WO2016198544A1 - Protease-resistant lipidated glp-1 analogs - Google Patents

Protease-resistant lipidated glp-1 analogs Download PDF

Info

Publication number
WO2016198544A1
WO2016198544A1 PCT/EP2016/063206 EP2016063206W WO2016198544A1 WO 2016198544 A1 WO2016198544 A1 WO 2016198544A1 EP 2016063206 W EP2016063206 W EP 2016063206W WO 2016198544 A1 WO2016198544 A1 WO 2016198544A1
Authority
WO
WIPO (PCT)
Prior art keywords
peg
polypeptide
lipid modified
peptide
ahx
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2016/063206
Other languages
English (en)
French (fr)
Inventor
Jefferson D REVELL
Maria A BEDNAREK
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
MedImmune Ltd
Original Assignee
MedImmune Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020177037653A priority Critical patent/KR20180016441A/ko
Priority to ES16732248T priority patent/ES2849950T3/es
Priority to EA201792640A priority patent/EA036415B1/ru
Priority to MX2017015482A priority patent/MX389407B/es
Priority to EP20202888.2A priority patent/EP3865504A1/en
Priority to CN201680033320.4A priority patent/CN108271373B/zh
Priority to TNP/2017/000519A priority patent/TN2017000519A1/en
Priority to CA2988841A priority patent/CA2988841C/en
Priority to US15/579,774 priority patent/US10414811B2/en
Priority to MYPI2017704708A priority patent/MY185816A/en
Priority to JP2017563292A priority patent/JP6811190B2/ja
Priority to EP16732248.6A priority patent/EP3307769B1/en
Priority to NZ738909A priority patent/NZ738909A/en
Priority to CR20170559A priority patent/CR20170559A/es
Application filed by MedImmune Ltd filed Critical MedImmune Ltd
Priority to AU2016277449A priority patent/AU2016277449B2/en
Publication of WO2016198544A1 publication Critical patent/WO2016198544A1/en
Priority to IL255978A priority patent/IL255978B/en
Anticipated expiration legal-status Critical
Priority to CONC2017/0012675A priority patent/CO2017012675A2/es
Priority to PH12017502259A priority patent/PH12017502259A1/en
Priority to US16/521,662 priority patent/US20200079833A1/en
Priority to AU2019229424A priority patent/AU2019229424A1/en
Priority to US17/169,833 priority patent/US20210221866A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/605Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/28Insulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/48Drugs for disorders of the endocrine system of the pancreatic hormones
    • A61P5/50Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00

Definitions

  • the present disclosure provides protease-resistant peptides, methods of making such peptides, as well as compositions comprising protease-resistant peptides and methods of treatment utilizing such peptides. Lipid modification of amino acids at certain positions in the peptide sequence is described herein.
  • sequence specific modifications e.g., those affecting the primary structure of the peptide itself
  • globally effective modifications e.g., those which alter certain overall physicochemical characteristics of the peptide. Introduced strategically, such modifications can reduce the effects of natural physiological processes which would otherwise eliminate or inactivate a peptide whose action is desired, e.g. enzymatic degradation and/or clearance by renal ultrafiltration.
  • Sequence specific modifications include incorporation of proteolysis-resistant unusual amino acids, or more involved modifications including cyclization between naturally occurring side-chain functions, e.g. disulfide formation (Cys-Cys), or lactamization (Lys-Glu or Lys-Asp). Additional modifications include cyclization between unnatural amino acid surrogates within the peptide backbone e.g. olefin metathesis stapling.
  • Global modifications include processes such as peptide lipidation e.g. palmitoylation and/or PEGylation. Palmitoylation has the effect of creating a circulating reservoir of peptide which reversibly associates with naturally abundant albumin in blood serum. Peptide associated with albumin effectively escapes renal ultrafiltration since the size of the associated complex is above the glomerular filtration cutoff. As the peptide dissociates from the surface of the albumin it is again free to interact with endogenous receptors. PEGylation has the effect of physically shielding the peptide from proteolysis and imparts significant hydrophilicity which upon hydration greatly increases the hydrodynamic radius of the therapeutic molecule to overcome renal clearance.
  • the present disclosure provides for an isolated polypeptide comprising the amino acid sequence: H X2 E G S X6 T S D V XI 1 X12 X13 L E G E A A X20 E X22 I X24 X25 V V X28 G G (SEQ ID NO: 2) wherein X2 is A or Aib, X6 is F or an alpha-methyl functionalized amino acid, XI 1 is S or an alpha- methyl functionalized amino acid, X12 is S or a lipid modified K, X13 is Y or an alpha- methyl functionalized amino acid, X20 is a lipid modified K, K, or an alpha-methyl functionalized amino acid, X22 is F or an alpha-methyl functionalized amino acid, X24 is A or a lipid modified K; X25 is W or an alpha-methyl functionalized amino acid, and X28 is K, E, or an alpha-methyl functionalized amino acid, wherein the polypeptide is lipidated
  • a peptide comprising the amino acid sequence of SEQ ID NO:
  • a peptide comprising the amino acid sequence of SEQ ID NO: 2 comprises a C-terminal acid.
  • X2 is Aib.
  • the lipid modified K is selected from the group consisting of: K(£-(PEG) 2 -(PEG) 2 -YE-Stearate), K(C-yE-Palmitoyl), K(£-(PEG) 2 -(PEG) 2 -(PEG) 2 - Stearoyl), K(£-yE-Lauroyl), K(£-YE-yE-Lauroyl), K(£-YE-YE-yE-Lauroyl), K(£-YE-YE-yE-Lauroyl), K(£-Ahx- Lauroyl), K(E-Ahx-Ahx-Lauroyl), K(E-Ahx-Ahx-Ahx-Lauroyl), K(£-(PEG) 2 - Lauroyl), K(£-(PEG) 2 - Lauroyl), K(£-(PEG) 2 - Lauroyl), K(£
  • X6 is a-MeF
  • XI 1 is a-MeS
  • X13 is a-MeF
  • X22 is a-MeF
  • X25 is a-MeF
  • X28 is a-MeK, or any combination thereof.
  • X2 is Aib
  • X6 is a- MeF
  • XI 1 is a-MeS
  • X13 is a-MeF
  • X20 is K(£-(PEG) 2 -(PEG) 2 -yE-Stearate)
  • X22 is a-MeF
  • X25 is a-MeF
  • X28 is a-MeK (SEQ ID NO: 3).
  • the peptide comprises the amino acid sequence of SEQ ID NO: 48, SEQ ID NO: 60, or SEQ ID NO: 68.
  • the polypeptide is substantially resistant to proteolytic degradation.
  • the polypeptide is substantially resistant to DPP-IV, neprilysin, a- chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and/or pepsin degradation.
  • the polypeptide at least maintains substantially the same receptor potency as a corresponding non-lipidated polypeptide.
  • the polypeptide at least maintains substantially the same receptor selectivity as a corresponding non-lipidated polypeptide.
  • the polypeptide exhibits increased receptor potency over a corresponding non-lipidated polypeptide.
  • the present disclosure also provides for an isolated polypeptide comprising the amino acid sequence: H X2 E G X5 X6 T S D X10 XI 1 X12 X13 X14 E G X17 A A X20 E X22 I X24 X25 X26 V X28 G X30 (SEQ ID NO: 4); wherein X2 is A or Aib, X5 is T or S, X6 is F or an alpha-methyl functionalized amino acid, X10 is V or a lipid modified K, XI 1 is S or an alpha-methyl functionalized amino acid, X 12 is S or a lipid modified K, X13 is Y, F, or a lipid modified K, X14 is L or a lipid modified K, X17 is Q or E, X20 is K, E, or an alpha-methyl functionalized amino acid, X22 is F, norleucine, tyrosine methyl ester, or an alpha-
  • X6 is F, a-MeF, a-MeS, or a-MeK
  • XI 1 is S a-MeF, a-MeS, or a-MeK
  • X20 is K, E, a-MeF, a-MeS, or a-MeK.
  • a peptide comprising the amino acid sequence of SEQ ID NO:
  • a peptide comprising the amino acid sequence of SEQ ID NO: 4 comprises a C-terminal acid.
  • X2 is Aib.
  • the two lipid modified K residues are the same or are different, and are selected from the group consisting of: K(£-(PEG) 2 - (PEG) 2 -yE-Lauroyl), K(£-(PEG) 2 -(PEG) 2 -YE-Palmitate), K(£-(PEG) 2 -(PEG) 2 -yE- Myristoyl), K(£-(PEG) 2 -(PEG) 2 -YE-Palmitoyl), K(£-(PEG) 2 -(PEG) 2 -YE-Stearoyl), K(£-(PEG) 2 -(PEG) 2 -yE-Stearate), and any combination thereof.
  • the two lipid modified K residues are both K(£-(PEG) 2 -(PEG) 2 -yE- Lauroyl), both K(£-(PEG) 2 -(PEG) 2 -YE-Palmitate), both K(£-(PEG) 2 -(PEG) 2 -yE- Myristoyl), both K(£-(PEG) 2 -(PEG) 2 -YE-Palmitoyl), both K(£-(PEG) 2 -(PEG) 2 -yE- Stearoyl), or both K(£-(PEG) 2 -(PEG) 2 -yE-Stearate).
  • X10 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K.
  • X 12 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K.
  • X13 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K.
  • X14 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K.
  • X24 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K.
  • X25 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K.
  • X26 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K.
  • X6 is a-MeF
  • XI 1 is a-MeS
  • X20 is a-MeK
  • X6 is a-MeF and XI 1 is a-MeS
  • X6 is a-MeF and X20 is a-MeK
  • XI 1 is a-MeS
  • X20 is a-MeK or X6 is a-MeF
  • XI 1 is a-MeS
  • X20 is a-MeK.
  • X13 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K.
  • X14 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K.
  • X5 is S.
  • X17 is E
  • X28 is E
  • X30 is G.
  • the polypeptide comprises the amino acid sequence of SEQ ID NO: 252; SEQ ID NO: 263; SEQ ID NO: 269; SEQ ID NO: 405; SEQ ID NO: 408; SEQ ID NO: 409; or SEQ ID NO: 410.
  • the present disclosure also provides for an isolated polypeptide comprising the amino acid sequence: H (Aib) E G S (a-MeF) T S D X10 XI 1 X12 X13 X14 E X16 X17 X18 A (a-MeK) X21 F I X24 X25 X26 V E G G (SEQ ID NO: 487), wherein X10 is V or a lipid modified K; XI 1 is S or an alpha- methyl functionalized amino acid; X 12 is S or a lipid modified K; X13 is Y or a lipid modified K; X14 is L or a lipid modified K; X16 is G or a lipid modified K; X17 is E or a lipid modified K; XI 8 is A or a lipid modified K; X21 is E or a lipid modified K; X24 is A or a lipid modified K; X25 is F or a lipid modified K;
  • a peptide comprising the amino acid sequence of SEQ ID NO:
  • a peptide comprising the amino acid sequence of SEQ ID NO: 487 comprises a C-terminal acid.
  • the lipid modified K residues can be attached to a variety of lipids or lipid moieties such as any of those described herein.
  • examples include those selected from the group consisting of: K(£-(PEG) 2 -(PEG) 2 - ⁇ -Lauroyl); K(£-(PEG) 2 -(PEG) 2 -YE-Palmitate); K(£-(PEG) 2 -(PEG) 2 -YE-Myristoyl); K(£-(PEG) 2 -(PEG) 2 -YE-Palmitoyl); K(£-(PEG) 2 -(PEG) 2 -YE-Stearoyl); K(£-(PEG) 2 - (PEG) 2 -YE-Stearate); and any combination thereof.
  • the lipid modification of the K residues can be the same or different. In certain embodiments, they are the same.
  • at least three lipid modified K residues can all be K(£-(PEG) 2 -(PEG) 2 -YE-Lauroyl); all be K(£-(PEG) 2 -(PEG) 2 -yE- Palmitate); all be K(£-(PEG) 2 -(PEG) 2 -YE-Myristoyl); all be K(£-(PEG) 2 -(PEG) 2 -yE- Palmitoyl); all be K(£-(PEG) 2 -(PEG) 2 -YE-Stearoyl); or all be K(£-(PEG) 2 -(PEG) 2 -yE- Stearate).
  • all modified residues can be K(£-(PEG) 2 -(PEG) 2 -YE-Lauroyl); all can be K(£-(PEG) 2 -(PEG) 2 -YE-Palmitate); all can be K(£-(PEG) 2 -(PEG) 2 -yE- Myristoyl); all can be K(£-(PEG) 2 -(PEG) 2 -YE-Palmitoyl); all can be K(£-(PEG) 2 - (PEG) 2 -YE-Stearoyl); or all can be K(£-(PEG) 2 -(PEG) 2 -yE-Stearate).
  • the polypeptide is substantially resistant to proteolytic degradation.
  • the synthetic peptide is substantially resistant to DPP-IV, neprilysin, a-chymo trypsin, plasmin, thrombin, kallikrein, trypsin, elastase and/or pepsin degradation.
  • the polypeptide, which comprises two lipid modified K residues at least maintains substantially the same receptor potency as a corresponding non-lipidated peptide.
  • the polypeptide, which comprises two lipid modified K residues at least maintains substantially the same receptor selectivity as a corresponding non-lipidated peptide. In certain embodiments, the polypeptide, which comprises two lipid modified K residues, exhibits increased receptor potency over a corresponding non-lipidated polypeptide.
  • lipidated peptidse that can bind to a human GLP- 1 receptor with an EC50 in the cAMP assay less than 5000 pM, less than 2500 pM, less than 1000 pM, less than 900 pM, less than 800 pM, less than 700 pM, less than 600 pM, less than 500 pM, less than 400 pM, less than 300 pM, less than 200 pM, less than 100 pM, less than 50 pM, less than 25 pM, less than 20 pM, less than 15 pM, less than 10 pM, less than 5 pM, less than 4 pM, less than 3 pM, or less than 2 pM.
  • the disclosure also provides for isolated polynucleotides encoding any of the lipidted polypeptide described herein. Certain embodiments provide for vectors comprising such polynucleotides. Certain embodiments provide for host cells comprising such nucleotides or vectors.
  • Certain embodiments provide for methods of making a lipidated polypeptide described herein.
  • the method comprises culturing a host cell under conditions allowing expression of the peptide, and recovering the peptide.
  • compositions comprising a lipidated polypeptide described in detail elsewhere herein.
  • a kit comprises such composition.
  • Certain embodiments provide for methods of treating or preventing a disease or condition caused or characterized by hypoglycemia or impaired insulin release. Such methods comprise administering to a subject in need of treatment an effective amount of a lipidated polypeptide described in detail elsewhere herein or as pharmaceutical composition comprising such polypeptide.
  • the disease or condition is diabetes.
  • the disease or condition is type-2 diabetes.
  • the administration further improves glycemic control, provides body weight control, improves ⁇ -cell function and mass, reduces the rate of gastric acid secretion and gastric emptying, or any combination thereof.
  • the polypeptide or the pharmaceutical composition is administered orally or by injection.
  • the polypeptide or the pharmaceutical composition is administered orally. In certain embodiments, the injection is administered subcutaneously or intravenously. In certain embodiments, the peptide or the pharmaceutical composition is administered once per day. In certain embodiments, methods of treating or preventing a disease or condition further comprise administering one or more additional therapies.
  • the additional therapy comprises blood sugar monitoring, diet modifications, exercise, insulin, a thiazolidinedione, a sulfonylurea, an incretin, metformin, a glyburide, a dipeptidyl peptidase 4 inhibitor, a bile acid sequestrant, or any combination thereof.
  • the subject treated is a human.
  • FIG 1 shows representative lipid, lipid moieties, and linkers for forming lipidated polypeptides disclosed herein.
  • FIG 2 shows the percent peptide remaining of 100 ⁇ g of peptide hydrolysed by 100 ⁇ g/mL Neprilysin at pH 8.3.
  • FIG 3 shows the percent peptide remaining of 100 ⁇ g of peptide hydrolysed by 200 ⁇ g/mL Pepsin, 100 mM HC1 at pH 2.
  • FIG 4 shows the percent peptide remaining of 100 ⁇ g of peptide hydrolysed by 150 ⁇ g/mL Trypsin at pH 8.1.
  • FIG 5 shows the percent peptide remaining of 100 ⁇ g of peptide hydrolysed by 100 ⁇ g/mL Chymo trypsin at pH 8.
  • FIG 6 shows the percent peptide remaining of 1000 ⁇ g of peptide hydrolysed by 100 ⁇ g/mL fresh SIF/Pancreatin® at pH 6.8.
  • FIG 7 shows the mean values from a triplicate run of the percent peptide remaining of
  • FIG 8 shows the chemical structure, chemical formula and molecular weight for SEQ
  • FIG 9 shows the FIG 9 shows the chemical structure, chemical formula and molecular weight for SEQ ID NO:48 and SEQ ID NO:60.
  • FIG 10 shows the chemical structure, chemical formula and molecular weight for SEQ
  • FIG 11 shows the chemical structure, chemical formula and molecular weight for SEQ
  • FIG 12 shows the chemical structure, chemical formula and molecular weight for SEQ
  • FIG 13 shows the chemical structure, chemical formula and molecular weight for SEQ
  • FIG 14 shows the chemical structure, chemical formula and molecular weight for SEQ
  • FIG 15 shows the chemical structure, chemical formula and molecular weight for SEQ
  • FIG 16 shows the chemical structure, chemical formula and molecular weight for SEQ
  • polypeptide peptide
  • protein protein fragment
  • amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function similarly to a naturally occurring amino acid.
  • amino acid and “amino acid residue” are used interchangeably throughout.
  • fragment when referring to a lipidated peptide as provided herein includes any peptide that retains at least some activity of a corresponding native peptide, e.g., GLP-1.
  • lipidated GLP-1 peptide analog refers to, e.g., a synthetic peptide comprising one or more lipidated amino acids, e.g., to render the peptide protease resistant, while still maintaining at least some of the GLP-1 activities of a native GLP-1 peptide.
  • Chemical modifications intended to improve metabolic stability of peptides can involve additional chemical manipulation following synthesis of the main peptide chain. Examples of manipulation include lactamization, disulfide bridge closure, lipidation and/or PEGylation.
  • lipid modified amino acid and “lipidated amino acid” are used interchangeably herein, and refer to an amino acid, typically a lysine or cysteine, which has a lipid moiety attached.
  • lipidated polypeptide “lipoprotein,” and the like refer to a peptide or polypeptide that includes one or more lipid modified amino acids.
  • Figure 1 illustrates various representative examples of lipids, lipid moieties, and linkers.
  • compositions or “pharmaceutical composition” refer to compositions containing a peptide or polypeptide provided herein, along with e.g., pharmaceutically acceptable carriers, excipients, or diluents for administration to a subject in need of treatment.
  • compositions that are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity or other complications commensurate with a reasonable benefit/risk ratio.
  • an "effective amount” is that amount of a peptide or polypeptide provided herein, the administration of which to a subject, either in a single dose or as part of a series, is effective for treatment.
  • subject is meant any subject, particularly a mammalian subject, in need of treatment with a peptide or polypeptide provided herein.
  • Mammalian subjects include, but are not limited to, humans, dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, bears, cows, apes, monkeys, orangutans, and chimpanzees, and so on.
  • the subject is a human subject.
  • compositions and methods that address the natural enzymatic liabilities of peptides.
  • peptides are provided that demonstrate increased resistance to enzymatic degradation, while still maintaining substantially the same or exhibiting increased receptor potency and selectivity as a wild-type peptide.
  • This disclosure provides lipidated peptides with improved protease resistance and increased potency. Improvements in protease resistance and potency can be associated with the position of the lipidation on the peptide. Lipidation can include carboxyl- or amino- terminal lipidation, or main-chain lipidation. In certain embodiments, the modification is of a main-chain amino acid residue. In certain embodiments, improvements in protease resistance and increased potency are associated with the selective and strategic position of the lipidation of one or more main-chain amino acid residues. Methods of preparing peptides with lipid modified amino acids are known in the art. [0061] In certain embodiments, a lipidated peptide comprising at least one lipidated amino acid residue is provided.
  • the lipidated peptide comprises at least two lipidated amino acid residues. In certain embodiments, the lipidated peptide contains only one lipidated amino acid residue. As used herein, a peptide with one lipid or lipid moiety attached is referred to as a mono-lipidated peptide. In other embodiments, the lipidated peptide contains two lipidated amino acid residues. As used herein, a peptide with two lipids or lipid moieties attached is referred to as a bis- lipidated peptide.
  • the lipidated peptide is a synthetic peptide. See International Patent Application No. PCT/EP2014/077240, published as WO2015/086686A2, which is incorporated by reference herein in its entirety.
  • the lipidated synthetic peptide comprises at least one substitution of an alpha-methyl functionalized amino acid for a native amino acid residue.
  • a lipidated synthetic peptide comprises at least two, three, four, five, six, or more substitutions of alpha- methyl functionalized amino acids for native amino acid residues.
  • synthetic peptide refers to a polymer of amino acid residues that has been generated by chemically coupling a carboxyl group or C-terminus of one amino acid to an amino group or iV-terminus of another. Chemical peptide synthesis typically starts at the C-terminus of the peptide and ends at the N- terminus. Various methods for generating synthetic peptides are well known in the art.
  • alpha-methyl functionalized amino acids refer to amino acids in which the first (alpha) carbon atom of the amino acid includes a methyl group (CH 3 ) substituent bound to the alpha carbon.
  • Alpha-methyl functionalized amino acids include any of the naturally occurring twenty amino acids that include such a functionalization.
  • alpha-methyl functionalized amino acids can replace any native amino acid in a peptide.
  • native amino acid refers to one of the standard 20 amino acids that exist in biologically generated proteins.
  • Substitution refers to the replacement of a native amino acid with, e.g., an alpha- functionalized amino acid.
  • the native amino acid can be readily replaced by an alpha functionalized amino acid.
  • the synthetic peptides described herein can be of any length, e.g., any number of amino acids in length, e.g., about 5 amino acids to about 200 amino acids in length, about 10 amino acids to about 150 amino acids in length, about 20 amino acids to about 100 amino acids in length, about 30 amino acids to about 75 amino acids in length, or about 20 amino acids, about 30 amino acids, about 40 amino acids, about 50 amino acids, about 60 amino acids, about 70 amino acids, about 80 amino acids, about 90 amino acids, or about 100 amino acids in length.
  • any number of amino acids in length e.g., about 5 amino acids to about 200 amino acids in length, about 10 amino acids to about 150 amino acids in length, about 20 amino acids to about 100 amino acids in length, about 30 amino acids to about 75 amino acids in length, or about 20 amino acids, about 30 amino acids, about 40 amino acids, about 50 amino acids, about 60 amino acids, about 70 amino acids, about 80 amino acids, about 90 amino acids, or about 100 amino acids in length.
  • Certain lipidated synthetic peptides described herein contain one or more alpha- functionalized amino acids substituted for native amino acids, while at least maintaining substantially the same or exhibiting increased receptor potency as a corresponding synthetic peptide that does not comprise the substitutions. Improvements in protease resistance and potency can be associated with the selective and strategic position of the lipidation and alpha-functionalized amino acids substituted amino acids on the peptide.
  • synthetic peptides that at least maintain substantially the same or exhibit increased receptor potency and selectivity contain two or more alpha-functionalized amino acids substituted for native amino acids.
  • synthetic peptides that at least maintain substantially the same or exhibiting increased receptor potency and selectivity contain three four, five, six or more alpha-functionalized amino acids substituted for the native amino acids.
  • receptor "potency" refers to the inverse of the half maximum (50%) effective concentration (EC50) of the peptide.
  • the EC50 refers to the concentration of peptide that induces a biological response halfway between the baseline response and maximum response, after a specified exposure time, for a selected target of the peptide.
  • peptides exhibiting a small value for EC50 have a corresponding high receptor potency
  • peptides exhibiting a large value for EC50 have a corresponding low receptor potency - the more peptide required to induce a response related to a receptor, the less potent the peptide is for that receptor.
  • Methods for determining the receptor potency and EC50 are known in the art and suitably involve determining stimulation of one or more cellular receptor responses.
  • suitable cell lines expressing GLP-1 receptor (GLP-1R), glucagon receptor (GCGR) or glucose-dependent insulinotropic peptide (gastric inhibitory polypeptide) receptor (GIPR) are generated by standard methods. Peptide activation of these various receptors results in downstream production of a cAMP second messenger which can be measured in a functional activity assay. From these measurements, EC50 values are readily determined.
  • lipidated peptides comprising one or more, e.g., one or two, attached lipids or lipid moieties and and substituition of alpha-methyl functionalized amino acids for the native amino acids can maintain "substantially the same” or exhibit increased receptor potency as compared to a corresponding peptide that does not comprise the lipids or lipid moieties or the non-natural amino acids.
  • substantially the same when referring to receptor potency, means that the lipidated peptide can exhibit, e.g., at least about 75% of the receptor potency, when the lipidated peptide is compared to the receptor potency of a corresponding peptide that is unlipidated or unlipidated and having different and/or fewer amino acid modifications, or other suitable comparator sequence (e.g., a control).
  • a lipidated peptide as provided herein can exhibit, e.g., about 80% of the receptor potency, about 85% of the receptor potency, about 90% of the receptor potency, about 91% of the receptor potency, about 92% of the receptor potency, about 93% of the receptor potency, about 94% of the receptor potency, about 95% of the receptor potency, about 96% of the receptor potency, about 97% of the receptor potency, about 98% of the receptor potency, about 99% of the receptor potency, about 99.1% of the receptor potency, about 99.2% of the receptor potency, about 99.3% of the receptor potency, about 99.4% of the receptor potency, about 99.5% of the receptor potency, about 99.6% of the receptor potency, about 99.7% of the receptor potency, about 99.8% of the receptor potency, about 99.9% of the receptor potency, or about 100% of the receptor potency, when the lipidated peptide is compared to the receptor potency of a corresponding peptid
  • increased receptor potency when referring to receptor potency, means that the lipidated peptide exhibits greater receptor potency greater than the receptor potency of a corresponding peptide that is unlipidated or unlipidated and having different and/or fewer amino acid modifications, or other suitable comparator sequence (e.g., a control).
  • increased receptor potency refers to, for example, 1% greater receptor potency, 2% percent greater receptor potency, 3% percent greater receptor potency, 4% percent greater receptor potency, 5% percent greater receptor potency, 6% percent greater receptor potency, 7% percent greater receptor potency, 8% percent greater receptor potency, 9% percent greater receptor potency, 10% percent greater receptor potency.
  • increased receptor potency refers to for example, 1% to 10% greater receptor potency, 1% to 20% percent greater receptor potency, 1% to 30% percent greater receptor potency, 1% to 40% percent greater receptor potency, 1% to 50% percent greater receptor potency, 5% to 10% greater receptor potency, 5% to 20% percent greater receptor potency, 5% to 30% percent greater receptor potency, 5% to 40% percent greater receptor potency, 5% to 50% percent greater receptor potency, 10 to 50% percent greater receptor potency, 20 to 50% percent greater receptor potency, 30 to 50% percent greater receptor potency, 40% to 50% percent greater receptor potency, or 50% to 100% percent greater receptor potency.
  • a lipidated peptide as provided herein comprising one or more, e.g., one or two, attached lipids or lipid moieties and substituition of alpha-methyl functionalized amino acids for native amino acids can also at least maintain "substantially the same selectivity" as a corresponding peptide that does not comprise the lipid or lipid moiety or non-natural amino acids, or other suitable comparator sequence (e.g., a control), as described herein.
  • selectivity refers to the ability of a peptide to bind its target (e.g., the agonist to which it is designed to bind) while not binding to other non-target proteins.
  • a lipidated peptide as provided herein can exhibit "substantially the same selectivity" and thus exhibit, e.g., at least about 75% of the selectivity when the lipidated peptides are compared to the selectivity of peptides that do not comprise the lipid or lipid moiety, or other suitable comparator sequence (e.g., a control), as described herein.
  • a lipidated peptide as provided herein can exhibit about 80% of the selectivity, about 85% of the selectivity, about 90% of the selectivity, about 91% of the selectivity, about 92% of the selectivity, about 93% of the selectivity, about 94% of the selectivity, about 95% of the selectivity, about 96% of the selectivity, about 97% of the selectivity, about 98% the selectivity, about 99% of the selectivity, about 99.1% of the selectivity, about 99.2% of the selectivity, about 99.3% of the selectivity, about 99.4% of the selectivity, about 99.5% of the selectivity, about 99.6% of the selectivity, about 99.7% of the selectivity, about 99.8% of the selectivity, about 99.9% of the selectivity, or about 100% of the selectivity, when the lipidated peptide is compared to the selectivity of a corresponding peptide that does not comprise the lipid or lipid moiety, or other suitable comparator sequence (e.g., a control), as described here
  • a lipidated peptide as provided herein can also comprise one or more alpha-methyl functionalized amino acids corresponding to the substituted native amino acids in a corresponding wild-type protein.
  • the amino acid in the original, wild-type peptide sequence can be substituted with an alpha-methyl functionalized amino acid that has the same side chain, e.g., Phe, Trp, Tyr, Ser, Arg, Ala, Val, Leu, His, or Lys, can be substituted with cc-MePhe, cc-MeTrp, cc-MeTyr, a- MeSer, a-MeArg, a-MeAla (Aib), a-MeVal, a-MeLeu, a-MeHis, or a-MeLys, respectively.
  • an alpha- methyl functionalized amino acid in a lipidated peptide as provided herein can correspond to the same class as the substituted native amino acids.
  • aliphatic alpha- methyl functionalized amino acids can be substituted for aliphatic native amino acids; hydroxyl alpha-methyl functionalized amino acids can be substituted for hydroxyl native amino acids; sulfur-containing alpha-methyl functionalized amino acids can be substituted for sulfur-containing native amino acids; cyclic alpha-methyl functionalized amino acids can be substituted for cyclic native amino acids; aromatic alpha- methyl functionalized amino acids can be substituted for aromatic native amino acids; basic alpha-methyl functionalized amino acids can be substituted for basic native amino acids; and/or acidic alpha-methyl functionalized amino acids can be substituted for acidic native amino acids.
  • an alpha-methyl functionalized amino acid in a lipidated peptide as provided herein does not correspond to the substituted native amino acids.
  • alpha-methyl functionalized amino acids include, for example, Bachem AG, Switzerland.
  • At least one alpha-methyl functionalized amino acid in a lipidated synthetic peptide described herein is alpha-methyl phenylalanine.
  • At least one alpha-methyl functionalized amino acid in a synthetic lipidated peptide described herein is selected from alpha-methyl functionalized Histidine, alpha-methyl functionalized Alanine, alpha-methyl functionalized Isoleucine, alpha-methyl functionalized Arginine, alpha-methyl functionalized Leucine, alpha-methyl functionalized Asparagine, alpha-methyl functionalized Lysine, alpha-methyl functionalized Aspartic acid, alpha-methyl functionalized Methionine, alpha-methyl functionalized Cysteine, alpha-methyl functionalized Phenylalanine, alpha-methyl functionalized Glutamic acid, alpha- methyl functionalized Threonine, alpha-methyl functionalized Glutamine, alpha- methyl functionalized Tryptophan, alpha-methyl functionalized Glycine, alpha-methyl functionalized Valine, alpha-methyl functionalized Ornithine, alpha-methyl functionalized Proline, alpha-methyl functionalized Selenocysteine, alpha-
  • the lipidated peptides described herein can be substantially resistant to proteolytic degradation.
  • proteolytic degradation means the breakdown of peptides into smaller peptides or even amino acids, generally caused by the hydrolysis of a peptide bond by enzymes.
  • Lipidated peptides that are "substantially resistant" to proteolytic degradation can, for example, remain at least about 50% intact following exposure to an enzyme in conditions that the enzyme is generally active (e.g., suitable pH, temperature, other environmental conditions) for a defined period of time.
  • Lipidated peptides provided herein can be substantially resistant to proteolytic degradation for a period of at least 4 hours, at least 8 hours, at least 12 hours, at least 24 hours, at least 36 hours, at least 48 hours, at least 72 hours, at least 96 hours, at least 120 hours, at least 144 hours, at least 168 hours, at least 192 hours, at least 216 hours, at least 240 hours, or about 36 hours to about 240 hours, about 48 hours to 240 hours, about 72 hours to about 240 hours, about 96 hours to about 240 hours, about 120 hours to about 240 hours, about 144 hours to about 240 hours, about 168 hours to about 240 hours, about 192 hours to about 240 hours, or about 216 hours to about 240 hours.
  • At least about 60% of the lipidated peptide remains intact following exposure to an enzyme in conditions that the enzyme is generally active for a defined period of time, for example, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.1%, at least about 99.2%, at least about 99.3%, at least about 99.4%, at least about 99.5%, at least about 99.6%, at least about 99.7%, at least about 99.8%, at least about 99.9%, or at least about 100% of the lipidated peptide remains intact following exposure to an enzyme in conditions that the enzyme is generally active for a defined period of time.
  • Lipidated peptides provided herein can be substantially resistant to proteolytic degradation by one or more enzymes found in a mammalian body, e.g., the human body.
  • the lipidated peptides can be substantially resistant to proteolytic degradation by one or more of dipeptidyl peptidase-IV (DPP-IV), neprilysin, a- chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin.
  • DPP-IV dipeptidyl peptidase-IV
  • the lipidated peptides can be resistant to proteolytic degradation by to two or more, three or more, four or more, five or more, six or more, seven or more, or suitably all of the recited enzymes.
  • the lipidated peptides described herein can also be substantially resistant to proteolytic degradation by other enzymes known in the art.
  • the lipidated peptides described herein can be substantially resistant to proteolytic degradation by digestive (gastric) enzymes and/or enzymes in the blood/serum.
  • the lipidated peptides described herein can be substantially resistant to proteolytic degradation by DPP-IV and neprilysin. In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation by pepsin, trypsin, a-chymotrypsin, and elastase. In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation by plasmin, thrombin, and kallikrein. In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation by pepsin, trypsin and a-chymotrypsin. In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation by pepsin and trypsin, etc.
  • lipidation of amino acid residues and/or substitution of alpha-functionalized amino acids for native amino acids can occur at native amino acid residues that are sites susceptible to proteolytic cleavage. That is, the amino acid residues that are substituted are determined to be sites where proteolytic enzymes are active in cleaving peptide bonds in the native peptides. Methods for determining sites of proteolytic cleavage are well known in the art and described herein.
  • Any class of peptide can be prepared according to the methods provided herein to yield lipidated peptides having the recited characteristics.
  • the lipidated peptides can be incretin class peptides.
  • Exemplary synthetic incretin class peptides that can be prepared as described herein include, but are not limited to, glucagon-like peptide 1 (GLP-1), a glucose-dependent insulinotropic peptide (GIP), an exenatide peptide, plus glucagon, secretins, tenomodulin, oxyntomodulin, insulin, or vasoactive intestinal peptide (VIP).
  • GLP-1 glucagon-like peptide 1
  • GIP glucose-dependent insulinotropic peptide
  • VIP vasoactive intestinal peptide
  • the lipidated peptide described herein is derived from the sequence of GLP-1 and referred to herein as a lipidated GLP-1 peptide analog.
  • HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (SEQ ID NO: 1).
  • lipidated GLP-1 peptide analogs are provided comprising at least one lipid modified amino acid residue, such as those shown in Table 1. In certain embodiments, the lipidated GLP-1 peptide analog contains only one lipid modified amino acid residue.
  • Mono-lipidated GLP-1 peptide analogs disclosed herein can be substantially resistant to proteolytic degradation. For example, in certain embodiments the mono-lipidated peptide is substantially resistant to DPP-IV, neprilysin, a- chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation. Mono-lipidated GLP-1 peptide analogs disclosed herein can maintain substantially the same or exhibit increased receptor potency and selectivity as a corresponding non-lipidated GLP-1 peptide or GLP-1 peptide analog.
  • a mono-lipidated peptide is lipidated on only one K (lysine) or only one C (cysteine) residue.
  • K lysine
  • C cysteine
  • X6 is F or an alpha-methyl functionalized amino acid
  • XI 1 is S or an alpha- methyl functionalized amino acid
  • X12 is S, a lipid modified K, or a lipid modified C;
  • X13 is Y or an alpha-methyl functionalized amino acid;
  • X20 is a lipid modified K, a lipid modified C, K, or an alpha-methyl functionalized amino acid
  • X22 is F or an alpha-methyl functionalized amino acid
  • X24 is A, a lipid modified K, or a lipid modified C
  • X25 is W or an alpha-methyl functionalized amino acid
  • X28 is K, E, or an alpha-methyl functionalized amino acid, wherein the polypeptide is lipidated on only one of X12, X20, or X24.
  • a mono-lipidated peptide comprises one or more
  • aminoisobutyric acid (Aib) substitutions In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 2: X2 is Aib.
  • the lipidated K or lipidated C can be attached to a variety of lipids or lipid moieties such as any of those described herein. Examples include those selected from the group consisting of: K(£-(PEG) 2 -(PEG) 2 -YE-Stearate); K(£-YE-Palmitoyl); K(£- (PEG) 2 -(PEG) 2 -YE-Stearate); K(YE-Palmitoyl); K(£-(PEG) 2 -(PEG) 2 -(PEG) 2 -Stearoyl); K(E-YE-Lauroyl); K(E-YE-YE-Lauroyl); K(E-YE-YE-YE-Lauroyl); K(E-Ahx-Lauroyl); K(E-Ahx-Ahx-Lauroyl); K(E-Ahx-Ahx-Lauroyl); K(E-Ahx-A
  • the alpha- methyl functionalized amino acid is a-MeF, a- MeS, or a-MeK.
  • a peptide comprising the amino acid sequence of SEQ ID NO: 2 X6 is a-MeF; XI 1 is a-MeS; X13 is a-MeF; X22 is a- MeF; X25 is a-MeF; and/or X28 is a-MeK.
  • X6 is a-MeF
  • XI 1 is a-MeS
  • X13 is a-MeF
  • X22 is a-MeF
  • X25 is a-MeF
  • X28 is a-MeK.
  • a peptide comprising the amino acid sequence of SEQ ID NO: 2 is Aib; X6 is a-MeF; XI 1 is a-MeS; X13 is a-MeF; X20 is K(£-(PEG) 2 -(PEG) 2 -yE- Stearate); X22 is a-MeF; X25 is a-MeF; and X28 is a-MeK (SEQ ID NO: 3; Table 1).
  • the peptide comprises the amino acid sequence of SEQ ID NO: 48 (Table 1), SEQ ID NO: 60 (Table 1), or SEQ ID NO: 68 (Table 1).
  • a peptide comprising the amino acid sequence of SEQ ID NO: 2, 3, 48, 60, or 68 is substantially resistant to proteolytic degradation.
  • the peptide is substantially resistant to DPP-IV, neprilysin, a-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation.
  • a peptide comprising the amino acid sequence of SEQ ID NO: 2, 3, 48, 60, or 68 at least maintains substantially the same receptor potency or exhibits increased receptor potency as compared to a
  • a peptide comprising the amino acid sequence of SEQ ID NO: 2, 3, 48, 60, or 68 at least maintains substantially the same receptor or exhibits increased receptor potency and selectivity as compared to a corresponding non-lipidated peptide.
  • lipidated GLP-1 peptide analogs are provided comprising at least two lipid modified amino acid residues, such as those shown in Table 2. In certain embodiments, lipidated GLP-1 peptide analogs contain two lipidated amino acid residues.
  • Bis-lipidated GLP-1 peptide analogs disclosed herein can be substantially resistant to proteolytic degradation. For example, in certain embodiments the bis-lipidated peptide is substantially resistant to DPP-rV, neprilysin, a-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation. Bis-lipidated GLP-1 peptide analogs disclosed herein can maintain substantially the same or exhibit increased receptor potency and selectivity as a corresponding non-lipidated GLP- 1 peptide or GLP- 1 peptide analog.
  • a bis-lipidated peptide is lipid modified at two amino acid residues. In certain embodiments, this can be at two K (lysine) residues, at two C (cysteine) residues, or at one K and one C residue in the same peptide. In certain embodiments, two K residues are lipid modified. Thus, certain embodiments provide for an isolated polypeptide comprising the amino acid sequence:
  • X2 is A or Aib
  • X5 is T or S
  • X6 is F or an alpha-methyl functionalized amino acid
  • X10 is V or a lipid modified K
  • XI 1 is S or an alpha- methyl functionalized amino acid
  • X 12 is S or a lipid modified K
  • X13 is Y, F, or a lipid modified K
  • X 14 is L or a lipid modified K
  • X17 is Q or E
  • X20 is K, E, or an alpha-methyl functionalized amino acid
  • X22 is F, norleucine, tyrosine methyl ester, or an alpha-methyl functionalized amino acid
  • X24 is A or a lipid modified K
  • X25 is W, F, or a lipid modified K
  • X26 is L, V, or a lipid modified K
  • X28 is K or E
  • X30 is R or G
  • polypeptide comprises two lipid modified K residues, and wherein one of X10, XI 2, X13, or X14 is a lipid modified K residue and one of X24, X25, or X26 is a lipid modified K residue.
  • a bis-lipidated peptide comprises one or more aminoisobutyric acid (Aib) substitutions.
  • a peptide comprising the amino acid sequence of SEQ ID NO: 4: X2 is Aib.
  • an alpha- methyl functionalized amino acid is one of a-MeF, a-MeS, or a-MeK.
  • the lipid modified K residues can be attached to a variety of lipids or lipid moieties such as any of those described herein.
  • Example include those selected from the group consisting of: K(£-(PEG) 2 -(PEG) 2 -YE-Lauroyl); K(£-(PEG) 2 -(PEG) 2 -YE-Palmitate); K(£- (PEG) 2 -(PEG) 2 -YE-Myristoyl); K(£-(PEG) 2 -(PEG) 2 -YE-Palmitoyl); K(£-(PEG) 2 -(PEG) 2 - ⁇ -Stearoyl); K(£-(PEG) 2 -(PEG) 2 -YE-Stearate); and any combination thereof.
  • the lipid modification of the K residues can be the same or different. In certain embodiments, they are the same. Thus, in certain embodiments, at least two lipid modified K residues can both be K(£-(PEG) 2 -(PEG) 2 -YE-Lauroyl); both be K(£-(PEG) 2 -(PEG) 2 -YE-Palmitate); both be K(£-(PEG) 2 -(PEG) 2 -YE-Myristoyl); both be K(£-(PEG) 2 -(PEG) 2 -YE-Palmitoyl); both be K(£-(PEG) 2 -(PEG) 2 -YE-Stearoyl); or both be K(£-(PEG) 2 -(PEG) 2 -YE-Stearate).
  • both modified residues can be K(£-(PEG) 2 -(PEG) 2 -YE-Lauroyl); both can be K(£-(PEG) 2 - (PEG) 2 -YE-Palmitate); both can be K(£-(PEG) 2 -(PEG) 2 -YE-Myristoyl); both can be K(£- (PEG) 2 -(PEG) 2 -YE-Palmitoyl); both can be K(£-(PEG) 2 -(PEG) 2 -YE-Stearoyl); or both can be K(£-(PEG) 2 -(PEG) 2 -YE-Stearate).
  • amino acid lipid modification of a peptide comprising the amino acid sequence of SEQ ID NO: 4 occurs in two distinct regions: one amino acid at position X10, X12, X13, or X14 is a lipid modified K residue and another amino acid at position X24, X25, or X26 is a lipid modified K residue.
  • amino acid lipid modification of a peptide comprising the amino acid sequence of SEQ ID NO: 4 occurs in two distinct regions: one amino acid at position X10, X12, X13, or X14 is a lipid modified K residue and another amino acid at position X24, X25, or X26 is a lipid modified K residue.
  • X10 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K;
  • X 12 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K;
  • X13 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K;
  • X 14 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K;
  • X24 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K;
  • X25 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K; or
  • X26 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K.
  • position X6 is a-MeF; XI 1 is a-MeS; X20 is a-MeK; and/or X22 is a-MeF.
  • X6 is a-MeF.
  • X6 is a-MeF and XI 1 is a-MeS.
  • X6 is a-MeF and X20 is a-MeK.
  • X6 is a-MeF, XI 1 is a-MeS, X20 is a-MeK, and X22 is a-MeF.
  • the number, position, and identity of an alpha-methyl functionalized amino acid in a bis-lipidated polypeptide comprising the amino acid sequence of SEQ ID NO: 4 can vary along with the position of the lipid modified amino acid residues.
  • X13 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K
  • X6 is a-MeF and XI 1 is a-MeS.
  • X 14 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K
  • X6 is a-MeF and XI 1 is a-MeS.
  • one or more wild- type GLP-1 sequence amino acids can be substituted with another naturally occurring amino acid.
  • the wild-type T residue at position X5 is substituted with S.
  • the wild-type Q, K, and R residues at positions X17, X28, and X30, respectively can be substituted with E, E, and G, respectively.
  • the peptide comprises the amino acid sequence of SEQ ID NO: 252 (Table 2); SEQ ID NO: 263 (Table 2); SEQ ID NO: 269 (Table 2); SEQ ID NO: 405 (Table 2); SEQ ID NO: 408 (Table 2); SEQ ID NO: 409 (Table 2); or SEQ ID NO: 410 (Table 2).
  • a peptide comprising the amino acid sequence of SEQ ID NO: 1
  • peptide is substantially resistant to proteolytic degradation.
  • the peptide is substantially resistant to DPP-IV, neprilysin, a-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation.
  • a peptide comprising the amino acid sequence of SEQ ID NO: 4, 252, 263, 269, 405, 408, 409, or 410 at least maintains substantially the same receptor potency as compared to a corresponding non-lipidated peptide.
  • a peptide comprising the amino acid sequence of SEQ ID NO: 4, 252, 263, 269, 405, 408, 409, or 410 at least maintains substantially the same receptor potency and selectivity as a compared to corresponding non-lipidated peptide.
  • lipidated GLP-1 peptide analogs are provided comprising at least three lipid modified amino acid residues, such as those shown in Table 3. In certain embodiments, lipidated GLP-1 peptide analogs contain three lipidated amino acid residues.
  • Tris-lipidated GLP-1 peptide analogs disclosed herein can be substantially resistant to proteolytic degradation. For example, in certain embodiments the tris-lipidated peptide is substantially resistant to DPP-rV, neprilysin, a-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation. Tris-lipidated GLP-1 peptide analogs disclosed herein can maintain substantially the same or exhibit increased receptor potency and selectivity as a corresponding non-lipidated GLP- 1 peptide or GLP- 1 peptide analog.
  • a tris-lipidated peptide is lipid modified at three amino acid residues. In certain embodiments, this can be at three K (lysine) residues, at three C (cysteine) residues, or at one K, one C residue, and a third K or C residue in the same peptide. In certain embodiments, three K residues are lipid modified. Thus, certain embodiments provide for an isolated polypeptide comprising the amino acid sequence:
  • X10 is V or a lipid modified K
  • XI 1 is S or an alpha- methyl functionalized amino acid
  • X 12 is S or a lipid modified K
  • X13 is Y or a lipid modified K
  • X 14 is L or a lipid modified K
  • X16 is G or a lipid modified K
  • X 17 is E or a lipid modified K
  • XI 8 is A or a lipid modified K
  • X21 is E or a lipid modified K
  • X24 is A or a lipid modified K
  • X25 is F or a lipid modified K
  • X26 is V or a lipid modified K
  • polypeptide comprises three lipid modified K residues, and wherein one of X10, X12, X13, or X14 is a lipid modified K residue and one of X16, X17, X18, or X21 is a lipid modified K residue and one of X24, X25, or X26 is a lipid modified K residue.
  • the lipid modified K residues can be attached to a variety of lipids or lipid moieties such as any of those described herein.
  • Example include those selected from the group consisting of: K(£-(PEG) 2 -(PEG) 2 -YE-Lauroyl); K(£-(PEG) 2 -(PEG) 2 -YE-Palmitate); K(£- (PEG) 2 -(PEG) 2 -YE-Myristoyl); K(£-(PEG) 2 -(PEG) 2 -YE-Palmitoyl); K(£-(PEG) 2 -(PEG) 2 - ⁇ -Stearoyl); K(£-(PEG) 2 -(PEG) 2 -YE-Stearate); and any combination thereof.
  • the lipid modification of the K residues can be the same or different. In certain embodiments, they are the same. Thus, in certain embodiments, at least three lipid modified K residues can all be K(£-(PEG) 2 -(PEG) 2 -YE-Lauroyl); all be K(£-(PEG) 2 -(PEG) 2 -YE-Palmitate); all be K(£- (PEG) 2 -(PEG) 2 -YE-Myristoyl); all be K(£-(PEG) 2 -(PEG) 2 -YE-Palmitoyl); all be K(£- (PEG) 2 -(PEG) 2 -YE-Stearoyl); or all be K(£-(PEG) 2 -(PEG) 2 -YE-Stearate).
  • all modified residues can be K(£-(PEG) 2 -(PEG) 2 -YE-Lauroyl); all can be K(£-(PEG) 2 -(PEG) 2 - ⁇ -Palmitate); all can be K(£-(PEG) 2 -(PEG) 2 -YE-Myristoyl); all can be K(£-(PEG) 2 - (PEG) 2 -YE-Palmitoyl); all can be K(£-(PEG) 2 -(PEG) 2 -YE-Stearoyl); or all can be K(£- (PEG) 2 -(PEG) 2 -YE-Stearate).
  • TABLE 3 Tris-lipidated Peptide Sequences
  • the C-terminus of a peptide is generally either a free carboxylic acid or an amide.
  • any one of the peptides in Tables 1, 2, and 3 can either have a C- terminal acid or a C-terminal amide. In certain aspects, any one of the peptides in Tables 1, 2, and 3 comprises a C-terminal acid. In certain aspects, any one of the peptides in Tables 1, 2, and 3 comprises a C-terminal amide.
  • Linkers used in various polypeptides provided herein can facilitate formation of a structure.
  • a polypeptide linker can comprise 1-50 amino acids, 1-25 amino acids, 25-50 amino acids, or 30-50 amino acids.
  • longer linkers correlate with higher activity (more flexible), but also decreased stability as the peptide becomes more exposed.
  • Linkers can comprise, e.g., (Gly-Ser)n, residues, where n is an integer of at least one, and up to, e.g., 4, 5, 6, 10, 20, 50, 100, or more, optionally with some Glu or Lys residues dispersed throughout to increase solubility.
  • linkers do not comprise any Serine residues, e.g., where the linker is subject to O-linked glycosylation.
  • linkers can contain cysteine residues, for example, if dimerization of linkers is used to bring two or more agonist polypeptides into a dimeric configuration.
  • an agonist polypeptide can comprise at least one, two, three, four, or more linkers. The length and amino acid sequence of a linker can be readily selected and optimized.
  • lipidated peptides can be prepared as C-terminal carboxamides, such as on NovaSyn ® TGR resin.
  • amino acids both natural and unnatural
  • NMP capping residual functionality with a solution of acetic anhydride and pyridine.
  • the N-Fmoc group can be deblocked using piperidine in DMF (20% v/v) at ambient temperature and the C-terminal residue incorporated as the N- Boc-protected form, e.g. Boc-His(Trt)-OH or Boc-Tyr(tBu)-OH or equivalent.
  • lipidation Fmoc-Lys(Mmt)-OH can be incorporated into the peptide backbone during automated assembly and upon completion the Mmt protecting group(s) can be removed manually and selectively by treatment of the synthesis resin with 1% TFA, 2%TIPS, DCM (10 x 1 minute, 20.0 mL/g).
  • the acidified resin can be quenched, such as with 5% DIPEA/NMP, and the exposed lysine amino-function(s) acylated, PEGylated or lipidated as required prior to peptide cleavage.
  • Crude peptides can be cleaved from the resin support by treatment with a suitable cleavage cocktail.
  • the cocktail consists of TFA (95% v/v), TIPS (2.5% v/v), and water (2.5% v/v) with agitation (3 x 1 hour at ambient temperature).
  • Cleavage aliquots can be combined, concentrated by rotary evaporation and precipitated by addition of cold diethyl ether, isolating the solids by centrifugation.
  • the crude peptides can be dried under a flow of dry nitrogen, reconstituted in a suitable aqueous buffer and filtered prior to chromatographic purification.
  • Crude mono-lipidated peptides can be dissolved in a solution of acetic acid/acetonitrile/water (1:5:50 v/v) and filtered.
  • the crude filtrates can be chromato graphed, such as over an Agilent Polaris C8-A stationary phase (21.2 x 250 mm, 5 micron) eluting with a linear solvent gradient of 10-70%, 15-80% or 20-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 minutes using a Varian SD-1 PrepStar binary pump system, monitoring by UV absorption at 210 nm.
  • the peptide-containing fractions can then be pooled, frozen (dry-ice/acetone) and lyophilized.
  • Crude bis-lipidated peptides can be dissolved, such as in 0.1M ammonium bicarbonate solution (1:5 acetonitrile/water v/v, pH 8.0) and filtered.
  • the crude filtrates can be chromatographed, such as over a Waters X-Bridge C18 stationary phase (19.0 x 250 mm, 5 micron) eluting with a linear solvent gradient of 20-90% B against A over 30 minutes using a Varian SD-1 PrepStar binary pump system, monitoring by UV absorption at 210 nm.
  • A 0.1M ammonium bicarbonate in water
  • B 0.1M ammonium bicarbonate in 1:2 water/acetonitrile
  • the peptide sequence can be a GLP-1 analog sequence such as those disclosed in
  • the lipid or lipid moiety can be any such as disclosed herein, including but not limited to: K(£-(PEG) 2 -(PEG) 2 -yE-Stearate); K(£-YE-Palmitoyl); K(£-(PEG) 2 -(PEG) 2 - ⁇ -Stearate); K(YE-Palmitoyl); K(£-(PEG) 2 -(PEG) 2 -(PEG) 2 -Stearoyl); K(£-yE-Lauroyl); K(£-YE-yE-Lauroyl); K(£-YE-YE-yE-Lauroyl); K(£-YE-YE-yE-Lauroyl); K(E-Ahx-Lauroyl); K(£-Ahx-Ahx- Lauroyl); K(E-Ahx-Ahx-Ahx-Lauroyl); K(£-(PEG) 2 -L
  • the methods suitably comprise identifying at least one native amino acid residue in the peptide for substitution. In other embodiments, the methods suitably comprise identifying at least two native amino acid residues in the peptide for substitution. Alpha-methyl functionalized amino acids can then substituted for the identified native amino acid residues.
  • the synthetic peptides prepared by the methods provided herein suitably maintain substantially the same or exhibit increased receptor potency and in some cases selectivity as a corresponding synthetic peptide that does not comprise the substitutions.
  • the synthetic peptides prepared according to the methods described herein can also be substantially resistant to proteolytic degradation.
  • substituted alpha-methyl functionalized amino acids correspond to the substituted native amino acid residues, and in additional embodiments, the substituted alpha-methyl functionalized amino acids correspond to the same class as the substituted native amino acid residues.
  • the substituted alpha-methyl functionalized amino acids can be alpha-methyl phenylalanine.
  • alpha-methyl phenylalanine is substituted for corresponding native amino acids, though in further embodiments of the methods, the alpha-methyl phenylalanine do not have to correspond to the same native amino acids for which the substitution is occurring.
  • the synthetic peptides prepared according to the methods described herein can be substantially resistant to one or more of DPP-IV, neprilysin, a- chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin degradation.
  • synthetic peptides can be prepared as C-terminal carboxamides on
  • identifying at least one native amino acid residue in the peptide for substitution suitably comprises identifying amino acids at sites susceptible to enzymatic cleavage.
  • exemplary methods of identifying amino acids at sites susceptible to enzymatic cleavage are well known in the art.
  • methods of identifying amino acids at sites susceptible to enzymatic cleavage suitably comprise exposing a natural peptide (e.g., a wild-type peptide) to a single enzyme under conditions in which the enzyme is active (e.g., suitable pH, buffer conditions, temperature, etc.) for a pre-determined amount of time and measuring the enzymatic degradation products of the peptide.
  • exemplary methods for measuring the enzymatic degradation products include, for example, reverse-phase liquid chromatography-mass spectrometry.
  • Peptide solutions can be added to solutions of a protease.
  • the peptide and enzyme can be co-incubated, suitably at about 37°C. Aliquots of the incubated peptide-enzyme mixture can be withdrawn periodically, quenched to arrest proteolytic activity, and analyzed by liquid chromatography-mass spectrometry (LC/MS). Analytes can be detected by both UV absorption (e.g., at 210 nm) and by ionization using a mass detector (ESI+ mode).
  • LC/MS liquid chromatography-mass spectrometry
  • Peptidic species (fragments) deriving from enzymatic cleavage of peptides can be analyzed post-process, and their molecular masses can be used to identify the precise cleavage position (highlighting the scissile bond in each case).
  • the methods described herein can be used to prepare any class of peptide having the recited characteristics.
  • the methods can be used to prepare incretin class peptides.
  • Synthetic incretin class peptides that can be prepared as described herein include, but are not limited to, glucagon-like peptide 1 (GLP-1), a glucose-dependent insulinotropic peptide (GIP), an exenatide peptide, plus glucagon, secretins, tenomodulin and oxyntomodulin.
  • GLP-1 glucagon-like peptide 1
  • GIP glucose-dependent insulinotropic peptide
  • exenatide peptide plus glucagon
  • secretins tenomodulin and oxyntomodulin.
  • the methods can be used to prepare synthetic GLP-1 peptides. In further embodiments, the methods can be used to prepare synthetic insulin.
  • methods of preparing a proteolytic ally stable peptide comprise exposing a peptide to one or more proteases, identifying at least two native amino acid residues which are sites susceptible to proteolytic cleavage, and substituting alpha-methyl functionalized amino acids for the identified amino acid residues.
  • the methods provide a synthetic peptide that maintains substantially the same or exhibits increased receptor potency and in some cases selectivity as a corresponding synthetic peptide that does not comprise the substitution(s).
  • the methods also provide a synthetic peptide that is substantially resistant to proteolytic degradation.
  • the substituted alpha-methyl functionalized amino acids correspond to the substituted native amino acid residues, and in additional embodiments, the substituted alpha-methyl functionalized amino acids correspond to the same class as the substituted native amino acid residues.
  • the substituted alpha-methyl functionalized amino acids can be selected from alpha-methyl functionalized Histidine, alpha-methyl functionalized Alanine, alpha-methyl functionalized Isoleucine, alpha-methyl functionalized Arginine, alpha-methyl functionalized Leucine, alpha-methyl functionalized Asparagine, alpha-methyl functionalized Lysine, alpha-methyl functionalized Aspartic acid, alpha-methyl functionalized Methionine, alpha-methyl functionalized Cysteine, alpha-methyl functionalized Phenylalanine, alpha-methyl functionalized Glutamic acid, alpha-methyl functionalized Threonine, alpha-methyl functionalized Glutamine, alpha- methyl functionalized Tryptophan, alpha-methyl functionalized Glycine, alpha-methyl functionalized Valine, alpha-methyl functionalized Ornithine, alpha-methyl functionalized Proline, alpha-methyl functionalized Selenocysteine, alpha-methyl functionalized Serine and alpha-methyl functionalized
  • the substituted alpha-methyl functionalized amino acids can be alpha-methyl phenylalanine and/or alpha-methyl lysine.
  • alpha-methyl phenylalanine and/or alpha-methyl lysine can be substituted for corresponding native amino acids, though in further embodiments of the methods, the alpha-methyl phenylalanine and/or alpha-methyl lysine do not have to correspond to the same native amino acids for which the substitution is occurring.
  • the synthetic peptides prepared according to the methods described herein can be substantially resistant to one or more of DPP-IV, neprilysin, a- chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin degradation.
  • formulations comprising a lipidated peptide described herein.
  • a lipidated peptide as described herein and a carrier Such formulations can be readily administered in the various methods described throughout.
  • the formulation comprises a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier means one or more non-toxic materials that do not interfere with the effectiveness of the biological activity of the lipidated peptides.
  • carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the lipidated peptide is combined to facilitate the application.
  • Formulations as described herein can be formulated for a particular dosage. Dosage regimens can be adjusted to provide the optimum response. It can be useful to formulate parenteral compositions in dosage unit forms for ease of administration and uniformity of dosage. Dosage unit forms as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of a lipidated peptide calculated to produce a therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms are dictated by, and directly dependent on, (a) the unique characteristics of the lipidated peptide and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such a lipidated peptide.
  • Formulations described herein can be formulated for particular routes of administration, such as oral, nasal, pulmonary, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration.
  • routes of administration such as oral, nasal, pulmonary, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration.
  • the formulations can conveniently be presented in unit dosage form and can be prepared by any methods known in the art of pharmacy.
  • the amount of lipidated peptide that can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration.
  • the amount of lipidated peptide that can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect.
  • Also provided herein are methods of treating a patient comprising administering a lipidated peptide, e.g., the formulations, described herein to a subject in need thereof.
  • subjects that can be administered the lipidated peptides in the various methods described herein are mammals, such as for example, humans, dogs, cats, primates, cattle, sheep, horses, pigs, etc.
  • Methods by which the lipidated peptides can be administered to the subject in any of the various methods described herein include, but are not limited to, intravenous (IV), intratumoral (IT), intralesional (IL), aerosol, percutaneous, oral, endoscopic, topical, intramuscular (IM), intradermal (ID), intraocular (IO), intraperitoneal (IP), transdermal (TD), intranasal (IN), intracerebral (IC), intraorgan (e.g. intrahepatic), slow release implant, or subcutaneous administration, or via administration using an osmotic or mechanical pump.
  • IV intravenous
  • IT intratumoral
  • IL intralesional
  • aerosol percutaneous, oral, endoscopic, topical, intramuscular (IM), intradermal (ID), intraocular (IO), intraperitoneal (IP), transdermal (TD), intranasal (IN), intracerebral (IC), intraorgan (e.g. intrahepatic), slow release implant, or subcutaneous administration, or via administration
  • the various methods can be carried out on mammalian subjects that are humans, including adults of any age and children.
  • the methods of treatment comprise treating a subject (also referred to herein as a patient) diagnosed with diabetes comprising administering a therapeutically effective amount of a suitable lipidated peptide as described herein, suitably a lipidated GLP-1 peptide as described herein.
  • the term "therapeutically effective amount” refers to the amount of a lipidated peptide, or formulation, that is sufficient to reduce the severity of a disease or disorder (or one or more symptoms thereof), ameliorate one or more symptoms of such a disease or disorder, prevent the advancement of such a disease or disorder, cause regression of such a disease or disorder, or enhance or improve the therapeutic effect(s) of another therapy.
  • the therapeutically effective amount cannot be specified in advance and can be determined by a caregiver, for example, by a physician or other healthcare provider, using various means, for example, dose titration.
  • methods are provided of treating a patient diagnosed with diabetes comprising administering a therapeutically effective amount of lipidated insulin to a patient.
  • lipidated peptides or formulations described herein can be delivered orally.
  • lipidated peptides can be substantially resistant to proteolytic degradation, e.g., degradation by enzymes in the stomach following oral administration.
  • Boc tert-butyloxycarbonyl; DCM, dichloromethane; DIPEA, N,N- diisopropylethylamine; DMF, N,N-dimethylformamide; DMSO, dimethylsulfoxide; EK, enterokinase; ESI, electrospray ionisation; Fmoc, 9-fluorenylmethyloxycarbonyl; GIP, gastric inhibitory polypeptide; GLP-1, glucagon-like peptide- 1; HCTU, O-(lH-6- chlorobenzotriazole- 1 -yl)- 1 , 1 ,3,3-tetramethyluronium hexafluorophosphate; RP-HPLC, reversed-phase high-performance liquid chromatography; EC50, half maximal (50%) effective concentration; LC/MS, liquid chromatography-coupled mass spectrometry; MeCN, acetonitrile; Mmt, 4-meth
  • N-a-Fmoc-L-amino acids were obtained from Bachem AG (Switzerland).
  • Unnatural amino acids were obtained from Iris Biotech AG (Germany), prepared by Pharmaron (China), or Peptech corporation (USA).
  • NovaSyn ® TGR (TentaGel Rink) and NovaSyn ® TGA (TentaGel Wang) synthesis resins were obtained from Novabiochem, Merck Biosciences (Germany).
  • Peptides were prepared by automated synthesis (PTI Prelude) using the Fmoc/ £ Bu protocol.
  • Asparagine (Asn) and glutamine (Gin) were incorporated as their sidechain trityl (Trt) derivatives.
  • Tryptophan (Trp) and lysine (Lys) were incorporated as their sidechain Boc derivatives.
  • Serine (Ser), threonine (Thr) and tyrosine (Tyr) were incorporated as sidechain £ Bu ethers, and aspartate (Asp) and glutamate (Glu) as their sidechain O'Bu esters.
  • Arginine (Arg) was incorporated as the sidechain Pbf derivative. Synthesis reagents were obtained from Sigma-Aldrich, Dorset, United Kingdom. Solvents were obtained from Merck, Darmstadt, Germany at the highest grade available and used without further purification.
  • Mass Lynx 3100 platform Analytes were chromatographed by elution over a Waters X- Bridge C18 stationary phase (4.6 x 100 mm, 3 micron) using a generic linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 10 minutes at 1.5 mL min 1 at ambient temperature. Analytes were detected by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI + mode), verifying molecular mass against calculated theoretical values. Analytical RP-HPLC spectra were recorded using an Agilent 1260 Infinity binary gradient system.
  • Table 3 details several commercially available circulatory and digestive proteases which are likely to contribute to the inactivation of endogenous peptide hormones e.g., GLP-1 through hydrolysis at numerous sites in the unmodified ligands. Several of these proteases were incubated with both native peptides and their modified counterparts containing a-methyl amino acids at known liable sites as described here.
  • Neprilysin 10.0 ⁇ g (-10 units) recombinant Neprilysin (R&D Systems: 1182-
  • ZNC-010) was reconstituted to 100 ⁇ . (100 ⁇ g/mL, -100 units/mL) in assay buffer (50 mM Tris, 50mM NaCl, 50mM NaHC0 3 , adjusted to pH 8.3) to give the enzyme stock solution.
  • assay buffer 50 mM Tris, 50mM NaCl, 50mM NaHC0 3 , adjusted to pH 8.3
  • 10 ⁇ ⁇ (1 ⁇ g, -1 unit) of neprilysin stock solution was incubated with 100 ⁇ ⁇ of peptide solution (1.0 mg/mL, -100 ⁇ g of peptide, -33 ⁇ ).
  • lipidated peptides 100 ⁇ ⁇ (10 ⁇ g, -10 units) of neprilysin stock solution was incubated with 100 ⁇ ⁇ of peptide solution (1.0 mg/mL, -100 ⁇ g of peptide, -25 ⁇ ). Ratio enzyme (units):peptide pinoles) -1:2.5.
  • Pepsin Lyophilized porcine pancreatic pepsin (Sigma: P7012) was reconstituted to afford a solution of 200 ⁇ g/mL (-500 units/mL) in assay buffer (0.1 M HCl, pH 2.0) to give the enzyme stock solution.
  • assay buffer 0.1 M HCl, pH 2.0
  • 10 ⁇ ⁇ (2 ⁇ g, -5 units) of enzyme solution was incubated with 100 ⁇ ⁇ of peptide solution (1.0 mg/mL, -100 ⁇ g of peptide, -33 ⁇ ).
  • Ratio enzyme (units) :peptide ( ⁇ moles) -1:6.
  • lipidated peptides 100 ⁇ ⁇ (20 ⁇ g, -50 units) of enzyme solution was incubated with 100 ⁇ L ⁇ of peptide solution (1.0 mg/mL, -100 ⁇ g of peptide, -25 ⁇ ). Ratio enzyme (units):peptide ( ⁇ moles) -2:1.
  • Trypsin Lyophilized porcine pancreatic trypsin (Sigma: T1426) was reconstituted to afford a solution of 100 ⁇ g/mL (-300 units/mL) in assay buffer (50 mM Tris, 10 mM CaCk, 150 mM NaCl, 1 mM HCl, adjusted to pH 7.8) to give the enzyme stock solution.
  • assay buffer 50 mM Tris, 10 mM CaCk, 150 mM NaCl, 1 mM HCl, adjusted to pH 7.8
  • 10 ⁇ ⁇ (1 ⁇ g, -3 units) of enzyme solution was incubated with 100 ⁇ ⁇ of peptide solution (1.0 mg/mL, -100 ⁇ g of peptide, -33 ⁇ ).
  • Ratio enzyme (units) amino acid pinoles) -1:11.
  • lipidated peptides 100 ⁇ ⁇ (10 ⁇ g, -30 units) of enzyme solution was incubated with 100 ⁇ ⁇ of peptide solution (1.0 mg/mL, -100 ⁇ g of peptide, -25 ⁇ ). Ratio enzyme (units):peptide pinoles) -1.2:1.
  • lipidated peptides 100 ⁇ ⁇ (10 ⁇ g, -10 units) of ⁇ -chymotrypsin stock solution was incubated with 100 ⁇ ⁇ of peptide solution (1.0 mg/mL, -100 ⁇ g of peptide, -25 ⁇ ). Ratio enzyme (units):peptide pinoles) -1:2.5.
  • Elastase 1.0 mg (-5 units) lyophilized porcine pancreatic elastase (Sigma: E7885) was reconstituted to 100 ⁇ ⁇ (10 mg/mL, -50 units/mL) in assay buffer (50 mM Tris, 50mM NaCl, 50mM NaHC0 3 ) and adjusted to pH 8.1 using NaOH (0.1 M) to give the enzyme stock solution.
  • assay buffer 50 mM Tris, 50mM NaCl, 50mM NaHC0 3
  • NaOH 0.1 M
  • 20 ⁇ ⁇ (200 ⁇ g, ⁇ 1 unit) of elastase stock solution was incubated with 100 ⁇ ⁇ of the peptide solution (1.0 mg/mL, -100 ⁇ g of peptide, -33 ⁇ ).
  • Ratio enzyme (units) peptide ( ⁇ moles) -1:33.
  • 100 ⁇ ⁇ (1000 ⁇ g, -5 units) of elastase stock solution was incubated with 100 ⁇ ⁇ of the peptide solution (1.0 mg/mL, -100 ⁇ g of peptide, -25 ⁇ ).
  • Neprilysin (R&D Systems: 1182-ZNC-OlO) was reconstituted to 100 ⁇ . (100 ⁇ g/mL, -100 units/mL) in assay buffer (50 mM Tris, 50mM NaCl, 50mM NaHC03, adjusted to pH 8.3) to give the enzyme stock solution.
  • Peptide stock solutions were prepared to a concentration of 330 ⁇ (-1.0 mg/mL) in assay buffer, pure water or 1XPBS (Dulbecco).
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min- 1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis were identified by molecular weight, allowing location of the site of cleavage.
  • Analytical RP-HPLC method Agilent Polaris C8-
  • Neprilysin (R&D Systems: 1182-ZNC-OlO) was reconstituted to 100 ⁇ . (100 ⁇ g/mL, -100 units/mL) in assay buffer (50 mM Tris, 50mM NaCl, 50mM NaHC0 3 , adjusted to pH 8.3) to give the enzyme stock solution.
  • Peptide stock solutions were prepared to a concentration of 250 ⁇ (-1.0 mg/mL) in assay buffer, pure water or 1XPBS (Dulbecco).
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min "1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI + mode).
  • ESI + mode Waters 3100 mass detector
  • Analytical RP-HPLC method Agilent Polaris C8- A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL mm 1 at 40°C with detection by UV absorption at 210 nm.
  • Manual integration (AUC) allowed estimation of remaining intact peptide over the time course of the experiment. Table 4 shows the results of this experiment.
  • Lyophilized porcine pancreatic pepsin (Sigma: P7012) was reconstituted to 200 ⁇ g/mL (-500 units/mL) in assay buffer (1.0 M HCl, pH 2.0) to give the enzyme stock solution.
  • Peptides stock solutions were prepared to a concentration of 330 ⁇ (-1.0 mg/mL) in assay buffer, pure water or 1XPBS (Dulbecco).
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10- 90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL mm 1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI + mode).
  • ESI + mode Waters 3100 mass detector
  • Analytical RP-HPLC method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min "1 at 40°C with detection by UV absorption at 210 nm.
  • Manual integration (AUC) allowed estimation of remaining intact peptide over the time course of the experiment. Table 5 shows the results of this experiment. 3.4.4 Evaluating proteolytic-resistance of mono- or bis-lipidated peptides to porcine pancreatic pepsin
  • Lyophilized porcine pancreatic pepsin (Sigma: P7012) was reconstituted to 200 ⁇ g/mL (-500 units/mL) in assay buffer (1.0 M HCl, pH 2.0) to give the enzyme stock solution.
  • Peptide stock solutions were prepared to a concentration of 250 ⁇ (-1.0 mg/mL) in assay buffer, pure water or IXPBS (Dulbecco).
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10- 90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL mm 1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI + mode).
  • ESI + mode Waters 3100 mass detector
  • Analytical RP-HPLC method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min "1 at 40°C with detection by UV absorption at 210 nm.
  • Manual integration allowed estimation of remaining intact peptide over the time course of the experiment. Table 5 shows the results of this experiment. Table 5: Percentage remaining intact peptide (AUC at specified time-point by RP-HPLC) upon incubation with pepsin.
  • Lyophilized porcine pancreatic trypsin (Sigma: T7409) was reconstituted to 200 ⁇ g/mL (-300 units/mL) in assay buffer (50 mM Tris, 10 mM CaCl 2 , 150 mM NaCl, 1 mM HC1, adjusted to pH 7.8) to give the enzyme stock solution.
  • Peptide stock solutions were prepared to a concentration of 330 ⁇ (-1.0 mg/mL) in assay buffer, pure water or 1XPBS (Dulbecco).
  • Lyophilized porcine pancreatic trypsin (Sigma: T7409) was reconstituted to 200 ⁇ g/mL (-300 units/mL) in assay buffer (50 mM Tris, 10 mM CaCl 2 , 150 mM NaCl, 1 mM HC1, adjusted to pH 7.8) to give the enzyme stock solution.
  • Peptide stock solutions were prepared to a concentration of 250 ⁇ (-1.0 mg/mL) in assay buffer, pure water or 1XPBS (Dulbecco).
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10- 90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL mm 1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI + mode).
  • ESI + mode Waters 3100 mass detector
  • Analytical RP-HPLC method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min "1 at 40°C with detection by UV absorption at 210 nm.
  • Manual integration allowed estimation of remaining intact peptide over the time course of the experiment. Table 6 shows the results of this experiment. Table 6: Percentage remaining intact peptide (AUC at specified time-point by RP-HPLC) upon incubation with trypsin.
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min 1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI + mode).
  • ESI + mode Waters 3100 mass detector
  • Analytical RP-HPLC method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min "1 at 40°C with detection by UV absorption at 210 nm.
  • Manual integration allows estimation of remaining intact peptide over the time course of the experiment. 3.4.8 Evaluating proteolytic-resistance of mono- or bis-lipidated peptides to a- chymotrypsin
  • recombinant a-chymotrypsin (R&D Systems: 6907-SE-010) is reconstituted to 100 ⁇ . (100 ⁇ g/mL, -100 units/mL) in assay buffer (50 mM Tris, 10 mM CaCl 2 , 150 mM NaCl, 1 mM HC1, adjusted to pH 7.8) to give the enzyme stock solution.
  • Peptide stock solutions are prepared to a concentration of 250 ⁇ (-1.0 mg/mL) in assay buffer, pure water or 1XPBS (Dulbecco).
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min 1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI + mode).
  • ESI + mode Waters 3100 mass detector
  • Analytical RP-HPLC method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) elutes with a linear binary gradient of 10- 90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min "1 at 40°C with detection by UV absorption at 210 nm.
  • Manual integration allows estimation of remaining intact peptide over the time course of the experiment.
  • Table 7 Percentage remaining intact peptide (AUC at specified time-point by RP-HPLC) upon incubation with a-chymotrypsin.
  • 1.0 mg ( ⁇ 5 units) lyophilized porcine pancreatic elastase (Sigma: E7885) is reconstituted to 100 ⁇ ⁇ (10 mg/mL, -50 units/mL) in assay buffer (50 mM Tris, 50mM NaCl, 50mM NaHC0 3 ) and adjusted to pH 8.1 using NaOH (1.0 M) to give the enzyme stock solution.
  • Peptide stock solutions are prepared to a concentration of 330 ⁇ (-1.0 mg/mL) in assay buffer, pure water or 1XPBS (Dulbecco).
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min 1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI + mode).
  • ESI + mode Waters 3100 mass detector
  • Analytical RP-HPLC method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) elutes with a linear binary gradient of 10- 90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min "1 at 40°C with detection by UV absorption at 210 nm.
  • Manual integration allows estimation of remaining intact peptide over the time course of the experiment.
  • 3.4.10 Evaluating proteolytic-resistance of mono- or bis-lipidated peptides to porcine pancreatic elastase
  • 1.0 mg ( ⁇ 5 units) lyophilized porcine pancreatic elastase (Sigma: E7885) are reconstituted to 100 ⁇ ⁇ (10 mg/mL, -50 units/mL) in assay buffer (50 mM Tris, 50mM NaCl, 50mM NaHC0 3 ) and adjusted to pH 8.1 using NaOH (1.0 M) to give the enzyme stock solution.
  • Peptide stock solutions are prepared to a concentration of 250 ⁇ (-1.0 mg/mL) in assay buffer, pure water or IXPBS (Dulbecco).
  • 100 ⁇ ⁇ (1000 ⁇ g, -5 units) of elastase stock solution are added to 100 ⁇ ⁇ of peptide stock solution (1.0 mg/mL, -100 ⁇ g of peptide, -25 ⁇ ) and the mixture is co-incubated in a temperature regulated bath at 37°C for the duration of the experiment (ratio enzyme [units] :peptide pinoles] -1:5).
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min 1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI + mode).
  • ESI + mode Waters 3100 mass detector
  • Analytical RP-HPLC method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) elutes with a linear binary gradient of 10- 90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min "1 at 40°C with detection by UV absorption at 210 nm.
  • Manual integration allows estimation of remaining intact peptide over the time course of the experiment.
  • 3.4.11 Evaluating proteolytic-resistance of mono- or bis-lipidated peptides to fasted- state simulated intestinal fluid (FASSIF/Pancreatin®)
  • Pancreatin® was prepared according to that described by Galia, Nicolaides, Horter, Lobenberg, Reppas and Dressman: Pharm. Res. 15 (1998) 698-705. The resulting preparation is proteolytically equivalent to -375 units/mL (375kU/L) and was used immediately without storage. Peptides for evaluation (1.0 mg, -250 nmoles) were initially dissolved in pre-warmed FASSIF without Pancreatin® (200 ⁇ ) to which was added pre- warmed fresh FASSIF/Pancreatin® (100 ⁇ ) to initiate potential digestion. Following momentary vortexing of the Eppendorf reaction tube the mixture was incubated at 37 °C in a thermostatic waterbath for the duration of the experiment.
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10- 90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min-1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode).
  • Table 8 Percentage remaining intact peptide (AUC at specified time-point by RP-HPLC) upon incubation with fasted-state simulated intestinal fluid (FASSIF/P).
  • Pancreatin® was prepared according to that described by Galia, Nicolaides, Horter, Lobenberg, Reppas and Dressman: Pharm. Res. 15 (1998) 698-705. To the resulting preparation was added human enterokinase (100 ⁇ g/mL) to ensure the potential for full zymogen activity of the mixture which was used immediately without storage. Peptides for evaluation (1.0 mg, -250 nmoles) were initially dissolved in pre-warmed FASSIF without Pancreatin® (200 ⁇ ) to which was added pre-warmed fresh FASSIF/Pancreatin® (100 ⁇ ) to initiate potential digestion.
  • LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min-1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode).
  • the biological activities/receptor potencies of the lipidated GLP- 1 anolog peptides described herein are suitably tested for biological activity, e.g., stimulation of one or more cellular receptor responses.
  • Stable cell lines expressing human, mouse, rat, or dog GLP-1 receptor (GLP-1R), glucagon receptor (GCGR) or glucose-dependent insulinotropic peptide (gastric inhibitory polypeptide) receptor (GIPR) are generated in HEK293 cells or CHO cells by standard methods. Peptide activation of these various receptors results in downstream accumulation of cAMP second messenger which can be measured in a functional activity assay.
  • a frozen cryo-vial of cells expressing the receptor of interest is thawed rapidly in a water-bath, transferred to pre-warmed assay buffer and spun at 240xg for 5 minutes. Cells are re-suspended in assay buffer at a batch-dependent optimized concentration (e.g. hGCGR cells at 2xl0 5 cells/ml, hGLP-lR and hGIPR cells at lxlO 5 cells /ml).
  • cAMP levels are measured using a commercially available cAMP dynamic 2 HTRF kit (Cisbio, Cat # 62AM4PEJ), following the two step protocol as per manufacturer's recommendations.
  • anti-cAMP cryptate donor fluorophore
  • cAMP-d2 acceptor fluorophore
  • 5 ⁇ anti-cAMP cryptate is added to wells of the assay plate
  • 5 ⁇ L cAMP-d2 is added to wells except non-specific binding (NSB) wells, to which conjugate and lysis buffer are added.
  • Plates are incubated at room temperature for one hour and then read on an Envision (Perkin Elmer) using excitation wavelength of 320nm and emission wavelengths of 620nm & 665nm. EC50 values of the synthetic peptides determined in cAMP assays are then determined.
  • CHO cells with stable recombinant expression of the human, mouse or rat GCGR or GLP- 1 receptor are cultured in assay buffer as above).
  • Cryopreserved cell stocks are prepared in lx cell freezing medium-DMSO serum free (Sigma Aldrich) at either lxlO 7 or 2xl0 7 /vial and stored at -80°C. Cells are rapidly thawed at 37°C and then diluted into assay buffer (buffer as above) containing serum albumin at 4.4, 3.2 and 3.2% for human, rat, and mouse serum albumin respectively.
  • Peptides are serially diluted in 100% DMSO and then diluted 100 fold into assay buffer as above containing serum albumin at stated final concentration.
  • Diluted peptides are then transferred into 384 black shallow well micro titre assay plates.
  • Cells are added to the assay plates and incubated for 30 min at room temperature. Following incubation the assay is stopped and cAMP levels measured using the HTRF® dynamic d2 cAMP assay kit available from CisBio Bioassays, as per the manufacturer's guidelines. Plates are read on Perkin Elmer ENVISION® fluorescence plate readers.
  • Human and rat serum albumin are purchased from Sigma Aldrich and mouse serum albumin from Equitech Bio Ltd.
  • EC50 values determined are dependent on both the potency of the peptides tested at the GLP- 1 and glucagon receptors in the recombinant cell lines and on the affinity of the peptide for serum albumin, which determines the amount of free peptide. Association with serum albumin increases the EC50 value obtained.
  • the fraction of free peptide at plasma concentrations of albumin and the EC50 at 0% serum albumin (SA) can be calculated based on the variation in cAMP generation with the SA concentration.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Organic Chemistry (AREA)
  • Endocrinology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Diabetes (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Emergency Medicine (AREA)
  • Child & Adolescent Psychology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Enzymes And Modification Thereof (AREA)
PCT/EP2016/063206 2015-06-10 2016-06-09 Protease-resistant lipidated glp-1 analogs Ceased WO2016198544A1 (en)

Priority Applications (21)

Application Number Priority Date Filing Date Title
NZ738909A NZ738909A (en) 2015-06-10 2016-06-09 Protease-resistant lipidated glp-1 analogs
EA201792640A EA036415B1 (ru) 2015-06-10 2016-06-09 Устойчивые к действию протеазы липидированные аналоги glp-1
MX2017015482A MX389407B (es) 2015-06-10 2016-06-09 Peptidos lipidados resistentes a proteasas.
EP20202888.2A EP3865504A1 (en) 2015-06-10 2016-06-09 Protease-resistant lipidated glp-1 analogs
CN201680033320.4A CN108271373B (zh) 2015-06-10 2016-06-09 蛋白酶抗性脂化glp-1类似物
TNP/2017/000519A TN2017000519A1 (en) 2015-06-10 2016-06-09 Protease-resistant lipidated glp-1 analogs
CA2988841A CA2988841C (en) 2015-06-10 2016-06-09 Protease-resistant lipidated glp-1 analogs
US15/579,774 US10414811B2 (en) 2015-06-10 2016-06-09 Protease-resistant lipidated GLP-1 analogs
MYPI2017704708A MY185816A (en) 2015-06-10 2016-06-09 Protease-resistant lipidated glp-1 analogs
JP2017563292A JP6811190B2 (ja) 2015-06-10 2016-06-09 プロテアーゼ耐性脂質付加glp−1類似体
ES16732248T ES2849950T3 (es) 2015-06-10 2016-06-09 Análogos de péptidos GLP-1 lipidados resistentes a proteasas
KR1020177037653A KR20180016441A (ko) 2015-06-10 2016-06-09 프로테아제-내성 지질화 glp-1 유사체
EP16732248.6A EP3307769B1 (en) 2015-06-10 2016-06-09 Protease-resistant lipidated glp-1 analogs
CR20170559A CR20170559A (es) 2015-06-10 2016-06-09 Peptidos lipidados resistentes a proteasas.
AU2016277449A AU2016277449B2 (en) 2015-06-10 2016-06-09 Protease-resistant lipidated GLP-1 analogs
IL255978A IL255978B (en) 2015-06-10 2017-11-28 Protease-resistant lipotransduction analogs of glp-1
CONC2017/0012675A CO2017012675A2 (es) 2015-06-10 2017-12-11 Péptidos lipidados resistentes a proteasas
PH12017502259A PH12017502259A1 (en) 2015-06-10 2017-12-11 Protease-resistant lipidated glp-1 analogs
US16/521,662 US20200079833A1 (en) 2015-06-10 2019-07-25 Protease-resistant lipidated glp-1 analogs
AU2019229424A AU2019229424A1 (en) 2015-06-10 2019-09-13 Protease-resistant lipidated glp-1 analogs
US17/169,833 US20210221866A1 (en) 2015-06-10 2021-02-08 Protease-resistant lipidated glp-1 analogs

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562173631P 2015-06-10 2015-06-10
US62/173,631 2015-06-10
US201662343390P 2016-05-31 2016-05-31
US62/343,390 2016-05-31

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/579,774 A-371-Of-International US10414811B2 (en) 2015-06-10 2016-06-09 Protease-resistant lipidated GLP-1 analogs
US16/521,662 Continuation US20200079833A1 (en) 2015-06-10 2019-07-25 Protease-resistant lipidated glp-1 analogs

Publications (1)

Publication Number Publication Date
WO2016198544A1 true WO2016198544A1 (en) 2016-12-15

Family

ID=56235790

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2016/063206 Ceased WO2016198544A1 (en) 2015-06-10 2016-06-09 Protease-resistant lipidated glp-1 analogs

Country Status (25)

Country Link
US (3) US10414811B2 (https=)
EP (2) EP3307769B1 (https=)
JP (1) JP6811190B2 (https=)
KR (1) KR20180016441A (https=)
CN (1) CN108271373B (https=)
AU (2) AU2016277449B2 (https=)
CA (1) CA2988841C (https=)
CL (1) CL2017003144A1 (https=)
CO (1) CO2017012675A2 (https=)
CR (1) CR20170559A (https=)
DO (1) DOP2017000287A (https=)
EA (1) EA036415B1 (https=)
ES (1) ES2849950T3 (https=)
IL (1) IL255978B (https=)
MX (1) MX389407B (https=)
MY (1) MY185816A (https=)
NI (1) NI201700156A (https=)
NZ (1) NZ738909A (https=)
PE (1) PE20180659A1 (https=)
PH (1) PH12017502259A1 (https=)
SG (1) SG10201911837SA (https=)
SV (1) SV2017005585A (https=)
TN (1) TN2017000519A1 (https=)
TW (1) TWI726889B (https=)
WO (1) WO2016198544A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017211922A3 (en) * 2016-06-09 2018-01-18 Medimmune Limited Protease-resistant mono-lipidated peptides
WO2019193576A1 (en) 2018-04-05 2019-10-10 Sun Pharmaceutical Industries Limited Novel glp-1 analogues
JP2021501172A (ja) * 2017-10-31 2021-01-14 メドイミューン・リミテッドMedImmune Limited Glp−1ペプチド類似体の経口送達

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3204051A1 (en) 2021-01-20 2022-07-28 Brian Lian Compositions and methods for the treatment of metabolic and liver disorders
JP7642830B2 (ja) 2021-09-15 2025-03-10 バイキング・セラピューティクス・インコーポレイテッド 代謝及び肝臓障害の処置のための組成物及び方法
TW202346323A (zh) * 2022-02-07 2023-12-01 英商梅迪繆思有限公司 具有改善的生物穩定性的glp—1及升糖素雙重激動肽

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014049610A2 (en) * 2012-09-26 2014-04-03 Cadila Healthcare Limited Peptides as gip, glp-1 and glucagon receptors triple-agonist
WO2014088631A1 (en) * 2012-12-06 2014-06-12 Stealth Peptides International, Inc. Peptide therapeutics and methods for using same
WO2015086686A2 (en) 2013-12-13 2015-06-18 Medimmune Limited Protease resistant peptides

Family Cites Families (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE3572982D1 (en) 1984-03-06 1989-10-19 Takeda Chemical Industries Ltd Chemically modified lymphokine and production thereof
WO1990006952A1 (fr) 1988-12-22 1990-06-28 Kirin-Amgen, Inc. Facteur de stimulation de colonies de granulocytes modifies chimiquement
JP2006501820A (ja) 2002-09-06 2006-01-19 バイエル・フアーマシユーチカルズ・コーポレーシヨン 修飾glp−1受容体アゴニストおよびそれらの薬理学的使用法
CN101010339B (zh) * 2004-07-02 2011-11-09 布里斯托尔-迈尔斯斯奎布公司 人类胰高血糖素样肽-1调节剂及它们在治疗糖尿病及相关病况中的用途
US8318668B2 (en) * 2005-09-08 2012-11-27 Trustees Of Tufts College Stabilized GLP-1 analogs
EP1854455B1 (en) * 2006-05-10 2009-10-07 Biocompatibles UK Limited Spherical microcapsules comprising GLP-1 peptides, their production and use
US20100022457A1 (en) 2006-05-26 2010-01-28 Bristol-Myers Squibb Company Sustained release glp-1 receptor modulators
WO2008023050A1 (en) 2006-08-25 2008-02-28 Novo Nordisk A/S Acylated exendin-4 compounds
SI2173890T1 (sl) 2007-06-21 2011-06-30 Univ Muenchen Tech Biološko aktivni proteini, ki imajo povečano in vivo in/ali in vitro stabilnost
CA2707448C (en) 2007-12-11 2014-10-14 Cadila Healthcare Limited Peptidomimetics with glucagon antagonistic and glp-1 agonistic activities
EP2364326B1 (en) * 2008-12-05 2018-07-04 Glaxo Group Limited Methods for selecting protease resistant polypeptides
EP2443146B1 (en) 2009-06-16 2016-10-05 Indiana University Research And Technology Corporation Gip receptor-active glucagon compounds
WO2011048614A2 (en) 2009-10-22 2011-04-28 Cadila Healthcare Limited Short chain peptidomimetics based orally active glp-1 agonist and glucagon receptor antagonist
MX2012013001A (es) 2010-05-13 2013-02-26 Univ Indiana Res & Tech Corp Peptidos de la superfamilia de glucagon que presentan actividad del receptor nuclear de hormonas.
US20130143800A1 (en) 2011-11-07 2013-06-06 Research Development Foundation Combination therapies to treat diabetes
CA2902352A1 (en) * 2013-03-14 2014-09-18 Medimmune Limited Pegylated glucagon and glp-1 co-agonists for the treatment of obesity

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014049610A2 (en) * 2012-09-26 2014-04-03 Cadila Healthcare Limited Peptides as gip, glp-1 and glucagon receptors triple-agonist
WO2014088631A1 (en) * 2012-12-06 2014-06-12 Stealth Peptides International, Inc. Peptide therapeutics and methods for using same
WO2015086686A2 (en) 2013-12-13 2015-06-18 Medimmune Limited Protease resistant peptides

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
GALIA; NICOLAIDES; HORTER; LOBENBERG, REPPAS AND DRESSMAN: PHARM. RES., vol. 15, 1998, pages 698 - 705
GREEN B D ET AL: "DEGRADATION, RECEPTOR BINDING, INSULIN SECRETING AND ANTIHYPERGLYCAEMIC ACTIONS OF PALMITATE-DERIVATISED NATIVE AND ALA8-SUBSTITUTED GLP-1 ANALOGUES", BIOLOGICAL CHEMISTRY, WALTER DE GRUYTER GMBH & CO, BERLIN, DE, vol. 385, no. 2, 1 February 2004 (2004-02-01), pages 169 - 177, XP009067701, ISSN: 1431-6730, DOI: 10.1515/BC.2004.035 *
HUI HONGXIANG ET AL: "Structure and function studies of glucagon-like peptide-1 (GLP-1): the designing of a novel pharmacological agent for the treatment of diabetes", DIABETES/METABOLISM RESEARCH AND REVIEWS, WILEY, LONDON, GB, vol. 21, no. 4, 1 July 2005 (2005-07-01), pages 313 - 331, XP002559636, ISSN: 1520-7552, [retrieved on 20050426], DOI: 10.1002/DMRR.553 *
KIM S ET AL: "Synthesis, bioactivity and specificity of glucagon-like peptide-1 (7-37)/polymer conjugate to isolated rat islets", BIOMATERIALS, ELSEVIER SCIENCE PUBLISHERS BV., BARKING, GB, vol. 26, no. 17, 1 June 2005 (2005-06-01), pages 3597 - 3606, XP027767990, ISSN: 0142-9612, [retrieved on 20050601] *
W.C.CHAN; P.D.WHITE.: "Fmoc Solid Phase Peptide Synthesis: A Practical Approach", 2004, OXFORD UNIVERSITY PRESS
YOUN ET AL: "Evaluation of therapeutic potentials of site-specific PEGylated glucagon-like peptide-1 isomers as a type 2 anti-diabetic treatment: Insulinotropic activity, glucose-stabilizing capability, and proteolytic stability", BIOCHEMICAL PHARMACOLOGY, ELSEVIER, US, vol. 73, no. 1, 6 December 2006 (2006-12-06), pages 84 - 93, XP005794625, ISSN: 0006-2952, DOI: 10.1016/J.BCP.2006.09.013 *

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017211922A3 (en) * 2016-06-09 2018-01-18 Medimmune Limited Protease-resistant mono-lipidated peptides
JP2021501172A (ja) * 2017-10-31 2021-01-14 メドイミューン・リミテッドMedImmune Limited Glp−1ペプチド類似体の経口送達
WO2019193576A1 (en) 2018-04-05 2019-10-10 Sun Pharmaceutical Industries Limited Novel glp-1 analogues
US11242373B2 (en) 2018-04-05 2022-02-08 Sun Pharmaceutical Industries Limited GLP-1 analogues
US11447535B2 (en) 2018-04-05 2022-09-20 Sun Pharmaceutical Industries Limited GLP-1 analogues
EP4122954A1 (en) 2018-04-05 2023-01-25 Sun Pharmaceutical Industries Limited Novel glp-1 analogues
US11866477B2 (en) 2018-04-05 2024-01-09 Sun Pharmaceutical Industries Limited GLP-1 analogues
US11873328B2 (en) 2018-04-05 2024-01-16 Sun Pharmaceutical Industries Limited GLP-1 analogues
EP4364751A2 (en) 2018-04-05 2024-05-08 Sun Pharmaceutical Industries Limited Novel glp-1 analogues
US12421289B2 (en) 2018-04-05 2025-09-23 Sun Pharmaceutical Industries Limited GLP-1 analogues

Also Published As

Publication number Publication date
US20180162920A1 (en) 2018-06-14
CR20170559A (es) 2018-05-11
SG10201911837SA (en) 2020-01-30
EP3307769B1 (en) 2020-12-02
DOP2017000287A (es) 2018-04-15
CN108271373B (zh) 2021-12-28
SV2017005585A (es) 2018-05-22
CL2017003144A1 (es) 2018-04-13
NI201700156A (es) 2018-10-18
AU2016277449A1 (en) 2018-02-01
CN108271373A (zh) 2018-07-10
KR20180016441A (ko) 2018-02-14
CO2017012675A2 (es) 2018-02-28
ES2849950T3 (es) 2021-08-24
IL255978A (en) 2018-01-31
MY185816A (en) 2021-06-10
US10414811B2 (en) 2019-09-17
PH12017502259A1 (en) 2018-06-25
TN2017000519A1 (en) 2019-04-12
IL255978B (en) 2021-04-29
US20200079833A1 (en) 2020-03-12
MX389407B (es) 2025-03-20
TW201710287A (zh) 2017-03-16
CA2988841A1 (en) 2016-12-15
MX2017015482A (es) 2018-02-09
PE20180659A1 (es) 2018-04-17
AU2016277449B2 (en) 2019-06-20
TWI726889B (zh) 2021-05-11
EA201792640A1 (ru) 2018-06-29
NZ738909A (en) 2019-08-30
JP6811190B2 (ja) 2021-01-13
AU2019229424A1 (en) 2019-10-03
US20210221866A1 (en) 2021-07-22
JP2018518485A (ja) 2018-07-12
EP3865504A1 (en) 2021-08-18
EP3307769A1 (en) 2018-04-18
EA036415B1 (ru) 2020-11-09
CA2988841C (en) 2023-06-06

Similar Documents

Publication Publication Date Title
US20210221866A1 (en) Protease-resistant lipidated glp-1 analogs
US20160318987A1 (en) Protease resistant peptides
WO2017211922A2 (en) Protease-resistant mono-lipidated peptides
US20250353891A1 (en) Glp-1 and glucagon dual agonist peptides with improved biological stability
US20190298805A1 (en) Glucagon analogs and methods of use thereof
HK1249120B (en) Protease-resistant lipidated glp-1 analogs
HK1260766A1 (en) Protease resistant peptides

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16732248

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 255978

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 11201709863U

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: MX/A/2017/015482

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 15579774

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2017563292

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 002540-2017

Country of ref document: PE

WWE Wipo information: entry into national phase

Ref document number: CR2017-000559

Country of ref document: CR

ENP Entry into the national phase

Ref document number: 2988841

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: NC2017/0012675

Country of ref document: CO

Ref document number: 2017-000156 I

Country of ref document: NI

Ref document number: 12017502259

Country of ref document: PH

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 201792640

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 20177037653

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: DZP2017000735

Country of ref document: DZ

WWE Wipo information: entry into national phase

Ref document number: 2016732248

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2016277449

Country of ref document: AU

Date of ref document: 20160609

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017026217

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112017026217

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20171205