1 to 3. In a further embodiment, b represents an integer selected from 2 or 3. In a yet further embodiment, b represents an integer selected from 3.
  • c represents an integer selected from 1 to 15. In a further embodiment, c represents an integer selected from 1 to 12. In a further embodiment, c represents an integer selected from 4 to 12. In a yet further embodiment, c represents an integer selected from 4 or 12. In a yet further embodiment, c represents an integer selected from 12.
  • d represents an integer selected from 1 to 15. In a further embodiment, d represents an integer selected from 2 to 13. In a further embodiment, d represents an integer selected from 2, 5 or 13. In a further embodiment, d represents an integer selected from 13. In a further embodiment, d represents an integer selected from 1 to 3. In a further embodiment, d represents an integer selected from 1 or 2. In a yet further embodiment, d represents an integer selected from 2. In one embodiment, Yi represents a bond, -C(0)NH- or -0-. In a further embodiment, Yi represents -C(0)NH-.
  • S2 represents a spacer selected from:
  • -(CH2)e- wherein one or two of said -CH2- groups are optionally substituted by one or two groups selected from -N(H)-, -C(0)NH- and -NHC(O)- (such as -(CH 2 )3-NHCO-CH 2 -, - (CH 2 )3- -(CH 2 )3-NHCO-(CH 2 )4-CONH-CH 2 -, -(CH 2 ) 3 -NH-CH 2 - or -(CH 2 ) 3 -NHCO-(CH 2 ) 3 - NHCO-CH 2 -); or -(CH2)r(CH2-CH2-0)g-(CH2)h-, wherein one to three of said -CH2- groups are optionally substituted by one to three -NHC(O)- groups (such as -(CH2)3-NHCO-(CH2CH 2 0)4- (CH 2 ) 2 -NHCO-CH 2 -, -(CH 2 )
  • S2 represents a spacer selected from -(CH2)e-, wherein one or two of said -CH2- groups are optionally substituted by a -C(0)NH- or -NHC(O)- group (such as - (CH 2 )3-NHCO-CH 2 -, -(CH 2 ) 3 -NHCO-, -(CH 2 ) 3 -, -(CH 2 )3-NHCO-(CH 2 )4-CONH-CH 2 - or -(CH 2 ) 3 - NH-CH2-) or -(CH2)f-(CH2-CH2-0)g-(CH2)h-, wherein one or two of said -CH2- groups are optionally substituted by a -C(0)NH- or -NHC(O)- group (such as -(CH 2 )3-NHCO-(CH 2 )2- (OCH 2 CH 2 )4-NHCO-CH 2 - or -(CH 2 )4-NHCO
  • S2 represents a spacer selected from:
  • -(CH2)e- wherein one or two of said -CH2- groups are optionally substituted by one or two -NHC(O)- groups (such as -(CH 2 )3-NHCO-CH 2 - or -(CH 2 )3-NHCO-(CH 2 )3-NHCO-CH 2 - ); or
  • -(CH2)f-(CH2-CH2-0)g-(CH2)h- wherein one to three of said -CH2- groups are optionally substituted by one to three -NHC(O)- groups (such as -(CH2)3-NHCO-(CH2CH 2 0)4- (CH 2 ) 2 -NHCO-CH 2 -, -(CH 2 )3-NHCO-(CH2CH20)i2-(CH 2 )2-NHCO-CH2- or -(CH 2 ) 3 -NHCO- (CH 2 )3-NHCO-(CH2CH20)4-(CH 2 )2-NHCO-CH2-).
  • -NHC(O)- groups such as -(CH2)3-NHCO-(CH2CH 2 0)4- (CH 2 ) 2 -NHCO-CH 2 -, -(CH 2 )3-NHCO-(CH2CH20)i2-(CH 2 )2-NHCO-CH2- or -(CH 2 ) 3
  • e represents an integer selected from 1 to 10. In a further embodiment, e represents an integer selected from 3 to 10. In a further embodiment, e represents an integer selected from 3, 5, 9 or 10. In a further embodiment, e represents an integer selected from 5 to 9. In a further embodiment, e represents an integer selected from 5 or 9. In a further embodiment, e represents an integer selected from 4 to 10. In a yet further embodiment, e represents an integer selected from 4, 5 or 10.
  • f represents an integer selected from 1 to 8. In a further embodiment, f represents an integer selected from 2 to 8. In a further embodiment, f represents an integer selected from 2 to 6. In a yet further embodiment, f represents an integer selected from 4 to 8. In a yet further embodiment, f represents an integer selected from 4 or 8.
  • g represents an integer selected from 1 to 15. In a further embodiment, g represents an integer selected from 4 to 12. In a further embodiment, g represents an integer selected from 4 or 12. In a further embodiment, g represents an integer selected from 1 to 5. In a further embodiment, g represents an integer selected from 1 to 4. In a yet further embodiment, g represents an integer selected from 4.
  • h represents an integer selected from 1 to 4. In a further embodiment, h represents an integer selected from 4.
  • Y2 represents a bond, -O- or -NHC(O)-. In a further embodiment, Y2 represents a bond or -O-. In a yet further embodiment, Y2 represents -0-. In one embodiment, m represents an integer selected from 1 to 4. In a further embodiment, m represents an integer selected from 3 or 4. In a further embodiment, m represents an integer selected from 1 to 3. In a yet further embodiment, m represents an integer selected from 2 or 3. In a yet further embodiment, m represents an integer selected from 1 or 2. In a yet further embodiment, m represents an integer selected from 1.
  • bicyclic heteroaromatic ring system refers to a bicyclic ring system containing two fused six membered rings and comprising at least one heteroatom selected from N.
  • bicyclic heteroaryl groups containing two fused six membered rings include but are not limited to quinoline, isoquinoline, pyridopyridine, quinoxaline, quinazoline, cinnoline, phthalazine, naphthyridine and pteridine groups.
  • said bicyclic heteroaromatic ring system is quinolinyl.
  • Cy represents phenyl, biphenyl, triphenyl or quinolinyl. In a further embodiment, Cy represents phenyl, biphenyl or triphenyl. In a further embodiment, Cy represents phenyl, biphenyl or quinolinyl. In a further embodiment, Cy represents phenyl or biphenyl. In a yet further embodiment, Cy represents biphenyl.
  • L represents a binding moiety which is an Epidermal Growth Factor Receptor (EGFR) binding nucleic acid aptamer
  • 51 represents a spacer selected from a -(CH2) a - or -(CH2)b-(CH2-CH2-0) c -(CH2)d- group, wherein one to five of said -CH2- groups may optionally be substituted by one or more groups selected from -0-, -C(0)NH-, -NHC(O)- and phenyl;
  • EGFR Epidermal Growth Factor Receptor
  • a represents an integer selected from 2 to 30;
  • b represents an integer selected from 0 to 3;
  • c represents an integer selected from 4 to 12;
  • d represents an integer selected from 2 to 13;
  • 52 represents a spacer selected from a -(CH2)e- or -(CH2)f-(CH2-CH2-0) g -(CH2)h- group, wherein one to three of said -CH2- groups may optionally be substituted by one or more groups selected from -N(H)-, -C(0)NH- and -NHC(O)-;
  • e represents an integer selected from 3 to 10;
  • f represents an integer selected from 4 to 8;
  • g represents an integer selected from 4 to 12;
  • h represents an integer selected from 1 to 4.
  • Xi represents -0-
  • Yi and Y2 independently represent a bond, -0-, -C(0)NH- or -NHC(O)- group;
  • F represents a carbohydrate molecule capable of binding to a human anti-alpha-galactosyl antibody
  • n an integer selected from 1 to 4.
  • Cy represents phenyl, biphenyl, triphenyl or quinolinyl, such that when Cy represents biphenyl or triphenyl, said -Y1-S1-X1-L group may be present on any of said phenyl rings and said [F-S2-Y2]m- group or groups may be present on any of said phenyl rings.
  • L represents a binding moiety which is an Epidermal Growth Factor Receptor (EGFR) binding nucleic acid aptamer;
  • EGFR Epidermal Growth Factor Receptor
  • Si represents a spacer selected from a -(CH2) a - or -(CH2)b-(CH2-CH2-0) c -(CH2)d- group, wherein one to five of said -CH2- groups may optionally be substituted by one or more groups selected from -0-, -C(0)NH-, -NHC(O)- and phenyl;
  • a represents an integer selected from 6 to 30;
  • b represents an integer selected from 3;
  • c represents an integer selected from 4 to 12;
  • d represents an integer selected from 13;
  • S2 represents a spacer selected from a -(CH2)e- or -(CH2)f-(CH2-CH2-0) g -(CH2)h- group, wherein one to three of said -CH2- groups may optionally be substituted by one to three - NHC(O)- groups;
  • e represents an integer selected from 5 to 9;
  • f represents an integer selected from 4 to 8;
  • g represents an integer selected from 4 to 12;
  • h represents an integer selected from 4;
  • Xi represents -0-
  • Yi and Y2 independently represent -O- or -C(0)NH-;
  • F represents a carbohydrate molecule capable of binding to a human anti-alpha-galactosyl antibody
  • n an integer selected from 1 to 4.
  • Cy represents phenyl, biphenyl or triphenyl, such that when Cy represents biphenyl or triphenyl, said -Y1-S1-X1-L group may be present on any of said phenyl rings and said [F-S2- Y2]m- group or groups may be present on any of said phenyl rings.
  • References herein to the term "carbohydrate molecule capable of binding to a human anti- alpha-galactosyl antibody” include sugar (i.e. carbohydrate) moieties capable of binding to an immune response component (i.e. an anti-alpha-galactosyl antibody) of said human and consequently eliciting an immune response in a human.
  • said anti-alpha- galactosyl antibody is an anti-alpha-galactosyl IgG antibody or an anti-alpha-galactosyl IgM antibody.
  • Data is presented herein in Figures 1 and 5 which demonstrates the capture of anti-alpha galactosyl IgG and IgM antibodies, respectively.
  • carbohydrate molecules include alpha-galactosyl compounds and modified derivatives thereof. Further examples of suitable carbohydrate molecules include the alpha-gal epitopes listed in US 2012/0003251 as being suitable for use in the selective targeting and killing of tumour cells, the epitopes of which are herein incorporated by reference.
  • F is selected from galactosyl-alpha-1 ,3-galactosyl-beta-1 ,4-N-acetylglucosamine, alpha1-3 galactobiose, alpha1-3-beta1-4-galactotriose or galilipentasaccharide.
  • F has a structure as shown in one of the following formulae:
  • S2 refers to the point of attachment to the S2 group.
  • nucleic acid aptamer refers to an oligonucleotide molecule that binds to a specific target molecule, such as a therapeutic target molecule. Nucleic acid aptamers are typically identified by selecting them from a large random sequence pool. In one embodiment, the nucleic acid aptamer is a DNA aptamer, an RNA aptamer or a nucleic acid analogue aptamer. In a further embodiment, the nucleic acid aptamer is an RNA aptamer. In one embodiment, the nucleic acid aptamer is an oligonucleotide comprising more than 5 but less than 100 nucleic acid molecules.
  • nucleic acid aptamer may contain natural and non-natural nucleotides, such as modified nucleotides which may have a fluorine or methoxy substituent at the 2' position.
  • suitable non-natural nucleotides are described in Table 9.6.1 of Stovall et al (2014). In Vitro Selection Using Modified or Unnatural Nucleotides, doi : 10.1002/0471142700. nc0906s56, the non-natural nucleotides of which are herein incorporated by reference.
  • L typically represents the followin structure:
  • B represents a natural base (i.e. adenine, thymine/uracil, guanine or cytosine) or non-natural base
  • the arrow represents the next nucleotide in the aptamer sequence
  • R x represents hydrogen, a hydroxyl group or a 2' modification such as fluorine or methoxy
  • Xi refers to the point of attachment to the Xi group which is required by the invention to be - 0-.
  • nucleic acid aptamer directed to a specific therapeutic target may easily be prepared in accordance with known procedures, such as Selective systematic Evolution of Ligands by Exponential enrichment (SELEX).
  • EGFR is well known to be over-expressed in several human cancer types.
  • the EGFR binding nucleic acid aptamer is an aptamer which binds to any of the EGFR subfamily selected from: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4).
  • EGFR binding nucleic acid aptamers examples include those described in Li et al (201 1) PLoS One 6(6), 1-9 which describes a series of anti-EGFR aptamers, including E07.
  • the EGFR binding nucleic acid aptamer comprises an aptamer having the sequence of SEQ ID NO: 2 or a sequence having at least 90% sequence identity to said sequence (such as at least 95, 96, 97, 98 or 99% sequence identity).
  • the EGFR binding nucleic acid aptamer comprises an aptamer having the sequence of SEQ ID NO: 2.
  • examples of further suitable EGFR binding nucleic acid aptamers include the nucleic acid aptamers of SEQ ID NOS: 1 to 84 described in International Patent Application No. PCT/GB2015/051812.
  • the nucleic acid aptamer is selected from SEQ ID NO: 79 described in International Patent Application No.
  • PCT/GB2015/051812 which has the following sequence: 5'-mGmGmG mAfllfU fUAA fllfCmG fCfCmG fllmAmG AmAmA AmGfC mAfUmG fUfCmA AAmG fCfCmG mGmAA fCfCfC-3' (SEQ ID NO: 3); wherein m is 2'-OMe and f is 2'-F.
  • the EGFR binding nucleic acid aptamer comprises an aptamer having the sequence of SEQ ID NO: 3 or a sequence having at least 90% sequence identity to said sequence (such as at least 95, 96, 97, 98 or 99% sequence identity).
  • the EGFR binding nucleic acid aptamer comprises an aptamer having the sequence of SEQ ID NO: 3.
  • nucleic acid aptamer comprises a 5' and 3' modified derivative of SEQ ID NO: 3 having the following sequence:
  • SEQ ID NO: 1 H 2 N-(CH 2 )6-5'-(SEQ ID NO: 3)-3'-idT (hereinafter referred to as SEQ ID NO: 1) or a sequence having at least 90% sequence identity to said sequence (such as at least 95, 96, 97, 98 or 99% sequence identity).
  • the EGFR binding nucleic acid aptamer comprises an aptamer having the sequence of SEQ ID NO: 1.
  • the invention provides a compound of formula (I) which comprises a compound of Examples 1-21 or a pharmaceutically acceptable salt thereof. In a yet further embodiment, the invention provides a compound of formula (I) which comprises a compound of Examples 1-3 or a pharmaceutically acceptable salt thereof.
  • Examples 1-21 have specific therapeutic utility in the treatment of cancer which can be inferred from the approach demonstrated for nucleic acid aptamers directed to group A Streptococcus (GAS) bacteria described in Kristian et al (2015) J. Mol. Med. (2015) 93, 619-631.
  • GAS group A Streptococcus
  • the invention provides a compound of formula (I) which is the free base of a compound of Examples 1-21 (in particular Examples 1-3).
  • a reference to a compound of formula (I) and sub-groups thereof also includes ionic forms, salts, solvates, isomers (including geometric and stereochemical isomers), tautomers, N- oxides, esters, isotopes and protected forms thereof, for example, as discussed below;
  • the salts or tautomers or isomers or N-oxides or solvates thereof preferably, the salts or tautomers or isomers or N-oxides or solvates thereof; and more preferably, the salts or tautomers or N-oxides or solvates thereof, even more preferably the salts or tautomers or solvates thereof.
  • compounds and their ionic forms, salts, solvates, isomers (including geometric and stereochemical isomers), tautomers, N-oxides, esters, isotopes and protected forms thereof as defined in any aspect of the invention (except intermediate compounds in chemical processes) are referred to as "compounds of the invention".
  • Compounds of formula (I) can exist in the form of salts, for example acid addition salts or, in certain cases salts of organic and inorganic bases such as carboxylate, sulfonate and phosphate salts. All such salts are within the scope of this invention, and references to compounds of formula (I) include the salt forms of the compounds. In one embodiment, the compound of formula (I) exists as the phosphate salt.
  • the salts of the present invention can be synthesized from the parent compound that contains a basic moiety by conventional chemical methods such as methods described in Pharmaceutical Salts: Properties, Selection, and Use, P. Heinrich Stahl (Editor), Camille G. Wermuth (Editor), ISBN: 3-90639-026-8, Hardcover, 388 pages, August 2002.
  • such salts can be prepared by reacting the base forms of these compounds with the appropriate base or acid in water or in an organic solvent, or in a mixture of the two;
  • nonaqueous media such as ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are used.
  • Acid addition salts may be formed with a wide variety of acids, both inorganic and organic.
  • acid addition salts include mono- or di-salts formed with an acid selected from the group consisting of acetic, 2,2-dichloroacetic, adipic, alginic, ascorbic (e.g.
  • D-glucuronic D-glucuronic
  • glutamic e.g. L-glutamic
  • a-oxoglutaric glycolic, hippuric
  • hydrohalic acids e.g. hydrobromic, hydrochloric, hydriodic
  • isethionic lactic (e.g.
  • salts consist of salts formed from acetic, hydrochloric, hydriodic, phosphoric, nitric, sulfuric, citric, lactic, succinic, maleic, malic, isethionic, fumaric, benzenesulfonic, toluenesulfonic, methanesulfonic (mesylate), ethanesulfonic,
  • naphthalenesulfonic, valeric, acetic, propanoic, butanoic, malonic, glucuronic and lactobionic acids One particular salt is the hydrochloride salt. Another particular salt is the
  • hydrogensulfate salt also known as a hemisulfate salt.
  • Salts further include, by way of example only, sodium, potassium, calcium, magnesium, ammonium, tetraalkylammonium, and the like.
  • the compound of formula (I) when the target binding moiety represents a nucleic acid aptamer that the compound of formula (I) will desirably be present as a salt free form to avoid any potential degradation of the nucleic acid aptamer.
  • the compounds of formula (I) may contain an amine function, these may form quaternary ammonium salts, for example by reaction with an alkylating agent according to methods well known to the skilled person. Such quaternary ammonium compounds are within the scope of formula (I).
  • the compounds of the invention may exist as mono- or di-salts depending upon the pKa of the acid from which the salt is formed.
  • the salt forms of the compounds of the invention are typically pharmaceutically acceptable salts, and examples of pharmaceutically acceptable salts are discussed in Berge et al., 1977, "Pharmaceutically Acceptable Salts," J. Pharm. Sci., Vol. 66, pp. 1-19. However, salts that are not pharmaceutically acceptable may also be prepared as intermediate forms which may then be converted into pharmaceutically acceptable salts. Such non-pharmaceutically acceptable salts forms, which may be useful, for example, in the purification or separation of the compounds of the invention, also form part of the invention.
  • N-oxides are the N-oxides of a tertiary amine or a nitrogen atom of a nitrogen-containing heterocycle.
  • N-Oxides can be formed by treatment of the corresponding amine with an oxidizing agent such as hydrogen peroxide or a per-acid (e.g. a peroxycarboxylic acid), see for example Advanced Organic Chemistry, by Jerry March, 4 th Edition, Wiley Interscience, pages. More particularly, N-oxides can be made by the procedure of L. W. Deady (Syn. Comm. 1977, 7, 509-514) in which the amine compound is reacted with m-chloroperoxybenzoic acid
  • pro-drug functionality suitable for the compounds of the present invention are described in Drugs of Today, Volume 19, Number 9, 1983, pp 499 - 538 and in Topics in Chemistry, Chapter 31 , pp 306 - 316 and in "Design of Prodrugs" by H. Bundgaard, Elsevier, 1985, Chapter 1 (the disclosures in which documents are incorporated herein by reference). It will further be appreciated by those skilled in the art, that certain moieties, known to those skilled in the art as “pro-moieties”, for example as described by H. Bundgaard in “Design of Prodrugs” (the disclosure in which document is incorporated herein by reference) may be placed on appropriate functionalities when such functionalities are present within compounds of the invention.
  • the present invention includes all pharmaceutically acceptable isotopically-labeled compounds of the invention, i.e. compounds of formula (I), wherein one or more atoms are replaced by atoms having the same atomic number, but an atomic mass or mass number different from the atomic mass or mass number usually found in nature.
  • isotopes suitable for inclusion in the compounds of the invention comprise isotopes of hydrogen, such as 2 H (D) and 3 H (T), carbon, such as 11 C, 13 C and 14 C, fluorine, such as 18 F, nitrogen, such as 13 N and 15 N, oxygen, such as 15 0, 17 0 and 18 0.
  • hydrogen such as 2 H (D) and 3 H (T)
  • carbon such as 11 C, 13 C and 14 C
  • fluorine such as 18 F
  • nitrogen such as 13 N and 15 N
  • oxygen such as 15 0, 17 0 and 18 0.
  • Certain isotopically-labelled compounds of formula (I), for example, those incorporating a radioactive isotope, are useful in drug and/or substrate tissue distribution studies.
  • the compounds of formula (I) can also have valuable diagnostic properties in that they can be used for detecting or identifying the formation of a complex between a labelled compound and other molecules, peptides, proteins, enzymes or receptors.
  • the detecting or identifying methods can use compounds that are labelled with labelling agents such as radioisotopes, enzymes, fluorescent substances, luminous substances (for example, luminol, luminol derivatives, luciferin, aequorin and luciferase), etc.
  • the radioactive isotopes tritium, / ' .e. 3 H (T), and carbon-14, i.e. 14 C, are particularly useful for this purpose in view of their ease of incorporation and ready means of detection.
  • Isotopically-labeled compounds of formula (I) can generally be prepared by conventional techniques known to those skilled in the art or by processes analogous to those described in the accompanying Examples and Preparations using appropriate isotopically-labeled reagents in place of the non-labeled reagent previously employed.
  • the compounds pertaining to the invention described herein may be prepared in a stepwise synthetic sequence as illustrated in the Processes and Schemes below.
  • the syntheses involve the preparation of various central constructs which then enable the choice of branching and length of linker with which to connect the two binding moieties.
  • Compounds of the formula (I) can be prepared in accordance with synthetic methods well known to the skilled person. For example, one skilled in the art will appreciate that the chemical steps and choice of protecting groups may be managed in any order to enable synthetic success.
  • Processes (a) and (b) typically comprise an amide bond formation reaction which comprises activation of the carboxylic acid with either phosphate containing reagents, triazine-based reagents or carbodiimide containing reagents in the presence of an organic base in an organic solvent.
  • Preferred conditions comprise HATU ((1-[bis(dimethyiamino)methyiene]-1 H-1 ,2 i 3- triazoio[4,5-b]pyridinium 3-oxid hexafluorophosphate) with either triethy!amine or diisopropylethylamine in D F or a mixture of D F and D SO; D T (4-(4,8-dimethoxy- 1 ⁇ 5-triazin-2-yi)-4-methy!morpho!in-4-ium chloride or tetrafiuoroborate salt) with an inorganic base in DMF, or with HBTU with triethy!amine in DMF.
  • Process (c) typically comprises interconversion procedures known by one skilled in the art.
  • a first substituent may be converted by methods known by one skilled in the art into a second, alternative substituent.
  • a wide range of well known functional group interconversions are known by a person skilled in the art for converting a precursor compound to a compound of formula (I) and are described in
  • PG 1 is a protecting group comprising either tert-butyl, methyl, ethyl or benzyl and PG 2 is an orthogonal protecting group comprising either methyl, ethyl or tert-butyl.
  • Compounds of formula (II), (XA) and (IIA) may be prepared from compounds of formula (X) according to process steps (i) and (ii), an amide bond formation step as described for processes (a) and (b) hereinbefore, followed by a suitable deprotection reaction.
  • PG comprises benzyl, the deprotection reaction mediated by catalytic hydrogenation.
  • Preferred conditions comprise 10% Pd/C in MeOH/EtOH or water or any combination thereof under an atmosphere of hydrogen (from between 15-70 psi). Alternatively deprotection may be mediated by a phase transfer reaction. Preferred conditions comprise TEA and water at room temperature for 16 hours.
  • PG comprises methyl, ethyl or tert-butyl
  • an acid or base mediated deprotection reaction as required by the protecting group is employed.
  • acid mediated deprotection conditions are required, preferred conditions comprise TFA, 4M HCI in dioxane, or 37% HCI in water with a co-solvent of DCM or water as necessary.
  • base mediated conditions are required, preferred conditions comprise either sodium or lithium hydroxide in aqueous media such as methanol or THF with water.
  • PG 1 is a protecting group comprising either tert-butyl, methyl, ethyl or benzyl
  • PG 2 is an orthogonal protecting group comprising either methyl, ethyl or tert-butyl and X is CI, Br or I.
  • Compounds of formula (X) may be prepared from compounds of formula (VII) and (VIII) according to process step (vi), an alkylation reaction.
  • Typical conditions comprise an inorganic base in a polar organic solvent at room temperature.
  • Preferred conditions comprise potassium carbonate in DMF.
  • compounds of formula (VII) may be prepared by employment of a Suzuki reaction to construct the bi/tri-phenyl unit.
  • Preferred conditions comprise tetrakistriphenyl phosphine palladium (0) or [1 , 1 '- bis(diphenylphosphino)ferrocene]dichloropalladium (II) complex with dichloromethane with sodium carbonate, potassium acetate or sodium bicarbonate in dioxane and water at 100-110 °C.
  • suitable required protecting groups such as TBS, such protecting groups may be deprotected using a fluoride mediated deprotection.
  • Preferred conditions comprise TBAF in THF at room temperature.
  • compounds of formula (VII) may be prepared directly by employment of a Suzuki reaction to construct the bi/tri-phenyl unit using conditions as described above and herein.
  • an intermediate compound selected from a compound of formula (VII), (X), (II), (XA) or (IIA) as defined hereinbefore.
  • the invention provides a pharmaceutical composition, and methods of making a pharmaceutical composition comprising (e.g admixing) at least one compound of the invention where L represents a nucleic acid aptamer, together with one or more pharmaceutically acceptable excipients and optionally other therapeutic or prophylactic agents, as described herein.
  • the pharmaceutically acceptable excipient(s) can be selected from, for example, carriers (e.g. a solid, liquid or semi-solid carrier), adjuvants, diluents, fillers or bulking agents, granulating agents, coating agents, release-controlling agents, binding agents, disintegrants, lubricating agents, preservatives, antioxidants, buffering agents, suspending agents, thickening agents, flavouring agents, sweeteners, taste masking agents, stabilisers or any other excipients conventionally used in pharmaceutical compositions.
  • carriers e.g. a solid, liquid or semi-solid carrier
  • adjuvants e.g. a solid, liquid or semi-solid carrier
  • compositions containing compounds of the invention can be formulated in accordance with known techniques, see for example, Remington's Pharmaceutical
  • compositions can be in any form suitable for parenteral, intranasal, intrabronchial, sublingual, ophthalmic, otic, rectal, intra-vaginal, or transdermal
  • compositions are intended for parenteral administration, they can be formulated for intravenous, intramuscular, intraperitoneal, subcutaneous administration or for direct delivery into a target organ or tissue by injection, infusion or other means of delivery.
  • the delivery can be by bolus injection, short term infusion or longer term infusion and can be via passive delivery or through the utilisation of a suitable infusion pump or syringe driver.
  • compositions adapted for parenteral administration include aqueous and nonaqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats, co-solvents, surface active agents, organic solvent mixtures, cyclodextrin complexation agents, emulsifying agents (for forming and stabilizing emulsion formulations), liposome components for forming liposomes, gellable polymers for forming polymeric gels, lyophilisation protectants and combinations of agents for, inter alia, stabilising the active ingredient in a soluble form and rendering the formulation isotonic with the blood of the intended recipient.
  • aqueous and nonaqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats, co-solvents, surface active agents, organic solvent mixtures, cyclodextrin complexation agents, emulsifying agents (for forming and stabilizing emulsion formulations), liposome components for forming liposomes, gellable polymers for forming
  • compositions for parenteral administration may also take the form of aqueous and nonaqueous sterile suspensions which may include suspending agents and thickening agents (R. G. Strickly, Solubilizing Excipients in oral and injectable formulations, Pharmaceutical Research, Vol 21 (2) 2004, p 201-230).
  • formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules, vials and prefilled syringes, and may be stored in a freeze-dried
  • the pharmaceutical formulation can be prepared by lyophilising a compound of the invention. Lyophilisation refers to the procedure of freeze-drying a composition. Freeze- drying and lyophilisation are therefore used herein as synonyms.
  • Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets.
  • compositions of the present invention for parenteral injection can also comprise pharmaceutically acceptable sterile aqueous or non-aqueous solutions, dispersions, suspensions or emulsions as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use.
  • aqueous and non-aqueous carriers, diluents, solvents or vehicles examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), carboxymethylcellulose and suitable mixtures thereof, vegetable oils (such as sunflower oil, safflower oil, corn oil or olive oil), and injectable organic esters such as ethyl oleate.
  • polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
  • carboxymethylcellulose and suitable mixtures thereof examples include vegetable oils (such as sunflower oil, safflower oil, corn oil or olive oil), and injectable organic esters such as ethyl oleate.
  • Proper fluidity can be maintained, for example, by the use of thickening or coating materials such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions of the present invention may also contain adjuvants such as
  • the pharmaceutical composition is in a form suitable for i.v. administration, for example by injection or infusion.
  • the solution can be dosed as is, or can be injected into an infusion bag (containing a pharmaceutically acceptable excipient, such as 0.9% saline or 5% dextrose), before administration.
  • the pharmaceutical composition is in a form suitable for subcutaneous (s.c.) administration.
  • the compound of the invention may be formulated with a carrier and administered in the form of nanoparticles, the increased surface area of the nanoparticles assisting their absorption.
  • nanoparticles offer the possibility of direct penetration into the cell.
  • Nanoparticle drug delivery systems are described in "Nanoparticle Technology for Drug Delivery", edited by Ram B Gupta and Uday B. Kompella, Informa Healthcare, ISBN 9781574448573, published 13 th March 2006. Nanoparticles for drug delivery are also described in J. Control. Release, 2003, 91 (1-2), 167-172, and in Sinha ef a/.,Mol. Cancer Ther. August 1 , (2006) 5, 1909.
  • compositions typically comprise from approximately 1 % (w/w) to approximately 95% (w/w) active ingredient and from 99% (w/w) to 5% (w/w) of a
  • compositions comprise from approximately 20% (w/w) to approximately 90%(w/w) active ingredient and from 80% (w/w) to 10% of a pharmaceutically acceptable excipient or combination of excipients.
  • the pharmaceutical compositions comprise from approximately 1 % to approximately 95%, preferably from approximately 20% to approximately 90%, active ingredient.
  • Pharmaceutical compositions according to the invention may be, for example, in unit dose form, such as in the form of ampoules, vials, suppositories, pre-filled syringes, dragees, tablets or capsules.
  • the pharmaceutically acceptable excipient(s) can be selected according to the desired physical form of the formulation and can, for example, be selected from diluents (e.g solid diluents such as fillers or bulking agents; and liquid diluents such as solvents and co- solvents), disintegrants, buffering agents, lubricants, flow aids, release controlling (e.g. release retarding or delaying polymers or waxes) agents, binders, granulating agents, pigments, plasticizers, antioxidants, preservatives, flavouring agents, taste masking agents, tonicity adjusting agents and coating agents.
  • diluents e.g solid diluents such as fillers or bulking agents; and liquid diluents such as solvents and co- solvents
  • disintegrants e.g solid diluents such as fillers or bulking agents
  • lubricants such as solvents and co- solvents
  • flow aids e.g. release retard
  • tablets and capsules typically contain 0-20% disintegrants, 0-5% lubricants, 0-5% flow aids and/or 0-99% (w/w) fillers/ or bulking agents (depending on drug dose). They may also contain 0-10% (w/w) polymer binders, 0-5% (w/w) antioxidants, 0-5% (w/w) pigments. Slow release tablets would in addition contain 0-99% (w/w) release-controlling (e.g. delaying) polymers (depending on dose).
  • the film coats of the tablet or capsule typically contain 0-10% (w/w) polymers, 0-3% (w/w) pigments, and/or 0-2% (w/w) plasticizers.
  • Parenteral or subcutaneous formulations typically contain 0-20% (w/w) buffers, 0-50% (w/w) cosolvents, and/or 0-99% (w/w) Water for Injection (WFI) (depending on dose and if freeze dried).
  • WFI Water for Injection
  • Formulations for intramuscular depots may also contain 0-99% (w/w) oils.
  • the compounds of the invention can also be formulated as solid dispersions.
  • Solid dispersions are homogeneous extremely fine disperse phases of two or more solids.
  • Solid solutions molecularly disperse systems
  • one type of solid dispersion are well known for use in pharmaceutical technology (see (Chiou and Riegelman, J. Pharm. Sci., 60, 1281- 1300 (1971)) and are useful in increasing dissolution rates and increasing the bioavailability of poorly water-soluble drugs.
  • the pharmaceutical formulations may be presented to a patient in "patient packs" containing an entire course of treatment in a single package, usually a blister pack.
  • Patient packs have an advantage over traditional prescriptions, where a pharmacist divides a patient's supply of a pharmaceutical from a bulk supply, in that the patient always has access to the package insert contained in the patient pack, normally missing in patient prescriptions.
  • the inclusion of a package insert has been shown to improve patient compliance with the physician's instructions.
  • One example of a patient pack includes a prefilled syringe. Such pre-filled syringes already contain the drug substance.
  • the front end portion of a pre-filled syringe to which a needle is to be attached is sealed with a nozzle cap. Prior to injection, the nozzle cap is removed from the front end portion and a needle is attached thereto. A gasket is then slid by pushing a plunger rod toward the front end portion so that the drug is expelled.
  • compositions for nasal delivery include ointments, creams, sprays, patches, gels, liquid drops and inserts (for example intraocular inserts). Such compositions can be formulated in accordance with known methods.
  • formulations for rectal or intra-vaginal administration include pessaries and suppositories which may be, for example, formed from a shaped moldable or waxy material containing the active compound. Solutions of the active compound may also be used for rectal administration.
  • compositions for administration by inhalation may take the form of inhalable powder compositions or liquid or powder sprays, and can be administrated in standard form using powder inhaler devices or aerosol dispensing devices. Such devices are well known.
  • the powdered formulations typically comprise the active compound together with an inert solid powdered diluent such as lactose.
  • the compound of the invention will generally be presented in unit dosage form and, as such, will typically contain sufficient compound to provide a desired level of biological activity.
  • a formulation may contain from 1 nanogram to 2 grams of active ingredient, e.g. from 1 nanogram to 2 milligrams of active ingredient. Within these ranges, particular subranges of compound are 0.1 milligrams to 2 grams of active ingredient (more usually from 10 milligrams to 1 gram, e.g. 50 milligrams to 500 milligrams), or 1 microgram to 20 milligrams (for example 1 microgram to 10 milligrams, e.g. 0.1 milligrams to 2 milligrams of active ingredient).
  • the active compound will be administered to a patient in need thereof (for example a human or animal patient) in an amount sufficient to achieve the desired therapeutic effect.
  • a method of treating cancer which comprises administering to an individual in need thereof a compound of formula (I) as defined herein.
  • cancers and their benign counterparts
  • cancers include, but are not limited to tumours of epithelial origin (adenomas and carcinomas of various types including adenocarcinomas, squamous carcinomas, transitional cell carcinomas and other carcinomas) such as carcinomas of the bladder and urinary tract, breast, gastrointestinal tract (including the esophagus, stomach (gastric), small intestine, colon, rectum and anus), liver (hepatocellular carcinoma), gall bladder and biliary system, exocrine pancreas, kidney, lung(for example adenocarcinomas, small cell lung carcinomas, non-small cell lung carcinomas, bronchioalveolar carcinomas and mesotheliomas), head and neck (for example cancers of the tongue, buccal cavity, larynx,
  • tumours of epithelial origin adenomas and carcinomas of various
  • lymphoid lineage for example acute lymphocytic leukemia [ALL], chronic lymphocytic leukemia [CLL], B-cell lymphomas such as diffuse large B-cell lymphoma
  • DLBCL follicular lymphoma
  • Burkitt's lymphoma mantle cell lymphoma
  • T-cell lymphomas and leukaemias natural killer [NK] cell lymphomas
  • NK natural killer
  • Hodgkin's lymphomas hairy cell leukaemia
  • monoclonal gammopathy of uncertain significance plasmacytoma, multiple myeloma, and post-transplant lymphoproliferative disorders
  • haematological malignancies and related conditions of myeloid lineage for example acute
  • AML acute myelogenousleukemia
  • CML chronic myelogenousleukemia
  • CMML myelomonocyticleukemia
  • hypereosinophilic syndrome myeloproliferative disorders such as polycythaemia vera, essential thrombocythaemia and primary myelofibrosis, myeloproliferative syndrome, myelodysplasia syndrome, and promyelocyticleukemia
  • myeloproliferative disorders such as polycythaemia vera, essential thrombocythaemia and primary myelofibrosis, myeloproliferative syndrome, myelodysplasia syndrome, and promyelocyticleukemia
  • tumours of mesenchymal origin for example sarcomas of soft tissue, bone or cartilage such as osteosarcomas, fibrosarcomas, chondrosarcomas, rhabdomyosarcomas,
  • tumours of the central or peripheral nervous system for example astrocytomas, gliomas and glioblastomas, meningiomas, ependymomas, pineal tumours and schwannomas
  • endocrine tumours for example pituitary tumours, adrenal tumours, islet cell tumours, parathyroid tumours, carcinoid tumours and medullary carcinoma of the thyroid
  • ocular and adnexal tumours for example retinoblastoma
  • germ cell and trophoblastic tumours for example teratomas, seminomas, dysger
  • the cancer is selected from lung, head and neck as well as colorectal cancer.
  • anticancer therapeutic agents or treatments that may be administered together (whether concurrently or at different time intervals) with the compound of the invention include but are not limited to:
  • the compound of the invention may also be administered in conjunction with non- chemotherapeutic treatments such as radiotherapy, photodynamic therapy, gene therapy; surgery and controlled diets.
  • non- chemotherapeutic treatments such as radiotherapy, photodynamic therapy, gene therapy; surgery and controlled diets.
  • the compound of the invention and one, two, three, four or more other therapeutic agents can be, for example, formulated together in a dosage form containing two, three, four or more therapeutic agents i.e. in a unitary pharmaceutical composition containing all components.
  • the individual therapeutic agents may be formulated separately and presented together in the form of a kit, optionally with instructions for their use.
  • the compound of the invention is generally administered to a subject in need of such administration, for example a human or animal patient, preferably a human.
  • the compound of the invention will typically be administered in amounts that are
  • the compound of the invention may be administered over a prolonged term (i.e. chronic administration) to maintain beneficial therapeutic effects or may be administered for a short period only (i.e. acute administration). Alternatively, they may be administered in a continuous manner or in a manner that provides intermittent dosing (e.g. a pulsatile manner).
  • a typical daily dose of the compound of the invention can be in the range from 100 picograms to 100 milligrams per kilogram of body weight, more typically 5 nanograms to 25 milligrams per kilogram of bodyweight, and more usually 10 nanograms to 15 milligrams per kilogram (e.g. 10 nanograms to 10 milligrams, and more typically 1 microgram per kilogram to 20 milligrams per kilogram, for example 1 microgram to 10 milligrams per kilogram) per kilogram of bodyweight although higher or lower doses may be administered where required.
  • the compound of the invention can either be administered on a daily basis or on a repeat basis every 2, or 3, or 4, or 5, or 6, or 7, or 10 or 14, or 21 , or 28 days for example.
  • the compound of the invention can be administered by infusion, multiple times per day.
  • the compound of the invention may be administered in a range of doses, for example 1 to 1500 mg, 2 to 800 mg, or 5 to 500 mg, e.g. 2 to 200 mg or 10 to 1000 mg, particular examples of doses including 10, 20, 50 and 80 mg.
  • the compound of the invention may be administered once or more than once each day.
  • the compound of the invention can be administered continuously (i.e. taken every day without a break for the duration of the treatment regimen).
  • the compound of the invention can be administered intermittently (i.e. taken continuously for a given period such as a week, then discontinued for a period such as a week and then taken continuously for another period such as a week and so on throughout the duration of the treatment regimen).
  • treatment regimens involving intermittent administration include regimens wherein administration is in cycles of one week on, one week off; or two weeks on, one week off; or three weeks on, one week off; or two weeks on, two weeks off; or four weeks on two weeks off; or one week on three weeks off - for one or more cycles, e.g. 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more cycles.
  • a patient will be given an infusion of a compound of the invention for periods of one hour daily for up to ten days in particular up to five days for one week, and the treatment repeated at a desired interval such as two to four weeks, in particular every three weeks. More particularly, a patient may be given an infusion of a compound of the invention for periods of one hour daily for 5 days and the treatment repeated every three weeks.
  • a patient is given an infusion over 30 minutes to 1 hour followed by maintenance infusions of variable duration, for example 1 to 5 hours, e.g. 3 hours.
  • a patient is given a continuous infusion for a period of 12 hours to 5 days, and in particular a continuous infusion of 24 hours to 72 hours.
  • the quantity of compound of the invention administered and the type of composition used will be commensurate with the nature of the disease or physiological condition being treated and will be at the discretion of the physician.
  • the compound of the invention can be used as a single agent or in combination with other therapeutic agents. Combination experiments can be performed, for example, as described in Chou TC, Talalay P. Quantitative analysis of dose-effect relationships: the combined effects of multiple drugs or enzyme inhibitors. Adv Enzyme Regulat 1984;22: 27-55.
  • the compound of the invention is administered in combination therapy with one, two, three, four or more other therapeutic agents (preferably one or two, more preferably one)
  • the agents can be administered simultaneously or sequentially. In the latter case, the two or more agents will be administered within a period and in an amount and manner that is sufficient to ensure that an advantageous or synergistic effect is achieved.
  • the weight ratio of the compound of the invention and the one or more other therapeutic agent(s) when given as a combination may be determined by the person skilled in the art. Said ratio and the exact dosage and frequency of administration depends on the particular compound of the invention and the other therapeutic agent(s) used, the particular condition being treated, the severity of the condition being treated, the age, weight, gender, diet, time of administration and general physical condition of the particular patient, the mode of administration as well as other medication the individual may be taking, as is well known to those skilled in the art. Furthermore, it is evident that the effective daily amount may be lowered or increased depending on the response of the treated subject and/or depending on the evaluation of the physician prescribing the compound of present invention. A particular weight ratio for the compound of the invention and another therapeutic agent may range from 1/10 to 10/1 , more in particular from 1/5 to 5/1 , even more in particular from 1/3 to 3/1.
  • Gilson TRILUTIONTM comprising: Gilson 215 liquid handler; Gilson 81 1C dynamic mixer; Gilson 306 pumps, Gilson manometric module; Gilson 155 UV/Vis detector, Gilson 819 injection value actuator and a Gilson valvemate II value actuator.
  • Methods were run as specified in the individual experimental using either a Phenomenex Luna C-18, 5 ⁇ , 150 x 21.20 mm, 100 A (product number 00F-4041-P0) column or Phenomenex Magellen C-18, 5 ⁇ , 150 x 10,00 mm (product number OOF-41 18- N0) column and collecting at the Amax in 2 mL fractions.
  • preparative HPLC may be performed at room temperature using a Varian auto- purification system with an Agilent Pursuit 5 Column (C18, 5 ⁇ , 21.2mm x 250mm), controlled by Varian Star software (version 6.41)
  • Mobile phases consisted of acetonitrile and water, both containing 0.1 % v/v formic acid.
  • aq. is aqueous
  • Boc is tert-butyloxycarbonyl
  • br s is broad singlet
  • is chemical shift in ppm
  • dd is doublet of doublets
  • ddd is doublet of doublets of doublets
  • DCM is dichloromethane
  • DIPEA is diisopropylethylamine
  • DMF is dimethylformamide
  • DMTMM is 4-(4,6-Dimethoxy-1 ,3,5-triazin-2-yl)-4-methylmorpholinium chloride or
  • DMSO dimethylsulphoxide
  • DMSO-d6 is perdeuterated dimethylsulphoxide NMR solvent
  • DNA is deoxyribonucleic acid
  • EtOAc is ethyl acetate
  • HATU is 0-(7-azabenzotriazol-1-yl)-N,N,N',N'-tetramethyluronium hexafluorophosphate
  • HFIP is hexafluoroisopropanol
  • HPLC high pressure liquid chromatography
  • IMS is industrial methylated spirit (typically 5%-10% MeOH in EtOH);
  • is micro
  • m is multiplet
  • MeCN is acetonitrile
  • MeOH is methanol
  • ml_ is millilitre
  • MS is mass spectrometry
  • NH 3 is ammonia or ammonium hydroxide (28% aqueous solution);
  • NMR nuclear magnetic resonance
  • OD optical density
  • Pd/C is (typically 5%-10%) palladium on charcoal hydrogenation catalyst (water-wet);
  • Pd(PPh 3 )4 is tetrakis triphenylphosphine palladium (0);
  • ppm is parts per million
  • RNA is ribonucleic acid
  • Rt is retention time
  • t is triplet
  • TBAF is tetra-n-butylammonium fluoride
  • TBME is tert-butyl methyl ether
  • TEA is triethylamine
  • TEAA is triethylammonium acetate
  • TBS is tert-butyldimethylsilyloxy
  • TFA is trifluoroacetic acid
  • TFAA is trifluoroacetic anhydride
  • THF is tetrahydrofuran
  • This intermediate may be prepared according to the methods described by Bovin et al (Mendeleev Communications (2002), (4), 143-145).
  • Preparations 1 -62 describe the methods used to prepare intermediates from the key linker molecules required for conjugation into the Examples, as described by Processes (a) to (c) and Schemes 1 -2 as described hereinbefore.
  • the reaction was put under an atmosphere of hydrogen (70 psi) and stirred for 3 hours at room temperature.
  • the catalyst was removed by filtration through Dicalite and concentrated in vacuo.
  • the residue was purified using reverse phase column chromatography (Biotage SP1 , 4 g, C-18 column, eluting with 2-30% MeCN/water with 0.1 % NH3) to afford the title compound as a colourless solid (64.1 mg, 93%).
  • Preparation 2 may also be prepared according to the following Method:
  • the title compound was prepared according to the method described by Preparation 6 using alpha-Gal (100 mg, 166 ⁇ ⁇ ) and 2,2',2"-((5'-((benzyloxy)carbonyl)-[1 , 1 '-biphenyl]- 3,3',5-triyl)tris(oxy))triacetic acid (Preparation 16, 21.2 mg, 41.5 ⁇ ) and isolated as a colourless solid (71.2 mg, 76%).
  • the reaction was concentrated in vacuo and purified using reverse phase column chromatograhy (Biotage SP1 , 12 g, C-18 column, eluting with 7-60% MeCN/water with 0.1 % NH3).
  • the desired residue was freeze-dried and further purified (Biotage SP1 , 12 g, C-18 column, eluting with 7-60% MeCN/water with 0.1 % N H3).
  • the residue was freeze dried to afford the title compound as a colourless solid (99 mg 47%).
  • HATU (58.3 mg, 153 ⁇ ) was added and the reaction was left to stir for 1 hour under nitrogen at room temperature.
  • the reaction was concentrated in vacuo and purified using reverse phase column chromatography (Biotage SP1 , 10 g, C-18 column, eluting with 5-40% MeCN/water with 0.1 % NH 3 ).
  • Preparations 21 -37 were prepared according to the method described for Preparation 20, a two-step reaction protocol comprising: Step 1) addition of aminopropyl-linked alpha-Gal employing a standard amide bond forming step, followed by: Step 2) deprotection of the benzyl protected benzoic/carboxylic acid intermediate, starting from the appropriate carboxylic acid precursor as described below.
  • the reactions were stirred from between 1-24 hours for Step 1 , hydrogenated for between 1-3 hours at from 50-80 psi for Step 2, and purified using the reverse-phase purification conditions as described below unless otherwise specified:
  • the resulting solid was filtered, washed with EtOAc and purified by silica gel column chromatography eluting with 2- 6% MeOH in DCM.
  • the resulting white solid (338.0 mg, 0.511 mmol) was dissolved in dioxane (6.76 ml_) and 4M HCI in dioxane (1.28 ml_, 5.12 mmol) was added.
  • the reaction mixture was stirred at room temperature for 18 hours and concentrated in vacuo.
  • the resulting solid was suspended in TBME (10 ml_), filtered, washed with TBME and dried for 1 hour under vacuum to afford the title compound as a white solid (271 mg, 89%).
  • Biotage SP1 (C-18 column, eluting with from between 2-100% MeCN/water with 0.1 % NH 3 ) or Biotage SP1 (C-18 column, eluting with from between 0-80% MeCN/water with 0.1 % formic acid).
  • Precursors Preparation 16 and 4-aminobutanoic acid.
  • reaction mixture was cooled to room temperature and NaHCOs (267.0 mg, 3.18 mmol), tri-tert-butyl 2,2',2"-((5- bromobenzene-1 ,2,3-triyl)tris(oxy))triacetate (580.0 mg, 1.06 mmol) and additional [1 , 1 - bis(diphenylphosphino)ferrocene]dichloropalladium(ll), complex with dichloromethane (86.0 mg, 0.106 mmol) was added.
  • the reaction was heated at 100 °C under nitrogen for 4 hours before cooling to room temperature.
  • the reaction was concentrated in vacuo and the residue was partitioned between EtOAc (25 mL) and water (25 mL).
  • reaction was concentrated in vacuo and purified using reverse phase column chromatography (Biotage SP1 , 60 g, C-18 column, eluting with 5-70% MeCN/water with 0.1 % formic acid) to afford the title compound as a yellow oil.
  • RNA aptamer C6-amino-linked-SEQ ID NO: 79 from International Patent Application No. PCT/GB2015/051812; herein referred to as SEQ ID NO: 1
  • SEQ ID NO: 1 RNA aptamer
  • aqueous carbonate buffer aqueous carbonate buffer
  • the reaction was quenched by the addition of TEAA and purified using reverse phase HPLC using XBridge Prep C18 column (10 x 50 mm, 5 ⁇ ) eluting with a gradient of 5-20% TEAA in MeCN in aqueous TEAA.
  • the title compound was collected to afford 260D (1 mg).
  • RNA aptamer 1 C 6 -amino-linked-SEQ ID NO:79, PCT/GB2015/051812; herein referred to as
  • nucleic acid aptamers used herein may be synthesised in accordance with techniques within the common general knowledge, such as solid phase nucleotide synthesis (CR Noe, L Kaufhold; Chemistry of Antisense Oligonucleotides in New Trends in Synthetic Medicinal Chemistry, Ed: F Gualtieri; Wiley-VCH, Weinheim, 2000; pp261-347. ISBN 3527297995).
  • ASSAYS ASSAYS
  • Flow cytometry was used to demonstrate binding of L (as an EGFR nucleic acid aptamer, RNA aptamer 1 , Ce-amino-linked-SEQ ID NO:79, PCT/GB2015/051812; herein referred to as SEQ ID NO: 1) to a receptor on a human cell line and F (as the carbohydrate molecule capable of binding to a human anti-alpha-galactosyl antibody).
  • A431 cells are used to capture the EGFR nucleic acid aptamer as it is well known that the cells significantly over- express the EGFR receptor.
  • a secondary phycoerythrin labelled anti-human IgG antibody was used to detect binding of alpha-galactosyl IgG antibody to the compound.
  • the compounds were used directly in the assay or heated to 70°C for 10 minutes and cooled to room temperature for 10 minutes prior to use in the assay.
  • A431 cells (ATCC CRL-1555) were harvested and resuspended at 5 x 10 6 cells/ml_ in phosphate buffered saline (PBS) (Sigma D8662) + 0.1 % BSA (Bovine Serum Albumin - Sigma A2153) + 0.1 mg/mL Yeast t-RNA (Invitrogen 15401-01 1) + 5 mM MgCI 2 (Sigma M1028) and incubated on ice for 30 minutes to block. 5 x 10 5 cells were then incubated with compound at various concentrations as described below or buffer alone at room
  • Anti-alpha galactosyl IgG antibody was purified from human IVIG (Gammagard) by affinity purification using an alpha-galactosyl-HSA (Human Serum Albumin) sepharose column by Rockland
  • Figure 1 demonstrates the capture of anti-alpha galactosyl IgG antibodies to the cell surface using Example 1 (Figure 1A), Example 2 ( Figure 1 B) and Example 3 ( Figure 1C).
  • the shift in fluorescence intensity (PE) occurs due to the binding event at each end of the molecule.
  • Figure 2 is a dose titration of Examples 1-3 using the Flow Cytometry assay described.
  • Figure 2 demonstrates a difference in recruitment of anti-galactosyl antibodies to the human cancer cell line A431 by Examples 1-3. Increasing recruitment is reported by an increase in Mean Fluorescence Intensity (MFI) emanating from the fluorescently labelled secondary antibody.
  • MFI Mean Fluorescence Intensity
  • Table 2 demonstrates binding activity of Examples 4-17 using the flow cytometry assay described above.
  • the fold shift over background was calculated by dividing the Mean Fluorescence Intensity (MFI) obtained in the presence of 10 nM or 1 ⁇ alphamer by the Mean Fluorescence Intensity (MFI) obtained in the absence of alphamer.
  • MFI Mean Fluorescence Intensity
  • the fold shift over background is reported as a geometric mean with standard error in brackets. The number of independent experiments is also reported. In order to achieve a signal both ends of the molecule are required to bind (aptamer to EGFR on the cell surface of the A431 cells and alpha-galactosyl to anti-alpha galactosyl antibodies).
  • Figure 3 demonstrates the capture of anti-alpha galactosyl antibodies to the cell surface using Example 18 (Figure 3A), Example 19 (Figure 3B), Example 20 (Figure 3C) and Example 21 ( Figure 3D).
  • the shift in fluorescence intensity (PE) occurs due to the binding event at each end of the molecule.
  • Figure 4 is a dose titration of Examples 18-21 using the Flow Cytometry assay described.
  • Figure 4 demonstrates a difference in recruitment of anti-galactosyl antibodies to the human cancer cell line A431 by Examples 18-21. Increasing recruitment is reported by an increase in fold shift over background.
  • L as an EGFR nucleic acid aptamer, RNA aptamer 1 , Ce-amino-linked-SEQ ID NO:79, PCT/GB2015/051812; herein referred to as SEQ ID NO: 1
  • F as the carbohydrate molecule capable of binding to a human anti-alpha-galactosyl antibody
  • A431 cells are used to capture the EGFR nucleic acid aptamer as it is well known that the cells significantly over- express the EGFR receptor.
  • a secondary FITC (fluorescein) labelled anti-human IgM antibody was used to detect binding of the alpha-galactosyl IgM antibody to the compound.
  • the compounds were heated to 70°C for 10 minutes and cooled to room temperature for 10 minutes prior to use in the assay.
  • A431 cells (ATCC CRL-1555) were harvested and resuspended at 5 x 10 6 cells/mL in phosphate buffered saline (PBS) (Sigma D8662) + 0.1 % BSA (Bovine Serum Albumin - Sigma A2153) + 0.1 mg/mL Yeast t-RNA (Invitrogen 15401-011) + 5 mM MgCI 2 (Sigma M1028) and incubated on ice for 30 minutes to block. 5 x 10 5 cells were then incubated with compound at 3 ⁇ as described below or buffer alone at room temperature, shaking at 450 rpm for 1 hour.
  • PBS phosphate buffered saline
  • BSA Bovine Serum Albumin - Sigma A2153
  • Yeast t-RNA Invitrogen 15401-011
  • 5 mM MgCI 2 Sigma M1028
  • the cells were washed with 3 x 200 ⁇ _ PBS + 0.1 % BSA, prior to adding 50 ⁇ _ of an Anti-alpha galactosyl IgM antibody at 32 ⁇ g/mL in PBS+ 0.1 % BSA and incubating at 4 °C for 1 hour.
  • the Anti-alpha galactosyl IgM antibody is a custom engineered Human IgM Antibody which uses an M86 anti-alpha galactosyl antibody obtained from Absolute Antibody and has the following variable region amino acid sequences:
  • VH EVKLDETGGGLVQPGRSMKLSCVASGFIFSDYWMNWVRQSP
  • VL DVLVTQNPLSLSVSLGDQASISCRSSQNLVHNDGNTYLHWYL
  • the cells were further washed with 3 x 200 ⁇ _ PBS + 0.1 % BSA before being treated with 100 ⁇ _ 1 :40 dilution of Anti-Human IgM-FITC (Biolegend 314506) at 4 °C for 1 hour. After a final wash of 3 x 200 ⁇ _ PBS + 0.1 % BSA the cells were resuspended in 200 ⁇ _ PBS + 0.1 % BSA and evaluated on a flow cytometer (FC500 Beckman Coulter). Data from all samples were analysed in the Kaluza software package (Beckman Coulter).
  • Figure 5 demonstrates the capture of anti-alpha galactosyl IgM antibodies to the cell surface using Example 1 (Figure 5A), Example 2 ( Figure 5B) and Example 3 ( Figure 5C).
  • the shift in fluorescence intensity (FITC) occurs due to the binding event at each end of the molecule.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Air Filters, Heat-Exchange Apparatuses, And Housings Of Air-Conditioning Units (AREA)
  • Central Air Conditioning (AREA)
PCT/GB2016/053133 2015-10-08 2016-10-07 Compounds and therapeutic uses thereof Ceased WO2017060728A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1517859.3 2015-10-08
GBGB1517859.3A GB201517859D0 (en) 2015-10-08 2015-10-08 Novel compounds and therapeutic uses thereof

Publications (1)

Publication Number Publication Date
WO2017060728A1 true WO2017060728A1 (en) 2017-04-13

Family

ID=55130801

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/GB2016/053133 Ceased WO2017060728A1 (en) 2015-10-08 2016-10-07 Compounds and therapeutic uses thereof
PCT/GB2016/053134 Ceased WO2017060729A1 (en) 2015-10-08 2016-10-07 Compounds and therapeutic uses thereof

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/GB2016/053134 Ceased WO2017060729A1 (en) 2015-10-08 2016-10-07 Compounds and therapeutic uses thereof

Country Status (9)

Country Link
US (2) US10953100B2 (cg-RX-API-DMAC7.html)
EP (1) EP3359201A1 (cg-RX-API-DMAC7.html)
JP (1) JP7065775B2 (cg-RX-API-DMAC7.html)
CN (1) CN108472381B (cg-RX-API-DMAC7.html)
AU (1) AU2016335365B2 (cg-RX-API-DMAC7.html)
GB (1) GB201517859D0 (cg-RX-API-DMAC7.html)
IL (1) IL258511B (cg-RX-API-DMAC7.html)
WO (2) WO2017060728A1 (cg-RX-API-DMAC7.html)
ZA (1) ZA201802256B (cg-RX-API-DMAC7.html)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018051085A1 (en) * 2016-09-13 2018-03-22 Centauri Therapeutics Limited Novel compounds and therapeutic uses thereof
WO2018185494A1 (en) * 2017-04-07 2018-10-11 Centauri Therapeutics Limited Novel compounds and therapeutic uses thereof
WO2018185495A1 (en) * 2017-04-07 2018-10-11 Centauri Therapeutics Limited Novel compounds and therapeutic uses thereof
EA038112B1 (ru) * 2017-05-04 2021-07-07 Сентаури Терапьютикс Лимитед Новые соединения и их терапевтические применения
US11406683B2 (en) 2017-05-04 2022-08-09 Centauri Therapeutics Limited (GB/GB) Compounds and therapeutics uses thereof
US12458706B2 (en) 2018-10-10 2025-11-04 Avvinity Therapeutics Limited Compounds and therapeutic uses thereof

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111748089B (zh) * 2019-03-28 2023-07-18 成都先导药物开发股份有限公司 一种生物素标记化合物以及确定化合物结合靶标蛋白的方法
CN116535449B (zh) * 2023-03-22 2025-09-16 华东理工大学 一种糖基没食子酸类衍生物及其制备方法与在制备乳腺癌靶向诊疗材料中的应用
GB202406865D0 (en) 2024-05-15 2024-06-26 Centauri Therapeutics Ltd Novel compounds and therapeutics uses thereof

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005079423A2 (en) * 2004-01-09 2005-09-01 Mullis Kary B Chemically programmable immunity
US20100285052A1 (en) * 2009-05-05 2010-11-11 Mullis Kary B Chemically Programmable Immunity
US20150190529A1 (en) * 2013-10-11 2015-07-09 The University Of Kansas Targeting multiple receptors on a cell surface for specific cell targeting
WO2015198024A1 (en) * 2014-06-23 2015-12-30 Altermune Limited Aptamers against egfr and therapeutic uses thereof

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6172045B1 (en) 1994-12-07 2001-01-09 Neorx Corporation Cluster clearing agents
EP2322209A3 (en) 2002-08-20 2012-02-01 Glykos Finland Oy Tumor specific oligosaccharide epitopes and use thereof
JP4430344B2 (ja) * 2002-09-09 2010-03-10 独立行政法人科学技術振興機構 多岐用途型リンカー化合物及びリガンド、並びにそれらの製造方法
EP1653977A2 (en) 2003-07-17 2006-05-10 THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES Treatment of disorders associated with natural killer t cells
CN101360728A (zh) * 2005-10-25 2009-02-04 艾吉拉医疗股份有限公司 Iap bir结构域结合化合物
US7998486B2 (en) 2006-10-25 2011-08-16 Newlink Genetics Corporation Enhanced immunogenicity of tumor associated antigens by addition of alphaGal epitopes

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005079423A2 (en) * 2004-01-09 2005-09-01 Mullis Kary B Chemically programmable immunity
US20100285052A1 (en) * 2009-05-05 2010-11-11 Mullis Kary B Chemically Programmable Immunity
US20150190529A1 (en) * 2013-10-11 2015-07-09 The University Of Kansas Targeting multiple receptors on a cell surface for specific cell targeting
WO2015198024A1 (en) * 2014-06-23 2015-12-30 Altermune Limited Aptamers against egfr and therapeutic uses thereof

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
G. E. WINTER ET AL: "Phthalimide conjugation as a strategy for in vivo target protein degradation", SCIENCE, vol. 348, no. 6241, 19 June 2015 (2015-06-19), pages 1376 - 1381, XP055328122, ISSN: 0036-8075, DOI: 10.1126/science.aab1433 *
SASCHA A. KRISTIAN ET AL: "Retargeting pre-existing human antibodies to a bacterial pathogen with an alpha-Gal conjugated aptamer", JOURNAL OF MOLECULAR MEDICINE., vol. 93, no. 6, 5 May 2015 (2015-05-05), DE, pages 619 - 631, XP055327406, ISSN: 0946-2716, DOI: 10.1007/s00109-015-1280-4 *

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018051085A1 (en) * 2016-09-13 2018-03-22 Centauri Therapeutics Limited Novel compounds and therapeutic uses thereof
US11014966B2 (en) 2016-09-13 2021-05-25 Centuari Therapeutics Limited Compounds and therapeutics uses thereof
WO2018185494A1 (en) * 2017-04-07 2018-10-11 Centauri Therapeutics Limited Novel compounds and therapeutic uses thereof
WO2018185495A1 (en) * 2017-04-07 2018-10-11 Centauri Therapeutics Limited Novel compounds and therapeutic uses thereof
IL270460B1 (en) * 2017-04-07 2023-05-01 Centauri Therapeutics Ltd New compounds and their medicinal uses
IL270460B2 (en) * 2017-04-07 2023-09-01 Centauri Therapeutics Ltd New compounds and their medicinal uses
US11766483B2 (en) 2017-04-07 2023-09-26 Centauri Therapeutics Limited (GB/GB) Compounds and therapeutics uses thereof
EA038112B1 (ru) * 2017-05-04 2021-07-07 Сентаури Терапьютикс Лимитед Новые соединения и их терапевтические применения
US11406683B2 (en) 2017-05-04 2022-08-09 Centauri Therapeutics Limited (GB/GB) Compounds and therapeutics uses thereof
US12138292B2 (en) 2017-05-04 2024-11-12 Centauri Therapeutics Limited (GB/GB) Compounds and therapeutics uses thereof
US12458706B2 (en) 2018-10-10 2025-11-04 Avvinity Therapeutics Limited Compounds and therapeutic uses thereof

Also Published As

Publication number Publication date
AU2016335365B2 (en) 2021-12-09
US20210369850A1 (en) 2021-12-02
AU2016335365A1 (en) 2018-04-26
CA3001084A1 (en) 2017-04-13
WO2017060729A1 (en) 2017-04-13
CN108472381B (zh) 2023-06-06
US10953100B2 (en) 2021-03-23
JP2018531287A (ja) 2018-10-25
EP3359201A1 (en) 2018-08-15
CN108472381A (zh) 2018-08-31
IL258511A (en) 2018-06-28
GB201517859D0 (en) 2015-11-25
ZA201802256B (en) 2019-01-30
US20180280521A1 (en) 2018-10-04
JP7065775B2 (ja) 2022-05-12
IL258511B (en) 2021-10-31
NZ741118A (en) 2024-07-26

Similar Documents

Publication Publication Date Title
WO2017060728A1 (en) Compounds and therapeutic uses thereof
JP2018531287A6 (ja) 化合物及びそれらの治療用途
US20150164909A1 (en) Antitumor effect potentiator composed of imidazooxazine compound
JP2022184922A (ja) 新規化合物及びその治療上の使用
JP2024150440A (ja) 化合物及びその治療的使用
EP3606561B1 (en) Novel compounds and therapeutic uses thereof
WO2020201743A1 (en) Novel compounds and therapeutic uses thereof
EP3606558B1 (en) Novel compounds and therapeutic uses thereof
CA3001084C (en) Aptamer or biotin conjugates for the treatment of cancer or infectious diseases
HK40023976B (en) Novel compounds and therapeutic uses thereof
HK40023976A (en) Novel compounds and therapeutic uses thereof
CA3036405C (en) Novel compounds and therapeutic uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16781186

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16781186

Country of ref document: EP

Kind code of ref document: A1