WO2016160956A1 - Compositions for enhanced enzyme production - Google Patents
Compositions for enhanced enzyme production Download PDFInfo
- Publication number
- WO2016160956A1 WO2016160956A1 PCT/US2016/024966 US2016024966W WO2016160956A1 WO 2016160956 A1 WO2016160956 A1 WO 2016160956A1 US 2016024966 W US2016024966 W US 2016024966W WO 2016160956 A1 WO2016160956 A1 WO 2016160956A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- biomass
- combination
- product
- oligosaccharides
- microorganism
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/14—Fungi; Culture media therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/22—Processes using, or culture media containing, cellulose or hydrolysates thereof
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/38—Chemical stimulation of growth or activity by addition of chemical compounds which are not essential growth factors; Stimulation of growth by removal of a chemical compound
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2405—Glucanases
- C12N9/2434—Glucanases acting on beta-1,4-glucosidic bonds
- C12N9/2437—Cellulases (3.2.1.4; 3.2.1.74; 3.2.1.91; 3.2.1.150)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P19/00—Preparation of compounds containing saccharide radicals
- C12P19/02—Monosaccharides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P19/00—Preparation of compounds containing saccharide radicals
- C12P19/14—Preparation of compounds containing saccharide radicals produced by the action of a carbohydrase (EC 3.2.x), e.g. by alpha-amylase, e.g. by cellulase, hemicellulase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01004—Cellulase (3.2.1.4), i.e. endo-1,4-beta-glucanase
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02E—REDUCTION OF GREENHOUSE GAS [GHG] EMISSIONS, RELATED TO ENERGY GENERATION, TRANSMISSION OR DISTRIBUTION
- Y02E50/00—Technologies for the production of fuel of non-fossil origin
- Y02E50/10—Biofuels, e.g. bio-diesel
Definitions
- the present invention relates generally to compositions for enhanced production of a protein, e.g., an enzyme, e.g., an amylase or a biomass degrading enzyme, e.g., a cellulase or a hemicellulase, and methods for enhanced biomass degrading enzyme production.
- a protein e.g., an enzyme, e.g., an amylase or a biomass degrading enzyme, e.g., a cellulase or a hemicellulase
- Such compositions comprise a caramelized sugar product.
- the methods described herein can be used to process biomass materials.
- Biomass degrading enzymes such as cellulases, xylanases, and ligninases, are important for the degradation of biomass, such as feedstock.
- Cellulosic and lignocellulosic materials are produced, processed, and used in large quantities in a number of applications. Often such materials are used once, and then discarded as waste, or are simply considered to be wasted materials, e.g., sewage, bagasse, sawdust, and stover.
- Microorganisms that produce biomass degrading enzymes, endogenously or heterologously, can be used to process biomass materials, e.g., to produce sugar products.
- compositions and/or methods that enhance biomass degrading enzyme production to increase the efficiency of biomass processing.
- the present invention is based, at least in part, on the surprising discovery that caramelized sugar products can induce production of biomass degrading enzymes when introduced to microorganisms capable of producing a biomass degrading enzyme, e.g., T.
- compositions and methods for enhancing the production of a biomass degrading enzyme from a microorganism are provided herein.
- the present invention features a method for inducing production of a protein comprising contacting a microorganism that produces the protein with a composition comprising a caramelized sugar product under conditions sufficient for production of a protein.
- the protein is an enzyme.
- the enzyme is an amylase or a biomass degrading enzyme.
- the microorganism is in a cell culture.
- sugar is added to the cell culture prior to contacting the microorganism with the composition comprising a caramelized sugar product.
- the microorganism is contacted with the composition comprising a caramelized sugar product when the cell culture is substantially free from sugar.
- the caramelized sugar product is produced by caramelizing glucose, xylose, maltose, lactose, or a combination thereof. In some embodiments, the caramelized sugar product is produced by caramelizing saccharified biomass comprising xylose and glucose. In some embodiments, the caramelized sugar product comprises oligosaccharides, dehydration products of the oligosaccharides, hydration products of the oligosaccharides, disproportionation products of the oligosaccharides, colored aromatic products, or any combination thereof. In some embodiments, the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof.
- the caramelized sugar product is produced by caramelizing glucose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising glucose.
- the caramelized sugar product is produced by caramelizing maltose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising maltose.
- the caramelized sugar product is produced by caramelizing lactose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising lactose.
- the caramelized sugar product is produced by caramelizing xylose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising xylose.
- trisaccharides are the most abundant species.
- the biomass degrading enzyme comprises an amylase, e.g., an alpha, beta or gamma amylase, an endoglucanase, an exoglucanase, a cellobiase, a
- cellobiohydrolase a xylanase, a ligninase, or a hemicellulase, or a combination thereof.
- the composition further comprises an inducer biomass.
- the inducer biomass comprises a starchy material or a starchy material that includes a cellulosic component.
- the inducer biomass e.g., starchy material or starchy material that includes a cellulosic component, comprises one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof.
- the agricultural product or waste comprises sugar cane jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, corn cobs, corn stover, corn fiber, coconut hair, beet pulp, bagasse, soybean stover, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, or beeswing, or a combination thereof.
- the agricultural product or waste comprises corn cobs, corn stover, corn fiber, or beeswing. In some embodiments, the agricultural product or waste comprises corn cobs. In some embodiments, the agricultural product or waste comprises beeswing. In some embodiments, the paper product or waste comprises paper, pigmented papers, loaded papers, coated papers, filled papers, magazines, printed matter, printer paper, polycoated paper, cardstock, cardboard, paperboard, or paper pulp, or a combination thereof. In some embodiments, the forestry product comprises aspen wood, particle board, wood chips, or sawdust, or a combination thereof. In some embodiments, the general waste comprises manure, sewage, or offal, or a combination thereof.
- the inducer biomass is pre-treated to reduce the recalcitrance of the inducer biomass.
- the pre-treatment of the inducer biomass comprises exposure to an electron beam, bombardment with electrons, sonication, oxidation, pyrolysis, steam explosion, chemical treatment, mechanical treatment, or freeze grinding.
- the pre-treatment of the inducer biomass comprises exposure to an electron beam or bombardment with electrons.
- the composition further comprises cellobiose, -cellobiono-l,5- lactone, lactose, D-xylose, xylobiose, galactose, and sophorose.
- the microorganism that produces a biomass degrading enzyme is from a species in the genera selected from Bacillus, Coprinus, Myceliophthora,
- the microorganism is a fungal cell.
- the microorganism that produces a biomass degrading enzyme is selected from Aspergillus, Humicola insolens (Scytalidium thermophilum), Coprinus cinereus, Fusarium oxysporum, Myceliophthora thermophila, Meripilus giganteus, Thielavia terrestris, Acremonium persicinum, Acremonium acremonium, Acremonium brachypenium, Acremonium dichromosporum, Acremonium obclavatum,
- the microorganism is T. reesei. In certain embodiments, the microorganism is T. reesei, or a variant thereof, e.g., RUT-NG14, PC3-7, QM9414, and RUT-C30.
- the amount of biomass degrading enzyme produced is increased by at least 1-fold, e.g., at least 1.2-fold, 1.5-fold, 1.8-fold, 2-fold, or more, compared the amount of biomass degrading enzyme produced by the microorganism without contacting with a caramelized sugar product. In some embodiments, the amount of biomass degrading enzyme produced is increased by at least 1-fold, e.g., at least 1.2-fold, 1.5 fold, 1.8-fold, 2-fold, compared the amount of biomass degrading enzyme produced by contacting the microorganism with a inducer biomass. In some embodiments, the biomass degrading enzyme comprises one or more, or all, of the enzymes listed in Table 1.
- the method further comprises separating the biomass degrading enzyme from a component of the cell culture. In some embodiments, the method further comprises separating the biomass degrading enzyme from the microorganism or remaining inducer biomass. In some embodiments, the method further comprises separating the biomass degrading enzyme from the microorganism or remaining inducer biomass by chromatography or filtration. In some embodiments, the biomass degrading enzyme is purified from the cell culture.
- the method further comprises a step comprising: a) contacting the microorganism with a sugar in a first container under conditions such that the
- microorganism proliferates; and b) transferring the microorganism to a second container, wherein the second container is larger, e.g., by volume, than the first container; and wherein said step is performed prior to contacting the microorganism with the composition.
- the step is repeated 1 or more times, e.g., 2, 3, 4, 5 times.
- the present invention features a method for producing a product from a biomass, comprising: a) inducing the production of a biomass degrading enzyme using a method comprising contacting a microorganism that produces the biomass degrading enzyme with a composition comprising a caramelized sugar product under conditions sufficient for production of a biomass degrading enzyme; b) providing a biomass; and c) contacting the biomass with the microorganism of step a) or the biomass degrading enzyme that has been separated or purified from the microorganism of step a), under conditions suitable for production of the product.
- the product is a sugar product.
- the product is glucose and/or xylose.
- the method further comprises isolating the product.
- the isolating of the product comprises precipitation, crystallization, chromatography, centrifugation, and/or extraction.
- the biomass degrading enzyme is an endoglucanase, a cellobiase, a cellobiohydrolase, a xylanase, a ligninase, or a hemicellulase, or a combination thereof.
- the biomass degrading enzyme comprises one or more, or all, of the enzymes listed in Table 1.
- the method further comprises a step of treating the biomass prior to step c) to reduce the recalcitrance of the biomass.
- the treating comprises exposure to an electron beam, bombardment with electrons, sonication, oxidation, pyrolysis, steam explosion, chemical treatment, mechanical treatment, or freeze-grinding.
- the treating comprises exposure to an electron beam or bombardment with electrons.
- the biomass comprises a starchy material or a starchy material that includes a cellulosic component.
- the biomass comprises one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof; wherein: a) an agricultural product or waste comprises sugar cane jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, corn cobs, corn stover, corn fiber, coconut hair, beet pulp, bagasse, soybean stover, grain residues
- the caramelized sugar product is produced by caramelizing glucose, maltose, xylose, lactose, or a combination thereof. In some embodiments, the caramelized sugar product is produced by caramelizing saccharified biomass comprising xylose and glucose. In some embodiments, the caramelized sugar product comprises oligosaccharides, dehydration products of the oligosaccharides, hydration products of the oligosaccharides, disproportionation products of the oligosaccharides, colored aromatic products, or any combination thereof.
- the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasacchrides, hexasaccharides, or a combination thereof.
- the caramelized sugar product is produced by caramelizing glucose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising glucose.
- the caramelized sugar product is produced by caramelizing maltose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising maltose.
- the caramelized sugar product is produced by caramelizing lactose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising lactose.
- the caramelized sugar product is produced by caramelizing xylose and wherein the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising xylose.
- the oligosaccharides comprise more than one species of oligosaccharides, trisaccharides are the most abundant species.
- the composition further comprises an inducer biomass.
- the inducer biomass comprises a starchy material or a starchy material that includes a cellulosic component.
- the inducer biomass comprises one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof; wherein a) an agricultural product or waste comprises sugar cane jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, corn cobs, corn stover, corn fiber, coconut
- the inducer biomass is pre-treated to reduce the recalcitrance of the inducer biomass.
- the pre-treatment of the biomass comprises exposure to an electron beam, bombardment with electrons, sonication, oxidation, pyrolysis, steam explosion, chemical treatment, mechanical treatment, or freeze grinding.
- the pre-treatment of the biomass comprises exposure to an electron beam or bombardment with electrons.
- the inducer biomass of the present invention is the same as the biomass provided in step (b).
- the composition further comprises cellobiose, -cellobiono-l,5- lactone, lactose, D-xylose, xylobiose, galactose, and sophorose.
- the microorganism that produces a biomass degrading enzyme is from a species in the genera selected from Bacillus, Coprinus, Myceliophthora,
- the microorganism is a fungal cell.
- the microorganism that produces a biomass degrading enzyme is selected from Aspergillus, Humicola insolens (Scytalidium thermophilum), Coprinus cinereus, Fusarium oxysporum, Myceliophthora thermophila, Meripilus giganteus, Thielavia terrestris, Acremonium persicinum, Acremonium acremonium, Acremonium brachypenium, Acremonium dichromosporum, Acremonium obclavatum,
- the microorganism is T. reesei. In certain embodiments, the microorganism is T. reesei, or a variant thereof, e.g., RUT-NG14, PC3-7, QM9414, and RUT-C30.
- the present invention features a composition comprising a caramelized sugar product for use in the methods disclosed herein.
- the caramelized sugar product is produced by caramelizing glucose, maltose, xylose, lactose, or a combination thereof.
- the caramelized sugar product is produced by caramelizing saccharified biomass comprising xylose and glucose.
- the caramelized sugar product comprises oligosaccharides, dehydration products of the
- oligosaccharides hydration products of the oligosaccharides, disproportionation products of the oligosaccharides, colored aromatic products, or any combination thereof.
- the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasacchrides, hexasaccharides, or a combination thereof.
- the caramelized sugar product is produced by caramelizing glucose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising glucose.
- the caramelized sugar product is produced by caramelizing maltose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising maltose.
- the caramelized sugar product is produced by caramelizing lactose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising lactose.
- the caramelized sugar product is produced by caramelizing xylose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising xylose.
- the oligosaccharides comprise more than one species of oligosaccharides, trisaccharides are the most abundant species.
- the composition further comprises an inducer biomass.
- the inducer biomass comprises a starchy material or a starchy material that includes a cellulosic component.
- the inducer biomass comprises one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof.
- An agricultural product or waste comprises sugar cane jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, corn cobs, corn stover, corn fiber, coconut hair, beet pulp, bagasse, soybean stover, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, or beeswing, or a combination thereof.
- a paper product or waste comprises paper, pigmented papers, loaded papers, coated papers, filled papers, magazines, printed matter, printer paper, polycoated paper, cardstock, cardboard, paperboard, or paper pulp, or a combination thereof.
- a forestry product comprises aspen wood, particle board, wood chips, or sawdust, or a combination thereof.
- a general waste comprises manure, sewage, or offal, or a combination thereof.
- the inducer biomass is pre-treated to reduce the recalcitrance of the inducer biomass.
- the pre-treatment of the biomass comprises exposure to an electron beam, bombardment with electrons, sonication, oxidation, pyrolysis, steam explosion, chemical treatment, mechanical treatment, or freeze grinding.
- the pre-treatment of the biomass comprises exposure to an electron beam or bombardment with electrons.
- the composition further comprises cellobiose, -cellobiono-l,5- lactone, lactose, D-xylose, xylobiose, galactose, and sophorose.
- the present invention features a cell culture comprising a microorganism capable of producing a biomass degrading enzyme and a caramelized sugar product.
- the cell culture further comprises cell culture media.
- the biomass degrading enzyme is an endoglucanase, a cellobiase, a
- the biomass degrading enzyme comprises one or more, or all, of the enzymes listed in Table 1.
- the caramelized sugar product is produced by caramelizing glucose, maltose, xylose, lactose, or a combination thereof.
- the caramelized sugar product is produced by caramelizing saccharified biomass comprising xylose and glucose.
- the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasacchrides, hexasaccharides, or a combination thereof.
- the caramelized sugar product comprises oligosaccharides, dehydration products of the oligosaccharides, hydration products of the oligosaccharides, disproportionation products of the oligosaccharides, colored aromatic products, or any combination thereof.
- the caramelized sugar product is produced by caramelizing glucose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising glucose.
- the caramelized sugar product is produced by caramelizing maltose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising maltose.
- the caramelized sugar product is produced by caramelizing lactose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising lactose.
- the caramelized sugar product is produced by caramelizing xylose and the oligosaccharides comprise disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, or a combination thereof, comprising xylose.
- the microorganism is from a species in the genera selected from Bacillus, Coprinus, Myceliophthora, Cephalosporium, Scytalidium, Penicillium, Aspergillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, Chrysosporium or Trichoderma.
- the microorganism is a fungal cell.
- the microorganism is selected from Aspergillus, Humicola insolens (Scytalidium thermophilum), Coprinus cinereus, Fusarium oxysporum, Myceliophthora thermophila, Meripilus giganteus, Thielavia terrestris, Acremonium persicinum, Acremonium acremonium, Acremonium brachypenium, Acremonium dichromosporum, Acremonium obclavatum, Acremonium pinkertoniae, Acremonium roseogriseum, Acremonium incoloratum, Acremonium furatum, Chrysosporium lucknowense, Trichoderma viride, Trichoderma reesei, or Trichoderma koningii.
- the microorganism is T. reesei. In certain embodiments, the microorganism is T. reesei, or a variant thereof, e.g., RUT-NG14, PC3-7, QM9414, and RUT- C30.
- the cell culture further comprises an inducer biomass.
- the inducer biomass comprises a starchy material or a starchy material that includes a cellulosic component.
- the inducer biomass comprises one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof; wherein a) an agricultural product or waste comprises sugar cane jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, corn cobs, corn stover, corn fiber,
- the cell culture further comprises a biomass degrading enzyme produced by the microorganism.
- the biomass degrading enzyme is an endoglucanase, a cellobiase, a cellobiohydrolase, a xylanase, a ligninase, or a hemicellulase, or a combination thereof.
- the biomass degrading enzyme comprises one or more, or all, of the enzymes listed in Table 1.
- Figure 1 is a graph showing the induction of cellulase production by caramelized sugars without cellulose inducer corncob (No CC).
- Caramelized glucose, caramelized maltose, caramelized lactose or no caramelized sugar (no feeding) was fed to cultures of T. reesei at 5g/L/day.
- Cellulase production was measured by protein titer (g/L) at days 4, 6, 8 and 11, and represented on the y-axis.
- Figure 2 is a graph showing the oligosaccharide composition of caramelized glucose, maltose, and lactose as determined by mass spectrometry.
- the number of saccharide units (2- 6) is represented on the x-axis.
- Figure 3 is a graph showing the effect of the cellulose inducer corncob (CC) and caramelized sugar on the induction of cellulase production in T. reesei.
- Corncob alone CC only
- glucose that was not caramelized glucose
- caramelized glucose caramel glucose
- CC + glucose corncob and caramelized glucose
- Cellulase production was measured by protein titer (g/L) at days 4, 6, 8 and 11, and represented on the y-axis.
- Figure 4 is a graph showing the effect of the cellulose inducer beeswing (BW) and caramelized sugar on the induction of cellulase production in T. reesei.
- Beeswing only (BW) and the combination of beeswing and caramelized glucose (BW + Base Caramel glu) was fed to T. reesei.
- Cellulase production was measured by protein titer (g/L) at days 4, 6, 8 and 12, and represented on the y-axis.
- an element means one element or more than one element.
- biomass refers to any non-fossilized, organic matter.
- Biomass can be a starchy material and/or a cellulosic, hemicellulosic, or lignocellulosic material.
- the biomass can be an agricultural product, a paper product, forestry product, or any intermediate, byproduct, residue or waste thereof, or a general waste.
- the biomass may be a combination of such materials.
- the biomass is processed, e.g., by a saccharification and/or a fermentation reaction described herein, to produce products, such as sugars, alcohols, organic acids, or biofuels.
- biomass degrading enzyme refers to an enzyme that breaks down components of the biomass matter described herein into intermediates or final products.
- a biomass degrading enzyme includes at least amylases, e.g., alpha, beta or gamma amylases, cellulases, hemicellulases, ligninases, endoglucancases, cellobiases, xylanases, and cellobiohydrolases.
- Biomass degrading enzymes are produced by a wide variety of microorganisms, and can be isolated from the microorganisms, such as T. reesei.
- the biomass degrading enzyme can be endogenously expressed or heterologously expressed.
- biomass degrading activity refers to enzymatic activity that breaks down components of the biomass matter described herein into intermediates or final products.
- Biomass degrading activity includes at least cellulase activity, hemicellulase activity, ligninase activity, endoglucanase activity, cellobiase activity, cellobiohydrolase activity, and xylanase activity.
- caramelized sugar product refers to a small molecule or compound, or a mixture thereof, that is produced from heating (with or without a solvent, such as water present) a sugar molecule, e.g., to at least 110 °C, to cause browning of the sugar.
- Sugar molecules suitable for producing caramelized sugar products include, for example, glucose, xylose, maltose, lactose, fructose, sucrose, sugar blends from saccharified biomass, such as saccharified corn cob, or any combination thereof.
- a caramelized sugar product may comprise oligosaccharides, e.g., oligosaccharides of the sugar molecule starting material, dehydration products of the oligosaccharides, hydration products of the oligosaccharides, disproportionation products of the oligosaccharides, colored aromatic products, or any combination thereof.
- oligosaccharides e.g., oligosaccharides of the sugar molecule starting material, dehydration products of the oligosaccharides, hydration products of the oligosaccharides, disproportionation products of the oligosaccharides, colored aromatic products, or any combination thereof.
- cellobiase refers to an enzyme that catalyzes the hydrolysis of a dimer, trimer, tetramer, pentamer, hexamer, heptamer, octamer, or an oligomer of glucose, or an oligomer of glucose and xylose, to glucose and/or xylose.
- the cellobiase is beta-glucosidase, which catalyzes beta- 1,4 bonds in cellobiose to release two glucose molecules.
- cellobiohydrolase refers to an enzyme that hydrolyzes glycosidic bonds in cellulose.
- the cellobiohydrolase is 1,4-beta-D-glucan cellobiohydrolase, which catalyzes the hydrolysis of 1,4-beta-D-glucosidic linkages, e.g., 1,4- beta-D-glucosidic linkages of the terminal units, in cellulose, cellulooligosaccharides, or any beta- 1,4-linked glucose containing polymer, releasing oligosaccharides from the polymer chain.
- 1,4-beta-D-glucan cellobiohydrolase catalyzes the hydrolysis of 1,4-beta-D-glucosidic linkages, e.g., 1,4- beta-D-glucosidic linkages of the terminal units, in cellulose, cellulooligosaccharides, or any beta- 1,4-linked glucose containing polymer, releasing oligosaccharides from the polymer chain.
- cellulase refers to an enzyme that catalyzes the break down, e.g., hydrolysis, of cellulose and related polysaccharides into shorter polysaccharides, oligosaccharides, or monosaccharides.
- cellulases include endoglucanases, cellobiases, and cellobiohydrolases (or exoglucanases).
- Cellulase activity refers to the activity of a cellulose, e.g., cellulolysis, and can include the hydrolysis of the 1,4-beta-D-glycosidic linkages in cellulose, hemicelluloses, lichenin, and cereal beta-D-glucans into shorter polysaccharides, oligosaccharides, or monosaccharides.
- endoglucanase refers to an enzyme that catalyzes the hydrolysis of internal ⁇ -1,4 glycosidic bonds.
- the endoglucanase is endo- 1 ,4-(l ,3; 1 ,4)-beta-D-glucan 4-glucanohydrolase, which catalyses endohydrolysis of 1,4-beta-D- glycosidic linkages in cellulose, cellulose derivatives (such as carboxymethyl cellulose and hydroxyethyl cellulose), lichenan, beta- 1,4 bonds in mixed beta- 1, 3 glucans such as cereal beta-D-glucans or xyloglucans, and other plant material containing cellulosic components.
- the term "inducer biomass”, as used herein, refers to any non-fossilized, organic matter that is introduced to a microorganism to induce the production of a protein, such as an enzyme, such as a biomass degrading enzyme.
- the inducer biomass can be a starchy material and/or a cellulosic material comprising cellulose.
- the inducer biomass can also be referred to as a cellulose inducer.
- the inducer biomass can comprise the same component(s) as a biomass that is used for production of a sugar product.
- the inducer biomass can be introduced with a caramelized sugar product to induce production of a biomass degrading enzyme.
- ligninase refers to an enzyme that catalyzes the breakdown of lignin, commonly found in the cell walls of plants, such as by an oxidation reaction.
- Ligninases include lignin-modifying enzymes, lignin peroxidases and laccases.
- nucleic acid or “polynucleotide” are used interchangeable, and refer to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double- stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides.
- nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
- polypeptide refers to a compound comprised of amino acid residues covalently linked by peptide bonds.
- a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
- Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
- Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
- a polypeptide includes a natural peptide, a recombinant peptide, or a combination thereof.
- a "plurality of polypeptides” refers to two or more polypeptides, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, 100, 200, or 500 or more polypeptides.
- xylanase refers to enzymes that hydrolyze xylan-containing material.
- Xylan is polysaccharide comprising units of xylose.
- a xylanase can be an endoxylanase, a beta-xylosidase, an arabinofuranosidase, an alpha-glucuronidase, an acetylxylan esterase, a feruloyl esterase, or an alpha-glucuronyl esterase.
- Materials comprising cellulose or hemicellulose e.g., corncob, wheat straw, sawdust, etc.
- Trichoderma reesei T. reesei
- Sugars, such as glucose, xylose and fructose are typically regarded as a soluble carbon source for T. reesei.
- the present invention is based, at least in part, on the surprising discovery that caramelized sugar products produced by heating sugar molecules, e.g., glucose and/or xylose, can induce production of proteins, e.g., enzymes, e.g., amylases or biomass degrading enzymes when introduced to microorganisms, e.g., T. reesei. Furthermore, the yield of proteins, e.g., biomass degrading enzymes produced was higher than that produced from conventional induction methods, e.g., using a cellulose-containing inducer, e.g., corncob.
- proteins e.g., enzymes, e.g., amylases or biomass degrading enzymes
- microorganisms e.g., T. reesei
- the yield of proteins, e.g., biomass degrading enzymes produced was higher than that produced from conventional induction methods, e.g., using a cellulose-containing inducer, e
- compositions comprising a caramelized sugar product for inducing production of proteins, e.g., enzymes, e.g., amylases or biomass degrading enzymes in a microorganism, and methods of use thereof.
- proteins e.g., enzymes, e.g., amylases or biomass degrading enzymes in a microorganism
- a composition comprising a caramelized sugar product is introduced to a microorganism e.g., to induce production of a biomass degrading enzyme.
- Caramelization is a non-enzymatic process commonly used in cooking by which sugar molecules are heated to a sufficient temperature to brown the sugar and produce a caramel.
- the sugar can be a 3, 4, 5, 6, or 7-carbon carbohydrate, e.g., glyceraldehyde, dihidroxyacetone, erythrose, threose, arabinose, ribose, ribulose, xylose, xylulose, lyxose, allose, altrose, fructose, galactose, glucose, gulose, idose, mannose, sorbose, talose, tagatose, sedoheptulose and mannoheptulose or mixtures of any of these.
- carbohydrate e.g., glyceraldehyde, dihidroxyacetone, erythrose, threose, arabinose, ribose, ribulose, xylose, xylulose, lyxose, allose, altrose, fructose, galactose, glucose, gulose, i
- suitable sugar molecules that can be used as the starting material for caramelization include glucose, maltose, lactose, xylose, fructose, and sucrose.
- glucose is caramelized.
- maltose is caramelized.
- lactose is caramelized.
- xylose is caramelized.
- sugars from saccharified biomass e.g., saccharified corn cob, wheat straw and/or a starchy material are caramelized. Any combination of glucose, maltose, lactose, xylose, fructose, and/or sucrose can be caramelized.
- a mixture comprising xylose and glucose is caramelized.
- Sugar molecules are caramelized by heating to a sufficient temperature to brown the sugar.
- the sugar molecules are heated to at least 110 °C, 120 °C, 130 °C, 140 °C, 150 °C, 160 °C, 170 °C, 180 °C, 190 °C, or 200 °C.
- the temperature used can depend on the sugar starting material, as different sugar molecules can be caramelized at different
- sugar molecules can be heated at a caramelization temperature described herein for a duration of time until a desired level of caramelization is achieved.
- the sugar molecules are heated at a caramelization temperature described herein for at least 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 23 hours, 24 hours, 36 hours, or 48 hours.
- sugar molecules can be caramelized by heating to 170 °C for 17 hours. Heating can be performed by heating neat sugars, e.g., solid sugars, or sugars in solution, e.g., in water or another solvent.
- the caramelization process produces a mixture of caramelized sugar products.
- the process includes reactions involving the oxidation of the sugar, the removal of water, and the break down of the sugar and results in hundreds of caramelized sugar products.
- a recent study has attempted to characterize the chemical composition of caramel, e.g., see Golon and
- Caramelized sugar products include one or more of: 1) oligosaccharides comprising the starting sugar molecule; 2) dehydration products of the starting sugar molecule and the oligosaccharides comprising the starting sugar molecule;
- the caramelized sugar product utilized in the methods disclosed herein for inducing production of proteins e.g., biomass degrading enzymes in a host cell can be any of the caramelized sugar products described herein, or a combination thereof. Without wishing to be bound by theory, it is believed that oligosaccharides produced by the caramelization process plays a role in inducing the production of proteins, e.g., biomass degrading enzymes in microorganisms.
- the described oligosaccharides perform two roles. First, it is believed that the oligosaccharides can partially be utilized by the organism, thus growing cell mass. Second, the oligosaccharides may trick the organism into producing enzymes so that the organism can break down the oligosaccharides to release more monosaccharides that will enhance cell growth. Enhanced cell growth gives more protein.
- the caramelized sugar product comprises one or more
- caramelized glucose comprises oligosaccharides comprising 2, 3, 4, 5, or 6 glucose molecules, or a combination thereof, e.g., disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, or hexasaccharides comprising glucose, or a combination thereof.
- caramelized maltose comprises oligosaccharides comprising 2, 3, 4, 5, or 6 maltose molecules, e.g., disaccharides, trisaccharides,
- caramelized xylose comprises oligosaccharides comprising 2, 3, 4, 5, or 6 xylose molecules, e.g., disaccharides, trisaccharides, tetrasaccharides,
- caramelized lactose comprises oligosaccharides comprising 2, 3, 4, 5, or 6 lactose molecules, or a combination thereof, e.g., disaccharides, trisaccharides,
- tetrasaccharides pentasaccharides, or hexasaccharides comprising lactose repeat units, or a combination thereof.
- the caramelized sugar product comprises a mixture of
- oligosaccharides comprising the starting sugar molecules, e.g., more than one, two, three, four, or five species of oligosaccharides.
- each species of oligosaccharides may be present at different ratios compared to the remaining oligosaccharide species.
- the trisaccharides most abundant species of oligosaccharides.
- the disaccharides are the second most abundant species of oligosaccharides.
- the caramelized sugar product comprises disaccharides, trisaccharides, and tetrasaccharides
- tetrasaccharides are the third most abundant species of oligosaccharides.
- the caramelized sugar product comprises one or more dehydration products of the starting sugar molecule and/or the oligosaccharides comprising the starting sugar molecule. Dehydration products can comprise the loss of 1, 2, 3, 4, 5, 6, 7, or 8 water molecules, depending on the number of monosaccharide units.
- Loss of water molecules may occur at the same saccharide moiety or can be distributed over two or more different saccharide moieties, e.g., of an oligosaccharide comprising the starting sugar molecule.
- an oligosaccharide comprising the starting sugar molecule.
- up to 7 dehydration products can be obtained by caramelization as a result of a loss of a single water molecule.
- the caramelized sugar product comprises one or more hydration products of the oligosaccharides comprising the starting sugar molecule.
- Hydration products can comprise one or two additional water molecules added to an oligosaccharide comprising the starting sugar molecule.
- the caramelized sugar product comprises one or more fragmentation products, or redox disproportionation products, of the oligosaccharides comprising the starting sugar molecule.
- the oligosaccharides comprising the starting sugar molecule may be oxidized and/or reduced.
- an oligosaccharide comprising the starting sugar molecule is simultaneously reduced and oxidized.
- the caramelized sugar product comprises one or more aromatic products.
- Aromatic products include aromatic dye molecules that confer the brown color of caramel. Analysis of caramelized glucose and fructose indicated that the aromatic dye molecules may differ between different starting sugar molecules (Golon et al., 2012).
- Aromatic products can also include the aromatic flavor molecules that confer the flavor of caramel, e.g., the "butterscotch” flavor. Examples of aromatic flavor molecules include diacetyl furans, e.g., hydroxymethylfurfural (HMF) and hydroxyacetylfuran (HAF), furanones, e.g.,
- HDF hydroxydimethylfuranone
- DDF dihydroxydimethylfuranone
- maltol from disaccharides and hydroxymaltol from monosaccharides.
- the chemical composition of a caramelized sugar can be determined by mass spectrometry.
- a caramelized sugar can be prepared by heating a starting sugar molecule, e.g., glucose, at 170 °C for 17 hours or 180 0 for 2 hours. The caramelized sugar is then dissolved in water or a mixture of methanol/water (1: 1, v/v, 1 ml), and analyzed by mass spectrometry.
- mass spectrometry techniques that can be used to analyze the caramelized sugar samples include MALDI-TOF, micrOTOF and direct infusion ion trap mass spectrometry (ESI-TOF-MS), liquid chromatography - mass spectrometry (LC-MS or HPLC- MS), or liquid chromatography - time of flight mass spectrometry (LC-TOF or HPLC-TOF).
- composition comprising a caramelized sugar product for inducing production of a protein e.g., a biomass degrading enzyme in a host cell or microorganism
- a protein e.g., a biomass degrading enzyme
- a host cell or microorganism can further comprise one or more agents known in the art that can induce production of a protein, e.g., a biomass degrading enzyme.
- Such agents include, but are not limited to, cellobiose ( ⁇ -D- glucopyranosyl-(l ⁇ 4)- -D-glucopyranose), ⁇ -cellobiono-l, 5-lactone ( ⁇ -D-glucopyranosyl- (l ⁇ 4)-D-glucono-l,5-lactone), lactose ( ⁇ -D-galactopyranosyl -(l ⁇ 4)-D-glucose), sophorose (2-0-P-D-glucopyranosyl-oc-D-glucose), D-xylose, xylobiose, galactose, 1-arabitol and 1- sorbose (Shmoll and Kubicek, 2003, Acta Microbiol Immunol Hung.
- cellobiose ⁇ -D- glucopyranosyl-(l ⁇ 4)- -D-glucopyranose
- ⁇ -cellobiono-l 5-lactone ( ⁇
- compositions comprising a caramelized sugar product for inducing production of a protein, e.g., an enzyme, e.g., an amylase or biomass degrading enzyme for use in any of the methods described herein.
- the composition can further comprise an inducer biomass described herein, and/or additional agents known in the art that induce production of a protein, e.g., an enzyme, e.g., an amylase or biomass degrading enzyme.
- the composition comprising a caramelized sugar product for inducing production of proteins may further comprise an inducer biomass described herein.
- the inducer biomass material may be the same material that can be processed to generate various products, such as hydrogen, sugars, and alcohols.
- An inducer biomass can be a starchy material comprising cellulose, and is also referred to herein as a cellulose inducer. Suitable examples of inducer biomass are described further herein.
- the inducer biomass may be pretreated to reduce recalcitrance by any of the treatment methods described herein, e.g., exposure to an electron beam, bombardment with electrons, sonication, oxidation, pyrolysis, steam explosion, chemical treatment, mechanical treatment, and/or freeze grinding.
- compositions comprising a caramelized sugar product to induce production of a protein, e.g., an enzyme, e.g., an amylase or biomass degrading enzyme can result in an increase in the amount of protein, e.g., enzyme, e.g., amylase or biomass degrading enzyme produced.
- the increase in the amount of biomass degrading enzyme produced by contacting a host cell or microorganism with a composition comprising a caramelized sugar product is at least 1 fold, 1.1 fold, 1.2 fold, 1.3 fold, 1.4 fold, 1.5 fold, 1.6 fold, 1.
- the amount of biomass degrading enzyme produced by contacting a host cell or microorganism with a composition comprising a caramelized sugar product is at least 1%, 2%, 5%, 10%, 25%, 50%, 75%, 100%, 200%, 300%, 400%, or 500% more than the amount of biomass degrading enzyme produced without use of a composition comprising the caramelized sugar product or compared to the amount of biomass degrading enzyme produced by using an inducer biomass.
- compositions comprising a caramelized sugar product and an inducer biomass can result in an increase in the amount of protein, e.g., enzyme, e.g., amylase or biomass degrading enzyme produced.
- the increase in the amount of biomass degrading enzyme produced by contacting a host cell or microorganism with a composition comprising a caramelized sugar product and an inducer biomass is at least 1 fold, 1.1 fold, 1.2 fold, 1.3 fold, 1.4 fold, 1.5 fold, 1.6 fold, 1.
- the amount of biomass degrading enzyme produced by contacting a host cell or microorganism with a composition comprising a caramelized sugar product and an inducer biomass is at least 1%, 2%, 5%, 10%, 25%, 50%, 75%, 100%, 200%, 300%, 400%, or 500% more than the amount of biomass degrading enzyme produced by using an inducer biomass alone or a caramelized sugar product alone.
- the combination of a caramelized sugar product and an inducer biomass results in a synergistic increase in the amount of protein, e.g., enzyme, e.g., amylase or biomass degrading enzyme produced.
- protein e.g., enzyme, e.g., amylase or biomass degrading enzyme produced.
- the observed effect from using a combination of two or more induction compositions is greater than the sum of the effect from using each individual induction composition separately.
- a composition comprising a caramelized sugar product and an inducer biomass described herein can induce a synergistic effect in the biomass degrading enzyme production of a microorganism, and results in a yield of biomass degrading enzyme that is greater than the sum of the yields produced from inducing the microorganism with caramelized sugar product alone and the inducer biomass alone.
- the amount of biomass degrading enzyme produced by contacting a host cell or microorganism with a composition comprising a caramelized sugar product and an inducer biomass is at least 1%, 2%, 5%, 10%, 25%, 50%, 75%, 100%, 200%, 300%, 400%, or 500% more than the sum of the amount of biomass degrading enzyme produced by using a caramelized sugar product alone and an inducer biomass alone.
- the amount or titer of a protein, e.g., enzyme, e.g., amylase or biomass degrading enzyme produced by a microorganism can be determined using assays described in the examples described herein.
- the amount of biomass degrading enzyme produced can be determined by using a Bradford assay and/or a nanodrop apparatus.
- the molar extinction coefficient can be estimated by inserting the amino acid sequence of the biomass degrading enzyme into the ExPASy ProtParam online tool.
- Activity assays known in the art can also be performed to determine the activity of the biomass degrading enzyme produced.
- compositions and methods for inducing the production of a protein e.g., enzyme, e.g., amylase or biomass degrading enzyme.
- a composition comprising a caramelized sugar product described herein can be introduced to a microorganism or host cell under sufficient conditions for production of the biomass degrading enzyme.
- producing or production of a biomass degrading enzyme by a microorganism includes the expression, translation, and/or secretion of the biomass degrading enzyme.
- the microorganism, or host cell, suitable for use in the present disclosure is capable of producing a protein, e.g., an enzyme, e.g., an amylase or a biomass degrading enzyme described herein.
- the microorganism naturally produces a biomass degrading enzyme, e.g., expresses an endogenous biomass degrading enzyme.
- the microorganism is genetically modified to produce a biomass degrading enzyme, e.g., to express a heterologous biomass degrading enzyme.
- a nucleic acid encoding a heterologous biomass degrading enzyme is introduced to the microorganism using standard methods known in the art, e.g., by electroporation, transfection, or transduction.
- the heterologous biomass degrading enzyme may be a biomass degrading enzyme that is naturally produced in a different microorganism, or may be a modified biomass degrading enzyme comprising a different amino acid sequence or different function and/or activity, e.g., increased or decreased activity, from that of the corresponding naturally occurring biomass degrading enzyme.
- the microorganism can be a fungus, a bacterium, a protozoan, a yeast, a synthetic organism or a semi- synthetic organism that produces one or more proteins, e.g., one or more enzymes, such as one or more amylases or biomass degrading enzymes.
- the microorganism is from a species in the genera selected from Bacillus, Coprinus,
- Myceliophthora Cephalosporium, Scytalidium, Penicillium, Aspergillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, Chrysosporium or Trichoderma.
- the microorganism is selected from Aspergillus, Humicola insolens ( Scytalidium thermophilum ), Coprinus cinereus, Fusarium oxysporum, Myceliophthora thermophila, Meripilus giganteus, Thielavia terrestris, Acremonium persicinum, Acremonium acremonium, Acremonium brachypenium, Acremonium dichromosporum, Acremonium obclavatum, Acremonium pinkertoniae, Acremonium roseogriseum, Acremonium incoloratum, Acremonium furatum, Chrysosporium lucknowense, Trichoderma viride, Trichoderma reesei, or Trichoderma koningii.
- the microorganism is a fungus, e.g., a filamentous fungus.
- the microorganism is Trichoderma reesei or any industrial strain or variant thereof.
- the microorganism can be T. reesei QM6a, T. reesei RL-P37, T. reesei MCG-80, T reesei RUTC30, T reesei RUT-NG14, T. reesei PC3-7, or T. reesei QM9414.
- compositions and methods for inducing production of a protein e.g., an enzyme, e.g., an amylase or biomass degrading enzyme in a microorganism.
- the biomass degrading enzyme can be naturally expressed by the microorganism.
- the biomass degrading enzyme can be a cellulase (e.g., a cellobiase, a cellobiohydrolase, or an
- endoglucanase a hemicellulase (e.g., a xylanase), or a ligninase, or any combination thereof.
- hemicellulase e.g., a xylanase
- ligninase e.g., a ligninase
- the biomass degrading enzyme is a cellulase.
- Cellulase collectively refers to enzymes that catalyze cellulolysis, or the decomposition of cellulose and related polysaccharides into monosaccharides, e.g., glucose or beta-glucose, or shorter polysaccharides and oligosaccharides.
- Cellulases are commonly produced by fungi, bacteria, and other protozoans. Examples of cellulases include cellobiases, cellobiohydrolases (exoglucanases), and endoglucanases.
- the biomass degrading enzyme is a cellobiase.
- a cellobiase is an enzyme that hydrolyzes beta- 1,4 bonds in its substrate, e.g., cellobiose, to release two glucose molecules.
- Cellobiose is a water soluble 1,4-linked dimer of glucose.
- the biomass degrading enzyme is Cel3a.
- Cel3a also known as Bgll is a cellobiase that was identified in Trichoderma reesei.
- the biomass degrading enzyme is a cellobiohydrolase, also known as exoglucanase or avicelase.
- a cellobiohydrolase catalyzes the hydrolysis of 1-4-beta-D- glucosidic linkages in oligosaccharides containing that linkage, e.g., cellulose and cellotetraose, thereby releasing cellobiose from the non-reducing ends of the chains. Examples of
- cellobiohydrolases include cellobiohydrolase I (CBHI) and cellobiohydrolase II (CBHII) from Trichoderma reesei.
- the biomass degrading enzyme is an endoglucanase.
- endoglucanase is an enzyme that catalyzes the hydrolysis of cellulose. Specifically, the endoglucanases cleave the internal bonds of the cellulose chain. Endoglucanases are produced by fungi, bacteria, and protozoans. Endoglucanases are also known as beta-1-4 endoglucanase, 4-beta-D-glucan cellobiohydrolase, exo-cellobiohydrolase, beta-l,4-glucan cellobiohydrolase, beta-l,4-glucan cellobiosylhydrolase, 1,4-beta-glucan cellobiosidase, CI cellulase,
- cellobiohydrolase I cellobiohydrolase, exo-beta-l,4-glucan cellobiohydrolase, 1, 4-beta-D- glucan cellobiohydrolase, or cellobiosidase.
- endoglucanases include Cel5A, Cel5B, Cel7B, Cell 2 A, Cel45A, Cel61A, Cel61B, and Cel74A from Trichoderma reesei.
- the biomass degrading enzyme is a hemicellulase.
- a hemicellulase collectively refers to enzymes that hydrolyze hemicelluloses, e.g., various components of cell walls in plants with the exception of cellulose, e.g., xylans, glucans, galactans, mannans, and pentosans.
- Hemicellulases include xylanases and galactanases.
- the biomass degrading enzyme is a xylanase.
- Xylanases are also known as endo-(l-4)-beta-xylan 4-xylanohydrolase, endo-l,4-xylanase, endo-l,4-beta- xylanase, beta-l,4-xylanase, endo-l,4-beta-D-xylanase, 1,4-beta-xylan xylanohydrolase, beta- xylanase, beta-l,4-xylan xylanohydrolase, beta-D-xylanase.
- a xylanase breaks down a component of plant cell walls called hemicellulose, e.g., degrades polysaccharides, such as xylan, e.g., beta-l,4-xylan, glucuronoxylan, arabinoxylan, glucomannan, and xyloglucan, to release xylose.
- xylanases include Xynl, Xyn2, and Xyn3 from Trichoderma reesei; and TERTU_1599, TERTU_3603, TERTU_2546, and TERTU_4506 from Trichoderma reesei; and TERTU_1599, TERTU_3603, TERTU_2546, and TERTU_4506 from
- the biomass degrading enzyme is a ligninase.
- a ligninase is an enzyme that breaks down lignin, which is a complex polymer of aromatic alcohols known as monolignols and plays an integral part of the secondary cell walls of plants and some algae.
- Ligninases include lignin peroxidases, l,2-bis(3,4-dimethoxyphenyl)propane-l,3- diokhydrogen-peroxide oxidoreductase, diarylpropane oxygenase, ligninase I, diarylpropane peroxidase, LiP, hydrogen-peroxide oxidoreductase (C-C-bond-cleaving), and some laccases.
- ligninases examples include CIP2 from Trichoderma reesei; LPOA, GLG2, GLG4, LIPA, GLG5, GLG3, GLG6, and LIPB from Phanerochaete chrysosporium; ligninase-3 from Phelbia radiate; Ligninase A and B from Coriolus versicolor; and LPG I and LPGIV Coriolus versicolor.
- the methods described herein are used to induce production of one or more cellulases or hemicellulases, e.g., one or more of a cellobiase, a cellobiohydrolase, an endoglucanase, a xylanase, and/or a ligninase.
- the methods described herein are used to induce production of a mixture of biomass degrading enzymes comprising any combination of one or more of a cellobiase, a cellobiohydrolase, an endoglucanase, a xylanase, and/or a ligninase.
- the mixture of biomass degrading enzymes comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 15, or at least 20 biomass degrading enzymes, e.g., biomass degrading enzymes described herein.
- the biomass degrading enzyme produced by the methods described herein is Cel3a, e.g., a Cel3a from T. reesei.
- the mixture of biomass degrading enzymes comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 of the biomass degrading enzymes listed in Table 1.
- amino acid sequences for the biomass degrading enzymes listed in Table 1 are provided below.
- MVRRTALLALGALSTLSMAQI SDDFESGWDQTKWP I SAPDCNQGGTVSLDTTVAHSGSNSMKV VGGPNGYCGHIFFGTTQVPTGDVYVRAWIRLQTALGSNHVTFI IMPDTAQGGKHLRIGGQSQV LDYNRESDDATLPDLSPNGIASTVTLPTGAFQCFEYHLGTDGTIETWLNGSLIPGMTVGPGVD NPNDAGWTRASYIPEITGVNFGWEAYSGDVNTVWFDDI S IASTRVGCGPGSPGGPGSSTTGRS STSGPTSTSRPSTTIPPPTSRTTTATGPTQTHYGQCGGIGYSGPTVCASGTTCQVLNPYYSQC
- MLPKDFQWGFATAAYQIEGAVDQDGRGPS IWDTFCAQPGKIADGSSGVTACDSYNRTAEDIAL LKSLGAKSYRFS I SWSRI IPEGGRGDAVNQAGIDHYVKFVDDLLDAGITPFITLFHWDLPEGL HQRYGGLLNRTEFPLDFENYARVMFRALPKVRNWITFNEPLCSAIPGYGSGTFAPGRQSTSEP WTVGHNILVAHGRAVKAYRDDFKPASGDGQIGIVLNGDFTYPWDAADPADKEAAERRLEFFTA WFADP IYLGDYPASMRKQLGDRLPTFTPEERALVHGSNDFYGMNHYTSNYIRHRSSPASADDT VGNVDVLFTNKQGNCIGPETQSPWLRPCAAGFRDFLVWI SKRYGYPP IYVTENGTS IKGESDL PKEKILEDDFRVKYYNEYIRAMVTAVELDGVNVKGYFAWSLMDNFEWADGYVTRFGVTYVDYE
- Cel5a Trichoderma reesei MNKSVAPLLLAAS ILYGGAAAQQTVWGQCGGIGWSGPTNCAPGSACSTLNPYYAQCIPGATTI TTSTRPPSGPTTTTRATSTSSSTPPTSSGVRFAGVNIAGFDFGCTTDGTCVTSKVYPPLKNFT GSNNYPDGIGQMQHFVNDDGMTIFRLPVGWQYLVNNNLGGNLDSTS I SKYDQLVQGCLSLGAY CIVDIHNYARWNGGI IGQGGPTNAQFTSLWSQLASKYASQSRVWFGIMNEPHDVNINTWAATV QEVVTAIRNAGATSQFI SLPGNDWQSAGAFI SDGSAAALSQVTNPDGSTTNLIFDVHKYLDSD NSGTHAECTTNNIDGAFSPLATWLRQNNRQAILTETGGGNVQSCIQDMCQQIQYLNQNSDVYL GYVGWGAGSFDSTYVLTETPTGSGNSWTDTSLVSSCLARK (S
- the biomass degrading enzyme comprises an amino acid sequence with at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to a biomass degrading enzyme described herein, e.g., listed in Table 1, or a functional fragment thereof, e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to a biomass degrading enzyme described herein, e.g., listed in Table 1, or a functional fragment thereof.
- Percent identity in the context of two or more amino acid or nucleic acid sequences refers to two or more sequences that are the same. Two sequences are "substantially identical" if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (e.g., 60% identity, optionally 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
- the identity exists over a region that is at least about 50 nucleotides, 100 nucleotides, 150 nucleotides, in length. More preferably, the identity exists over a region that is at least about 200 or more amino acids, or at least about 500 or 1000 or more nucleotides, in length.
- sequence comparison For sequence comparison, one sequence typically acts as a reference sequence, to which one or more test sequences are compared.
- test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
- sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, (1970) Adv. Appl. Math.
- BLAST and BLAST 2.0 algorithms Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., (1977) Nuc. Acids Res. 25:3389-3402; and Altschul et al., (1990) J. Mol. Biol. 215:403-410, respectively.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
- Functional variants may comprise one or more mutations, such that the variant retains some level of activity, e.g., biomass degrading activity, of an enzyme, e.g., a biomass degrading enzyme described herein produced by the microorganism from which the enzyme originates from.
- the functional variant has at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, or at least 99%) of the biomass degrading activity as the corresponding naturally occurring biomass degrading enzyme.
- the functional variant has at least 200%, at least 300%, at least 400%, at least 500%, at least 1000% or more of the biomass degrading activity as the corresponding naturally occurring biomass degrading enzyme.
- Biomass degrading activity can be tested using the functional assays known in the art. For example, if the biomass degrading enzyme is a cellulase, then functional assays that measure cellulase activity can be performed.
- the mutations present in a functional variant include amino acid substitutions, additions, and deletions. Mutations can be introduced by standard techniques known in the art, such as site-directed mutagenesis and PCR- mediated mutagenesis. Mutagenesis can also be achieved through using CRISPR (Clustered regularly-interspaced short palindromic
- the CRISPR/Cas system is naturally found in bacteria and archaea, and has been modified for use in gene editing (silencing, enhancing or mutating specific genes) in eukaryotes such as mice or primates. Wiedenheft et al. (2012) Nature 482: 331-8. This is accomplished by introducing into the cell a plasmid containing a specifically designed CRISPR and one or more appropriate Cas.
- the mutation may be a conservative amino acid substitution, in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- one or more amino acid residues within the biomass degrading enzyme can be replaced with other amino acids from the same side chain family, and the resultant biomass degrading activity comparable (e.g., at least 80%, 85%, 90%, 95%, or 99% of the biomass degrading activity) to that of the wild-type biomass degrading enzyme.
- the mutation may be an amino acid substitution in which an amino acid residue is replaced with an amino acid residue having a different side chain.
- Such mutations may alter or affect various enzymatic characteristics of the biomass degrading enzyme, e.g., cellobiase, ligninase, endoglucanase, or cellobiohydrolase.
- such mutations may alter or affect the activity, e.g., the biomass degrading activity, thermostability, optimal pH for reaction, enzyme kinetics, or substrate recognition of the enzyme, e.g., the biomass degrading enzyme.
- a mutation increases the biomass degrading activity of the variant in comparison to the biomass degrading enzyme, e.g., a cellulase produced by T. reesei.
- a mutation increases or decreases the thermostability of the variant in comparison to a wild-type biomass degrading enzyme, e.g., a cellulase produced by T. reesei.
- a mutation changes the pH range at which the variant optimally performs the biomass degrading reaction in comparison to wild- type biomass degrading enzyme, e.g., a cellulase produced by T. reesei.
- a mutation increases or decreases the kinetics of the biomass degrading reaction (e.g., k cat , K M, kcat/KM, or KD) in comparison to wild-type biomass degrading enzyme, e.g., a cellulase produced by T. reesei.
- a mutation increases or decreases the ability of the cellobiase to recognize or bind to the substrate in comparison to wild-type biomass degrading enzyme, e.g., a cellulase produced by T. reesei.
- the microorganism that can produce a protein e.g., enzyme, e.g., amylase or biomass degrading enzyme can be in a cell culture.
- a cell culture comprises one or more cells in a cell culture medium.
- the cell culture medium can be an aqueous cell culture medium comprising components that support cell maintenance, cell viability, cell growth, and/or cell proliferation.
- Cell culture media can typically comprises physiological salts, e.g., ammonium salt, phosphate salt, potassium salt, magnesium salt, calcium salt, iron salt, manganese salt, zinc salt, or cobalt salt; amino acids; water, and optionally, a carbon source.
- a cell culture media suitable for growing a microorganism described herein comprises an ammonium salt, e.g., ammonium sulfate and/or ammonium hydroxide; a potassium salt, e.g., potassium hydroxide; a calcium salt, e.g., calcium chloride; a magnesium salt, e.g., magnesium sulfate; a manganese salt, e.g., manganese sulfate; an iron salt, e.g., iron sulfate; a zinc salt, e.g., zinc sulfate, a cobalt salt, e.g., cobalt chloride, phthalic acid; lactose; antibiotics, e.g.,
- An exemplary growth media is
- the microorganism or cell culture is contacted with, e.g., fed, a carbon source, such as a sugar, to support the growth or proliferation of the microorganism.
- a carbon source such as a sugar
- the microorganism or cell culture is contacted with, e.g., fed, glucose.
- the cell culture can be transferred from one container, e.g., a cell culture container, to a larger container to allow and encourage the microorganism to continue to proliferate.
- the microorganism is contacted with sugar in a first container under suitable conditions, as described herein, such that the microorganism proliferates.
- the proliferation can be monitored, and once a desired level of growth, e.g., a specific growth phase, or a desired level of proliferation, e.g., as measured by turbidity of the culture or by cell number, the microorganism can be transferred to a second container, where the second container is larger, e.g., by volume, than the first container.
- Transferring the microorganism to the larger second container allows and encourages the microorganism to continue to proliferate.
- the microorganism is transferred once, e.g., from a first container to a larger second container.
- the microorganism is transferred once, e.g., from a first container to a larger second container.
- microorganism is transferred more than once, e.g., two, three, four, five, six, seven, eight, nine, or ten times, wherein for each transfer, the microorganism is transferred into a container that is larger than the container from which the microorganism was transferred from.
- Containers suitable for transferring and culturing the microorganisms described herein include any cell culture container known in the art. Examples of suitable containers include, but are not limited to, a cell culture flask, a roller bottle, a bioreactor, or a tank.
- Cell culture conditions for consideration include pH, temperature, oxygen levels, and movement.
- the pH of the cell culture e.g., the media, is generally at physiological pH, e.g., between pH 4-8, or between pH 5-7, e.g., at pH 5, pH 6, or pH 7.
- the temperature for growth of a microorganism producing a biomass degrading enzyme is generally between 20 and 40°C, e.g., 30°C.
- a particular strain of the microorganism may show enhanced proliferation of enzyme production at an elevated temperature, e.g., 32 or 37 °C, or at a lower temperature, e.g., 27 °C.
- Optimal oxygen levels for growth of a microorganism producing a biomass degrading enzyme is generally between 15 and 30%, e.g., 20%.
- the cell culture may be stationary or may use movement to promote maintenance or proliferation. For example, the cell culture may be rolled, shaken, or agitated to enhance cell proliferation.
- the cell culture conditions disclosed herein are merely exemplary, and should not be construed as limiting. Varying cell culture conditions from those explicitly listed herein may be envisioned or experimentally determined, and may depend on the species or strain of microorganism used. Cell culture conditions sufficient for proliferation of the microorganism that can produce a biomass degrading enzyme result in an increase in the cell number of a culture of the microorganism. Cell culture conditions sufficient for the production of a biomass degrading enzyme results in one or more cells of the microorganism producing a biomass degrading enzyme.
- the cell culture can be induced to produce a protein, e.g., an enzyme, e.g., an amylase or biomass degrading enzyme described herein.
- a composition described herein comprising a caramelized sugar product is added e.g., fed, to the microorganism or cell culture that is capable of producing a biomass degrading enzyme, thereby inducing the microorganism to produce the biomass degrading enzyme.
- the composition comprising a caramelized sugar product is added to the culture directly.
- the composition comprising a caramelized sugar product is added to an enzyme production culture media, comprising components that support and encourage the production of the protein, e.g., biomass degrading enzyme.
- the microorganism is then transferred or cultured in the enzyme production culture media.
- An enzyme production culture media can comprise physiological salts, e.g., ammonium salts, and a composition comprising a caramelized sugar product and/or an inducer biomass, and is adjusted to pH 4-7, e.g., pH 6.
- an enzyme production culture media comprises ammonium sulfate, rice bran, and a composition comprising a caramelized sugar product and/or an inducer biomass, e.g., corncob or beeswing, and is adjusted to pH 6, e.g., with 6M ammonium hydroxide.
- Production of a protein e.g., an enzyme, e.g., an amylase or biomass degrading enzyme can be induced by contacting the microorganism with a combination of a caramelized sugar product and an inducer biomass described herein.
- the inducer biomass can be a starchy material comprising cellulose.
- the biomass may also comprise hemicellulose and/or lignin.
- the inducer biomass can comprise one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof.
- An agricultural product or waste comprises material that can be cultivated, harvested, or processed for use or consumption, e.g., by humans or animals, or any intermediate, byproduct, or waste that is generated from the cultivation, harvest, or processing methods.
- Agricultural products or waste include, but are not limited to, sugar cane, jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, corn cobs, corn stover, corn fiber, coconut hair, beet pulp, bagasse, soybean stover, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, or beeswing, or a combination thereof.
- a paper product or waste comprises material that is used to make a paper product, any paper product, or any intermediate, byproduct or waste that is generated from making or breaking down the paper product.
- Paper products or waste include, but are not limited to, paper, pigmented papers, loaded papers, coated papers, corrugated paper, filled papers, magazines, printed matter, printer paper, polycoated paper, cardstock, cardboard, paperboard, or paper pulp, or a combination thereof.
- a forestry product or waste comprises material that is produced by cultivating, harvesting, or processing of wood, or any intermediate, byproduct, or waste that is generated from the cultivation, harvest, or processing of the wood.
- Forestry products or waste include, but are not limited to, aspen wood, wood from any genus or species of tree, particle board, wood chips, or sawdust, or a combination thereof.
- a general waste includes, but is not limited to, manure, sewage, or offal, or a combination thereof.
- a caramelized sugar product and an inducer biomass are added to the microorganism or cell culture simultaneously.
- the caramelized sugar product and the inducer biomass can be present in the same composition or can be in separate compositions.
- the caramelized sugar product and inducer biomass can be components of an enzyme production culture media.
- a caramelized sugar product and an inducer biomass are in separate compositions, and are added to the microorganism or cell culture sequentially.
- a caramelized sugar product can be added to the microorganism or cell culture prior to or after an inducer biomass is added to the microorganism or cell culture.
- the duration between the addition of the caramelized sugar product and the addition of an inducer biomass can be hours, e.g., 1, 2, 3, 4, 5, 6, 12, 18, or more hours, or days, e.g., 1, 2, 3, 4, 5, 6, 7 or more days.
- a caramelized sugar product can be introduced to the microorganism, e.g., by direct addition to the culture or by enzyme production culture media, twice a day, once a day, every other day, every three days or once a week.
- the caramelized sugar product can be added at a concentration range of 1-20 g/L, 1-15 g/L, 1-10 g/L, 1-5 g/L, 2-15 g/L, 2-10g/L, 2-5 g/L, 5-20 g/L, 5-15 g/L, 5-10 g/L, 4-5 g/L, 10-20 g/L or 10-15 g/L of microorganism cell culture.
- the caramelized sugar product can be added at a concentration of 0.5 g/L, 1 g/L, 2 g/L, 3 g/L, 4 g/L, 5 g/L, 6 g/L, 7 g/L, 8 g/L, 9 g/L, 10 g/L, 15 g/L or 20 g/L or more, of microorganism cell culture.
- the caramelized sugar product is added to the microorganism at 4 g/L once per day, or 5 g/L once per day.
- An inducer biomass can be introduced to the microorganism, e.g., by direct addition to the culture or by enzyme production culture media, twice a day, once a day, every other day, every 3 days, or once a week.
- the inducer biomass can be added at a concentration range of 1- 20 g/L, 1-15 g/L, 1-10 g/L, 1-5 g/L, 2-15 g/L, 2-10g/L, 2-5 g/L, 5-20 g/L, 5-15 g/L, 5-10 g/L, 10-20 g/L, or 10-15 g/L of microorganism cell culture.
- the inducer biomass can be added at a concentration of 0.5 g/L, 1 g/L, 2 g/L, 3 g/L, 4 g/L, 5 g/L, 6 g/L, 7 g/L, 8 g/L, 9 g/L, 10 g/L, 15 g/L or 20 g/L or more, of microorganism cell culture.
- the inducer biomass is added to the microorganism at 5 g/L, once per day.
- the concentration of a caramelized sugar product or an inducer biomass used for inducing production of a protein e.g., an enzyme, e.g., an amylase or biomass degrading enzyme is greater than or equal to 0.1% weight by volume (w/v), 0.5% w/v, 1% w/v, 2% w/v, or 5% w/v, and less than or equal to 25% w/v, 20% w/v, 15% w/v, and 10% w/v.
- the microorganism can be induced to produce a protein, e.g., an enzyme, e.g., an amylase or biomass degrading enzyme for one or more days, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, or 30 or more days.
- the duration of the induction can depend on the size, e.g., volume or cell number, of the microorganism culture, the microorganism used, or the amount of the protein, e.g., enzyme, e.g., amylase or biomass degrading enzyme needed.
- the microorganism is induced to produce a biomass degrading enzyme for 11 or 12 days.
- Production of the protein e.g., enzyme, e.g., amylase or biomass degrading enzyme can be measured from the cell culture by measuring the level of proteins, e.g. biomass degrading enzymes, present in the cell culture that were produced by the cells.
- the aqueous portion of the culture can be isolated, e.g., by centrifuging the cell culture or an aliquot or sample of the cell culture.
- a protein assay known in the art, such as the Bradford assay or nanodrop protein quantification can be used to determine the level or titer of protein, e.g., g/L, in the aqueous portion of the culture.
- the protein titer indicates the amount of biomass degrading enzyme produced by the microorganism or cell culture.
- a control sample can be used to normalize for the amount of proteins present in a cell culture that has not been induced to produce a biomass degrading enzyme.
- the proteins, e.g., enzymes, e.g., amylases or biomass degrading enzymes produced by the microorganism as described herein can be used in biological or industrial processes, such as processing biomass materials described herein into products, e.g., sugar products or biofuels. Methods for process biomass materials into products, e.g., degrading or converting biomass materials into sugars or biofuels, are described further herein.
- the microorganism, or culture thereof, that has been induced to produce a protein, e.g., a biomass degrading enzyme, as described herein, can be added directly to the biomass to be processed. Alternatively, the biomass to be processed can be added directly to the microorganism or culture that has been induced to produce a biomass degrading enzyme.
- a protein, e.g., an enzyme, e.g., an amylase or biomass degrading enzyme produced by the microorganism as described herein can also be separated or purified prior use in biomass processing.
- the protein, e.g., biomass degrading enzyme can be separated from one or more of the following components: the microorganism, e.g., the cells of the microorganism; the caramelized sugar product used to induce enzyme production, e.g., the caramelized sugar product that is remaining after enzyme induction; the inducer biomass used to induce enzyme production, e.g., the inducer biomass that is remaining after enzyme induction; components of the cell culture media, e.g., glucose, physiological salts; and one or more proteins present in the culture that do not have biomass degrading activity.
- the microorganism e.g., the cells of the microorganism
- the caramelized sugar product used to induce enzyme production e.g., the caramelized sugar product that is remaining after enzyme induction
- the protein e.g., biomass degrading enzyme can be purified, such that the biomass degrading enzyme is substantially free of other proteins that do not have biomass degrading activity, cell debris, nucleic acids, e.g., from the microorganism, caramelized sugar product, and/or inducer biomass.
- Methods for separation or purification of an enzyme are known in the art, and can include centrifugation, filtration, protein fractionation, size exclusion chromatography, affinity chromatography, or any combination thereof.
- the present invention provides methods and compositions for converting or processing a biomass into a product using a protein, e.g., an enzyme, e.g., an amylase or biomass degrading enzyme, wherein the protein, e.g., enzyme, e.g., amylase or biomass degrading enzyme is produced by contacting a microorganism with a composition comprising a caramelized sugar product, as described herein.
- a protein e.g., an enzyme, e.g., an amylase or biomass degrading enzyme
- a biomass is optimally pretreated, e.g., to reduce the recalcitrance, and saccharified by a saccharification process that involves incubating the treated biomass with biomass degrading or cellulolytic, enzymes to produce sugar products (e.g., glucose and/or xylose).
- sugar products e.g., glucose and/or xylose
- the sugar products can then be further processed, e.g., by fermentation or distillation, to produce other products.
- Such products include alcohols (e.g., ethanol, isobutanol, or n-butanol), sugar alcohols (e.g., erythritol, xylitol, or sorbitol), or organic acids (e.g., lactic acid, pyruvic acid, succinic acid).
- alcohols e.g., ethanol, isobutanol, or n-butanol
- sugar alcohols e.g., erythritol, xylitol, or sorbitol
- organic acids e.g., lactic acid, pyruvic acid, succinic acid
- the biomass material can be converted to one or more products, such as energy, fuels, foods and materials.
- products include, but are not limited to, hydrogen, sugars (e.g., glucose, xylose, arabinose, mannose, galactose, fructose, cellobiose, disaccharides, oligosaccharides and polysaccharides), alcohols (e.g., monohydric alcohols or dihydric alcohols, such as ethanol, n-propanol, isobutanol, sec- butanol, tert-butanol or n-butanol), hydrated or hydrous alcohols (e.g., containing greater than 10%, 20%, 30% or even greater than 40% water), biodiesel, organic acids (e.g., lactic acid), hydrocarbons (e.g., methane, ethane, propane, isobutene, pentane, n-hexane, biodiese
- sugars e.g
- carboxylic acids examples include carboxylic acids, salts of a carboxylic acid, a mixture of carboxylic acids and salts of carboxylic acids and esters of carboxylic acids (e.g., methyl, ethyl and n-propyl esters), ketones (e.g., acetone), aldehydes (e.g., acetaldehyde), alpha and beta unsaturated acids (e.g., acrylic acid) and olefins (e.g., ethylene).
- carboxylic acids salts of a carboxylic acid
- a mixture of carboxylic acids and salts of carboxylic acids and esters of carboxylic acids e.g., methyl, ethyl and n-propyl esters
- ketones e.g., acetone
- aldehydes e.g., acetaldehyde
- alpha and beta unsaturated acids e.g., acrylic acid
- alcohols and alcohol derivatives include propanol, propylene glycol, 1,4- butanediol, 1,3 -propanediol, sugar alcohols and polyols (e.g., glycol, glycerol, erythritol, threitol, arabitol, xylitol, ribitol, mannitol, sorbitol, galactitol, iditol, inositol, volemitol, isomalt, maltitol, lactitol, maltotriitol, maltotetraitol, and polyglycitol and other polyols), and methyl or ethyl esters of any of these alcohols.
- sugar alcohols and polyols e.g., glycol, glycerol, erythritol, threitol, arabitol, xylitol,
- Other products include methyl acrylate, methylmethacrylate, lactic acid, citric acid, formic acid, acetic acid, propionic acid, butyric acid, succinic acid, valeric acid, caproic acid, 3- hydroxypropionic acid, palmitic acid, stearic acid, oxalic acid, malonic acid, glutaric acid, oleic acid, linoleic acid, glycolic acid, gamma-hydroxybutyric acid, and mixtures thereof, salts of any of these acids, mixtures of any of the acids and their respective salts.
- the product of the methods for converting a biomass provided herein, e.g., comprising using a protein, e.g., an enzyme, e.g., an amylase or biomass degrading enzyme produced as described herein is a sugar product.
- the sugar product is glucose.
- the sugar product is xylose.
- the sugar product is a mixture of glucose and xylose.
- the product of the methods for converting a biomass provided herein, e.g., comprising using a protein, e.g., an enzyme, e.g., an amylase or biomass degrading enzyme produced as described herein is an organic acid product.
- the organic acid product is lactic acid.
- the biomass to be processed using the methods described herein is a starchy material and/or a cellulosic material comprising cellulose, e.g., a lignocellulosic material.
- the biomass may also comprise hemicellulose and/or lignin.
- the biomass can comprise one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof.
- An agricultural product or waste comprises material that can be cultivated, harvested, or processed for use or consumption, e.g., by humans or animals, or any intermediate, byproduct, or waste that is generated from the cultivation, harvest, or processing methods.
- Agricultural products or waste include, but are not limited to, sugar cane, jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses,
- a paper product or waste comprises material that is used to make a paper product, any paper product, or any intermediate, byproduct or waste that is generated from making or breaking down the paper product.
- Paper products or waste include, but are not limited to, paper, pigmented papers, loaded papers, coated papers, corrugated paper, filled papers, magazines, printed matter, printer paper, polycoated paper, cardstock, cardboard, paperboard, or paper pulp, or a combination thereof.
- a forestry product or waste comprises material that is produced by cultivating, harvesting, or processing of wood, or any intermediate, byproduct, or waste that is generated from the cultivation, harvest, or processing of the wood.
- Forestry products or waste include, but are not limited to, aspen wood, wood from any genus or species of tree, particle board, wood chips, or sawdust, or a combination thereof.
- a general waste includes, but is not limited to, manure, sewage, or offal, or a combination thereof.
- the biomass to be converted into products can be the same as the inducer biomass. Alternatively, the biomass to be converted into products is different than the inducer biomass.
- the biomass is treated prior to use in the process described herein.
- the biomass is treated to reduce the recalcitrance of the biomass, to reduce its bulk density, and/or increase its surface area.
- Suitable biomass treatment process may include, but are not limited to: bombardment with electrons, sonication, oxidation, pyrolysis, steam explosion, chemical treatment, mechanical treatment, and freeze grinding.
- the treatment method is bombardment with electrons.
- electron bombardment is performed until the biomass receives a total dose of at least 0.5 Mrad, e.g. at least 5, 10, 20, 30, or at least 40 Mrad.
- the treatment is performed until the biomass receives a dose a of from about 0.5 Mrad to about 150 Mrad, about 1 Mrad to about 100 Mrad, about 5 Mrad to about 75 Mrad, about 2 Mrad to about 75 Mrad, about 10 Mrad to about 50 Mrad, e.g., about 5 Mrad to about 50 Mrad, about 20 Mrad to about 40 Mrad, about 10 Mrad to about 35 Mrad, or from about 20 Mrad to about 30 Mrad.
- a total dose of 25 to 35 Mrad is preferred, applied ideally over a couple of seconds, e.g., at 5 Mrad/pass with each pass being applied for about one second. Applying a dose of greater than 7 to 9 Mrad/pass can in some cases cause thermal degradation of the feedstock material.
- the biomass material e.g., agricultural product or waste, paper product or waste, forestry product or waste, or general waste
- useful intermediates and products such as organic acids, salts of organic acids, anhydrides, esters of organic acids and fuels, e.g., fuels for internal combustion engines or feedstocks for fuel cells.
- Systems and processes are described herein that can use as feedstock cellulosic and/or lignocellulosic materials that are readily available, but often can be difficult to process, e.g., municipal waste streams and waste paper streams, such as streams that include newspaper, kraft paper, corrugated paper or mixtures of these.
- the glucan- or xylan-containing cellulose in the biomass can be hydrolyzed to low molecular weight carbohydrates, such as sugars, by a saccharifying agent in a process referred to as
- the saccharifying agent can comprise one or more enzymes, e.g., a biomass degrading enzyme, or acid, or a mixture thereof.
- the low molecular weight carbohydrates can then be used, for example, in an existing manufacturing plant, such as a single cell protein plant, an enzyme manufacturing plant, or a fuel plant, e.g., an ethanol manufacturing facility.
- the biomass can be hydrolyzed using an enzyme, e.g., a biomass degrading enzyme, by combining the biomass material(s) and the enzyme in a solvent, e.g., in an aqueous solution.
- the enzymes can be induced and/or produced according to the methods described herein.
- a biomass is hydrolyzed using a biomass degrading enzyme that has been produced by contacting a microorganism with a composition comprising a caramelized sugar product as described herein.
- the biomass degrading enzyme can be supplied by microorganisms that are capable of breaking down biomass (such as the cellulose and/or the lignin portions of the biomass), or that contain or manufacture various cellulolytic enzymes (cellulases), ligninases or various small molecule biomass degrading metabolites. These enzymes may be a complex of enzymes that act synergistically to degrade crystalline cellulose or the lignin portions of biomass. Examples of cellulolytic enzymes include: endoglucanases, cellobiohydrolases, and cellobiases (beta-glucosidases).
- a cellulosic substrate e.g., of the biomass
- Cellobiose is a water-soluble 1,4- linked dimer of glucose.
- cellobiase cleaves cellobiose to yield glucose. The efficiency (e.g., time to hydrolyze and/or completeness of hydrolysis) of this process depends on the recalcitrance of the cellulosic material.
- the reduced-recalcitrance biomass is treated with the biomass degrading enzymes discussed above, generally by combining the reduced-recalcitrance biomass and a saccharifying agent, e.g., comprising one or more biomass degrading enzymes, in a fluid medium, e.g., an aqueous solution.
- a saccharifying agent e.g., comprising one or more biomass degrading enzymes
- the biomass is boiled, steeped, or cooked in hot water prior to saccharification, as described in U.S. Pat. App. Pub. 2012/0100577 Al by Medoff and
- a protein e.g., an enzyme, e.g., an amylase or biomass degrading enzyme in a microorganism.
- the proteins, e.g., enzymes, e.g., amylases or biomass degrading enzyme(s) produced using the induction compositions and methods described herein can be used in the saccharification process as the saccharifying agent.
- the saccharifying agent is added directly to a biomass, e.g., a treated biomass, to initiate and perform the saccharification process to produce sugar products.
- the saccharification agent may comprise the proteins, e.g., biomass degrading enzyme(s) produced using the induction compositions and methods described herein.
- biomass degrading enzyme(s) produced using the induction compositions and methods described herein can be a cellulase, a hemicellulase, or a ligninase.
- the biomass degrading enzyme produced using the induction compositions and methods described herein can be one or more of the enzymes listed in Table 1.
- the saccharification agent may further comprise one or more additional agents that participate in the saccharification process, e.g., other proteins, e.g., enzymes, e.g., amylases or biomass degrading enzymes that were not obtained using the induction compositions or methods described herein.
- additional agents that participate in the saccharification process, e.g., other proteins, e.g., enzymes, e.g., amylases or biomass degrading enzymes that were not obtained using the induction compositions or methods described herein.
- the biomass is added to a culture comprising the microorganisms that have been induced to produce the proteins, e.g., enzymes, e.g., amylases or biomass degrading enzymes as described herein.
- proteins e.g., enzymes, e.g., amylases or biomass degrading enzymes as described herein.
- Other saccharifying agents e.g., proteins (e.g., biomass degrading enzymes) or acids, can be added to biomass and culture mixture for the
- the saccharification process can be partially or completely performed in a tank (e.g., a tank having a volume of at least 4000 L, 40,000 L, 500,000 L, 2,000,000 L, 4,000,000 L, or 6,000,000L or more) in a manufacturing plant, and/or can be partially or completely performed in transit, e.g., in a rail car, tanker truck, or in a supertanker or the hold of a ship.
- a tank e.g., a tank having a volume of at least 4000 L, 40,000 L, 500,000 L, 2,000,000 L, 4,000,000 L, or 6,000,000L or more
- the time required for complete saccharification will depend on the process conditions and the biomass material and enzyme used. If saccharification is performed in a manufacturing plant under controlled conditions, the cellulose may be substantially entirely converted to sugar, e.g., glucose in about 12-96 hours. If saccharification is performed partially or completely in transit, saccharification may take longer.
- the saccharification reaction occurs at a pH optimal for the enzymatic reactions to occur, e.g., at the pH optimal for the activity of the biomass degrading enzymes.
- the pH of the saccharification reaction is at pH 4-4.5.
- the saccharification reaction occurs at a temperature optimal for the enzymatic reactions to occur, e.g., at the temperature optimal for the activity of the biomass degrading enzymes.
- the temperature of the saccharification reaction is at 42°C - 52°C. It is generally preferred that the tank contents be mixed during saccharification, e.g., using jet mixing as described in International App. No. PCT/US2010/035331, filed May 18, 2010, which was published in English as WO 2010/135380 and designated the United States, the full disclosure of which is incorporated by reference herein.
- surfactants can enhance the rate of saccharification.
- surfactants include non-ionic surfactants, such as a Tween® 20 or Tween® 80 polyethylene glycol surfactants, ionic surfactants, or amphoteric surfactants.
- the concentration of the sugar solution resulting from saccharification be relatively high, e.g., greater than 5%, 7.5%, 10%, 10.5%, or greater than 40%, or greater than 50, 60, 70, or even greater than 80% by weight.
- Water may be removed, e.g., by evaporation, to increase the concentration of the sugar solution. This reduces the volume to be shipped, and also inhibits microbial growth in the solution.
- sugar solutions of lower concentrations may be used, in which case it may be desirable to add an antimicrobial additive, e.g., a broad spectrum antibiotic, in a low concentration, e.g., 50 to 150 ppm.
- an antimicrobial additive e.g., a broad spectrum antibiotic
- suitable antibiotics include amphotericin B, ampicillin, chloramphenicol, ciprofloxacin, gentamicin, hygromycin B, kanamycin, neomycin, penicillin, puromycin, streptomycin.
- Antibiotics will inhibit growth of microorganisms during transport and storage, and can be used at appropriate concentrations, e.g., between 15 and 10,000 ppm by weight, e.g., between 25 and 500 ppm, or between 50 and 150 ppm.
- an antibiotic can be included even if the sugar concentration is relatively high.
- other additives with anti-microbial of preservative properties may be used.
- the antimicrobial additive(s) are
- a relatively high concentration solution can be obtained by limiting the amount of water added to the biomass material with the enzyme.
- the concentration can be controlled, e.g., by controlling how much saccharification takes place. For example, concentration can be increased by adding more biomass material to the solution.
- a surfactant can be added, e.g., one of those discussed above.
- Solubility can also be increased by increasing the temperature of the solution.
- the solution can be maintained at a temperature of 40-50° C, 60-80° C, or even higher.
- sugars can be isolated by
- sugars produced by saccharification may be hydrogenated, fermented, or treated with other chemicals to produce other products.
- Glucose can be hydrogenated to sorbitol.
- Xylose can be hydrogenated to xylitol.
- Hydrogenation can be accomplished by use of a catalyst (e.g., Pt/ganinia-AlaCh, Ru/C, Raney Nickel, or other catalysts know in the art) in combination with 3 ⁇ 4 under high pressure (e.g., 10 to 12000 psi).
- a catalyst e.g., Pt/ganinia-AlaCh, Ru/C, Raney Nickel, or other catalysts know in the art
- 3 ⁇ 4 under high pressure e.g. 10 to 12000 psi.
- the sorbitol and/or xylitol products can be isolated and purified using methods known in the art.
- Sugar products from saccharification can also be fermented to produce alcohols, sugar alcohols, such as erythritol, or organic acids, e.g., lactic lacid, glutamic or citric acids or amino acids.
- alcohols sugar alcohols, such as erythritol
- organic acids e.g., lactic lacid, glutamic or citric acids or amino acids.
- Yeast and Zymomonas bacteria can be used for fermentation or conversion of sugar(s) to alcohol(s). Other microorganisms are discussed below.
- the optimum pH for fermentations is about pH 4 to 7.
- the optimum pH for yeast is from about pH 4 to 5
- the optimum pH for Zymomonas is from about pH 5 to 6.
- Typical fermentation times are about 24 to 168 hours (e.g., 24 to 96 hrs) with temperatures in the range of 20° C. to 40° C. (e.g., 26° C. to 40° C), however thermophilic microorganisms prefer higher
- At least a portion of the fermentation is conducted in the absence of oxygen, e.g., under a blanket of an inert gas such as N 2 , Ar, He, C0 2 or mixtures thereof.
- the mixture may have a constant purge of an inert gas flowing through the tank during part of or all of the fermentation.
- anaerobic conditions can be achieved or maintained by carbon dioxide production during the fermentation and no additional inert gas is needed.
- all or a portion of the fermentation process can be interrupted before the low molecular weight sugar is completely converted to a product (e.g., ethanol).
- the intermediate fermentation products include sugar and carbohydrates in high concentrations.
- the sugars and carbohydrates can be isolated via any means known in the art.
- These intermediate fermentation products can be used in preparation of food for human or animal consumption. Additionally or alternatively, the intermediate fermentation products can be ground to a fine particle size in a stainless-steel laboratory mill to produce a flour-like substance.
- Jet mixing may be used during fermentation, and in some cases saccharification and fermentation are performed in the same tank.
- Nutrients for the microorganisms may be added during saccharification and/or fermentation, for example the food-based nutrient packages described in U.S. Pat. App. Pub. 2012/0052536, filed Jul. 15, 2011, the complete disclosure of which is incorporated herein by reference.
- the saccharification equipment can be mobile. Further, saccharification and/or fermentation may be performed in part or entirely during transit.
- the microorganism(s) used in fermentation can be naturally-occurring microorganisms and/or engineered microorganisms.
- the microorganism can be a bacterium (including, but not limited to, e.g., a cellulolytic bacterium), a fungus, (including, but not limited to, e.g., a yeast), a plant, a protist, e.g., a protozoa or a fungus-like protest (including, but not limited to, e.g., a slime mold), or an algae.
- a bacterium including, but not limited to, e.g., a cellulolytic bacterium
- a fungus including, but not limited to, e.g., a yeast
- a plant e.g., a protist, e.g., a protozoa or a fungus-like protest (including, but not limited to, e.g.
- Suitable fermenting microorganisms have the ability to convert carbohydrates, such as glucose, fructose, xylose, arabinose, mannose, galactose, oligosaccharides or polysaccharides into fermentation products.
- Fermenting microorganisms include strains of the genus
- Saccharomyces spp. including, but not limited to, S. cerevisiae (baker's yeast), S. distaticus, S. uvarum), the genus Kluyveromyces, (including, but not limited to, K. marxianus, K. fragilis), the genus Candida (including, but not limited to, C. pseudotropicalis, and C. brassicae), Pichia stipitis (a relative of Candida shehatae), the genus Clavispora (including, but not limited to, C. lusitaniae and C. opuntiae), the genus Pachysolen (including, but not limited to, P.
- Saccharomyces spp. including, but not limited to, S. cerevisiae (baker's yeast), S. distaticus, S. uvarum), the genus Kluyveromyces, (including, but not limited to, K. marxianus, K. fragilis), the genus Candida (including,
- tannophilus the genus Bretannomyces (including, but not limited to, e.g., B. clausenii (Philippidis, G. P., 1996, Cellulose bioconversion technology, in Handbook on Bioethanol: Production and Utilization, Wyman, C. E., ed., Taylor & Francis, Washington, D.C., 179-212) ).
- Other suitable microorganisms include, for example, Zymomonas mobilis, Clostridium spp. (including, but not limited to, C. thermocellum (Philippidis, 1996, supra), C.
- acetobutylicum Moniliella pollinis, Moniliella megachiliensis, Lactobacillus spp. Yarrowia lipolytica, Aureobasidium sp., Trichosporonoides sp., Trigonopsis variabilis, Trichosporon sp., Moniliellaacetoabutans sp., Typhula variabilis, Candida magnoliae, Ustilaginomycetes sp., Pseudozyma tsukubaensis, yeast species of genera Zygosaccharomyces, Debaryomyces, Hansenula and Pichia, and fungi of the dematioid genus Torula.
- Clostridium spp. can be used to produce ethanol, butanol, butyric acid, acetic acid, and acetone. Lactobacillus spp. can be used to produce lactic acid.
- yeasts include, for example, Red Star®/Lesaffre Ethanol Red (available from Red Star/Lesaffre, USA), FALI® (available from Fleischmann's Yeast, a division of Burns Philip Food Inc., USA), SUPERSTART® (available from Alltech, now Lalemand), GERT STRAND® (available from Gert Strand AB, Sweden) and FERMOL® (available from DSM Specialties).
- microorganisms that can be used to saccharify biomass material and produce sugars can also be used to ferment and convert those sugars to useful products.
- the resulting fluids can be distilled using, for example, a "beer column” to separate ethanol and other alcohols from the majority of water and residual solids.
- the vapor exiting the beer column can be, e.g., 35% by weight ethanol and can be fed to a rectification column.
- a mixture of nearly azeotropic (92.5%) ethanol and water from the rectification column can be purified to pure (99.5%) ethanol using vapor-phase molecular sieves.
- the beer column bottoms can be sent to the first effect of a three-effect evaporator.
- the rectification column reflux condenser can provide heat for this first effect.
- solids can be separated using a centrifuge and dried in a rotary dryer. A portion (25%) of the centrifuge effluent can be recycled to fermentation and the rest sent to the second and third evaporator effects.
- Most of the evaporator condensate can be returned to the process as fairly clean condensate with a small portion split off to waste water treatment to prevent build-up of low-boiling compounds.
- T. reesei strain RUTC30 (ATCC 56765) was used to produce cellulases. Spores (>107ml) of T. reesei were inoculated into the seed culture media (Table 2 and 3) with 0.25% inoculation ratio at 30°C, shaken at 175 rpm. Table 2. T. reesei seed culture media
- Seed culture was inoculated into the main culture media (Table 4) with 5% inoculation ratio.
- Main culture was conducted at 27 °C, 700 rpm, 0.3 VVM in 3L bioreactor (New
- Caramelized sugar (or sugar) was fed into the main culture in feeding rate of 4 to 5 g/L/day.
- Example 2 Caramelized sugars induce cellulase production
- caramelized sugars are used to induce cellulose production in T. reesei.
- T. reesei was cultured and grown as described in the methods provided herein, e.g., Example 1.
- Caramelized glucose, maltose, and lactose was prepared according to the methods provided herein, e.g., Example 1.
- Caramelized sugars e.g., caramelized glucose, caramelized maltose, and caramelized lactose, (without cellulose inducer) were fed to a T. reesei culture at 5g/L/day. Levels of protein produced (g/L) was measured at days 4, 6, 8, and 11 or 12. Without any sugar feeding, very little protein was produced (Figure 1). Caramelized glucose, caramelized maltose, and caramelized lactose all induced protein production. Specifically, caramelized glucose and caramelized maltose showed higher induction capability than caramelized lactose. These results show that caramelized sugar was capable of inducing cellulase production.
- Mass spectrometry analysis was performed to identify the components of caramelized glucose, caramelized maltose, and caramelized lactose.
- Caramelized sugar samples were diluted 1000-fold and analyzed by ESI-MS. Extracted ion chromatograms were generated from the TIC, stacked, and integrated.
- cellulose inducers e.g., corncob and beeswing
- caramelized sugar was added with caramelized sugar to a T. reesei culture, and cellulase production was measured by determining the resulting protein titer.
- T. reesei were cultured and induced to produce cellulase as described in Example 2.
- Corncob and caramelized sugar was added together to a T. reesei culture. Induction by both cellulose inducer (corncob, CC) and caramelized sugar showed synergistic effect for cellulase production, as measured by protein titer ( Figure 3). Induction by corncob and caramelized glucose resulted in a 1.9 fold increase in protein titer, when compared to induction with corncob only ( Figure 3). Induction by corncob and caramelized glucose resulted in a 1.9 fold increase in protein titer, when compared to induction with caramelized sugar only ( Figure 3).
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Virology (AREA)
- Tropical Medicine & Parasitology (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Mycology (AREA)
- Botany (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Processing Of Solid Wastes (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2016243182A AU2016243182A1 (en) | 2015-03-31 | 2016-03-30 | Compositions for enhanced enzyme production |
| CA2981059A CA2981059A1 (en) | 2015-03-31 | 2016-03-30 | Compositions for enhanced enzyme production |
| JP2017550812A JP2018509919A (ja) | 2015-03-31 | 2016-03-30 | 増強された酵素産生のための組成物 |
| SG11201707406VA SG11201707406VA (en) | 2015-03-31 | 2016-03-30 | Compositions for enhanced enzyme production |
| US15/031,439 US10611997B2 (en) | 2015-03-31 | 2016-03-30 | Compositions for enhanced enzyme production |
| CN201680019638.7A CN107429224A (zh) | 2015-03-31 | 2016-03-30 | 用于增强的酶产生的组合物 |
| KR1020177027856A KR20170132190A (ko) | 2015-03-31 | 2016-03-30 | 향상된 효소 제조를 위한 조성물 |
| EP16774087.7A EP3277795A4 (en) | 2015-03-31 | 2016-03-30 | COMPOSITIONS FOR IMPROVED ENZYME PRODUCTION |
| MX2017012562A MX2017012562A (es) | 2015-03-31 | 2016-03-30 | Composiciones para produccion potenciada de enzimas. |
| BR112017020847-4A BR112017020847A2 (pt) | 2015-03-31 | 2016-03-30 | composições para aumento de produção de enzimas |
| PH12017501657A PH12017501657A1 (en) | 2015-03-31 | 2017-09-11 | Compositions for enhanced enzyme production |
| IL254665A IL254665A0 (en) | 2015-03-31 | 2017-09-25 | Compounds to produce increased production of enzymes |
| IL254744A IL254744A0 (en) | 2015-03-31 | 2017-09-27 | Preparations for improved production of enzymes |
| US16/802,543 US20200190462A1 (en) | 2015-03-31 | 2020-02-26 | Compositions for enhanced enzyme production |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562140785P | 2015-03-31 | 2015-03-31 | |
| US62/140,785 | 2015-03-31 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/031,439 A-371-Of-International US10611997B2 (en) | 2015-03-31 | 2016-03-30 | Compositions for enhanced enzyme production |
| US16/802,543 Division US20200190462A1 (en) | 2015-03-31 | 2020-02-26 | Compositions for enhanced enzyme production |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016160956A1 true WO2016160956A1 (en) | 2016-10-06 |
Family
ID=57005198
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/024966 Ceased WO2016160956A1 (en) | 2015-03-31 | 2016-03-30 | Compositions for enhanced enzyme production |
Country Status (13)
| Country | Link |
|---|---|
| US (2) | US10611997B2 (https=) |
| EP (1) | EP3277795A4 (https=) |
| JP (1) | JP2018509919A (https=) |
| KR (1) | KR20170132190A (https=) |
| CN (1) | CN107429224A (https=) |
| AU (1) | AU2016243182A1 (https=) |
| BR (1) | BR112017020847A2 (https=) |
| CA (1) | CA2981059A1 (https=) |
| IL (2) | IL254665A0 (https=) |
| MX (1) | MX2017012562A (https=) |
| PH (1) | PH12017501657A1 (https=) |
| SG (1) | SG11201707406VA (https=) |
| WO (1) | WO2016160956A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10611997B2 (en) | 2015-03-31 | 2020-04-07 | Xyleco, Inc. | Compositions for enhanced enzyme production |
| CN112334582A (zh) * | 2018-07-04 | 2021-02-05 | 花王株式会社 | 蛋白质的制造方法 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20120201947A1 (en) * | 2006-09-01 | 2012-08-09 | Earnest Stuart | Advanced biorefinery process |
| US20130344555A1 (en) * | 2010-11-01 | 2013-12-26 | Technical University Of Denmark | Dsmz 24726 for second generation bio-ethanol production |
| US20140011258A1 (en) * | 2011-12-22 | 2014-01-09 | Xyleco, Inc. | Processing biomass |
| WO2014176508A2 (en) * | 2013-04-26 | 2014-10-30 | Xyleco, Inc. | Processing biomass to obtain hydroxylcarboxylic acids |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7713725B2 (en) | 2002-09-10 | 2010-05-11 | Danisco Us Inc. | Induction of gene expression using a high concentration sugar mixture |
| EP2198019A4 (en) * | 2007-08-30 | 2011-05-11 | Iogen Energy Corp | PROCESS FOR PRODUCING CELLULASE |
| CN101250511B (zh) * | 2008-04-16 | 2010-12-01 | 中国石油化工股份有限公司 | 稀硫酸处理纸浆作为碳源促进里氏木霉合成纤维素酶的方法 |
| EP2350272A4 (en) | 2008-11-03 | 2013-01-16 | Iogen Energy Corp | HOST AND FERMENTATION METHOD FOR CELLULATE PRODUCTION |
| KR101371416B1 (ko) | 2012-04-05 | 2014-03-19 | 전북대학교산학협력단 | 재조합 피키아 파스토리스에 의한 자일라나아제의 대량생산을 위한 최적 배지 조성물 및 발효 조건 |
| US9624436B2 (en) * | 2012-05-17 | 2017-04-18 | Shell Oil Company | Methods and systems for processing biomass material |
| CN104630186A (zh) | 2015-02-07 | 2015-05-20 | 大连理工大学 | 一种用于诱导生产纤维素酶的糖混合液的制备方法及应用 |
| JP2018509919A (ja) | 2015-03-31 | 2018-04-12 | ザイレコ,インコーポレイテッド | 増強された酵素産生のための組成物 |
-
2016
- 2016-03-30 JP JP2017550812A patent/JP2018509919A/ja active Pending
- 2016-03-30 MX MX2017012562A patent/MX2017012562A/es unknown
- 2016-03-30 AU AU2016243182A patent/AU2016243182A1/en not_active Abandoned
- 2016-03-30 CA CA2981059A patent/CA2981059A1/en not_active Abandoned
- 2016-03-30 CN CN201680019638.7A patent/CN107429224A/zh active Pending
- 2016-03-30 BR BR112017020847-4A patent/BR112017020847A2/pt not_active IP Right Cessation
- 2016-03-30 WO PCT/US2016/024966 patent/WO2016160956A1/en not_active Ceased
- 2016-03-30 EP EP16774087.7A patent/EP3277795A4/en not_active Withdrawn
- 2016-03-30 KR KR1020177027856A patent/KR20170132190A/ko not_active Withdrawn
- 2016-03-30 US US15/031,439 patent/US10611997B2/en not_active Expired - Fee Related
- 2016-03-30 SG SG11201707406VA patent/SG11201707406VA/en unknown
-
2017
- 2017-09-11 PH PH12017501657A patent/PH12017501657A1/en unknown
- 2017-09-25 IL IL254665A patent/IL254665A0/en unknown
- 2017-09-27 IL IL254744A patent/IL254744A0/en unknown
-
2020
- 2020-02-26 US US16/802,543 patent/US20200190462A1/en not_active Abandoned
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20120201947A1 (en) * | 2006-09-01 | 2012-08-09 | Earnest Stuart | Advanced biorefinery process |
| US20130344555A1 (en) * | 2010-11-01 | 2013-12-26 | Technical University Of Denmark | Dsmz 24726 for second generation bio-ethanol production |
| US20140011258A1 (en) * | 2011-12-22 | 2014-01-09 | Xyleco, Inc. | Processing biomass |
| WO2014176508A2 (en) * | 2013-04-26 | 2014-10-30 | Xyleco, Inc. | Processing biomass to obtain hydroxylcarboxylic acids |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10611997B2 (en) | 2015-03-31 | 2020-04-07 | Xyleco, Inc. | Compositions for enhanced enzyme production |
| CN112334582A (zh) * | 2018-07-04 | 2021-02-05 | 花王株式会社 | 蛋白质的制造方法 |
| EP3819383A4 (en) * | 2018-07-04 | 2022-06-08 | Kao Corporation | Method for producing protein |
| US12227782B2 (en) | 2018-07-04 | 2025-02-18 | Kao Corporation | Method for producing protein |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20170132190A (ko) | 2017-12-01 |
| BR112017020847A2 (pt) | 2018-07-10 |
| US20200190462A1 (en) | 2020-06-18 |
| IL254665A0 (en) | 2017-11-30 |
| SG11201707406VA (en) | 2017-10-30 |
| CA2981059A1 (en) | 2016-10-06 |
| EP3277795A1 (en) | 2018-02-07 |
| EP3277795A4 (en) | 2019-02-13 |
| MX2017012562A (es) | 2018-01-30 |
| IL254744A0 (en) | 2017-11-30 |
| JP2018509919A (ja) | 2018-04-12 |
| US20180010088A1 (en) | 2018-01-11 |
| CN107429224A (zh) | 2017-12-01 |
| US10611997B2 (en) | 2020-04-07 |
| AU2016243182A1 (en) | 2017-09-21 |
| PH12017501657A1 (en) | 2018-03-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2516663B1 (en) | Methods for improving the efficiency of simultaneous saccharification and fermentation reactions | |
| US9758802B2 (en) | Methods of degrading or hydrolyzing a polysaccharide | |
| US20200190462A1 (en) | Compositions for enhanced enzyme production | |
| US20190316108A1 (en) | Solubilized enzyme and uses thereof | |
| US20190024068A1 (en) | Aglycosylated enzyme and uses thereof | |
| AU2015261652B2 (en) | Methods for improving the efficiency of simultaneous saccharification and fermentation reactions | |
| OA18211A (en) | Aglycosylated enzyme and uses thereof. | |
| OA18252A (en) | Solubilized enzyme and uses thereof. | |
| BR122018071572B1 (pt) | Célula de trichoderma reesei, método para produzir uma preparação de celulase e caldo de cultura | |
| BR112012018407B1 (pt) | Composição e métodos de sacarificação e fermentação simultâneas e para produção de um produto de fermentação | |
| HK1174667A (en) | Methods for improving the efficiency of simultaneous saccharification and fermentation reactions |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16774087 Country of ref document: EP Kind code of ref document: A1 |
|
| REEP | Request for entry into the european phase |
Ref document number: 2016774087 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12017501657 Country of ref document: PH |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201707406V Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2016243182 Country of ref document: AU Date of ref document: 20160330 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 254665 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2981059 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 254744 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 20177027856 Country of ref document: KR Kind code of ref document: A Ref document number: 2017550812 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/012562 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017020847 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112017020847 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170928 |