OA18252A - Solubilized enzyme and uses thereof. - Google Patents

Solubilized enzyme and uses thereof. Download PDF

Info

Publication number
OA18252A
OA18252A OA1201700105 OA18252A OA 18252 A OA18252 A OA 18252A OA 1201700105 OA1201700105 OA 1201700105 OA 18252 A OA18252 A OA 18252A
Authority
OA
OAPI
Prior art keywords
polypeptide
biomass
activity
mixture
degrading
Prior art date
Application number
OA1201700105
Inventor
Aiichiro Yoshida
Thomas Craig Masterman
Marshall Medoff
Natasha Kreder
James Lynch
Sean Landry
Desiree Pangilinan
Original Assignee
Xyleco, Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Xyleco, Inc. filed Critical Xyleco, Inc.
Publication of OA18252A publication Critical patent/OA18252A/en

Links

Abstract

The present invention relates to mixtures comprising a polypeptide or a plurality of polypeptides having biomass-degrading activity that is solubilized from an inclusion body, and retaining biomass-degrading activity, and methods for producing and using the same. The invention described herein provides methods for increasing the yield of recombinant protein with biomassdegrading activity that can be isolated from host cells.

Description

SOLUBILIZED ENZYME AND USES THEREOF
Related Applications [001] This application claims the benefït of U.S. Provisional Application No. 62/055,702, filed September 26, 2014; the entire contents of which are hereby incorporated by reference.
Sequence Listing [002] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on September 1, 2015, is named X2002-7003WO_SL.txt and is 76,946 bytes in size.
Field of the Invention [003] The présent invention relates generally to mixtures comprising a polypeptide having biomass-degrading activity solubilized from inclusion bodies and having biomass-degrading activity, and methods for producing the mixtures described herein. The présent invention also provides methods for using such mixtures, e.g., to process biomass materials.
BACKGROUND OF THE INVENTION [004] Biomass-degrading enzymes, such as cellulases, xylanases, and ligninases, are important for the dégradation of biomass, such as feedstock. Cellulosic and lignocellulosic materials are produced, processed, and used in large quantities in a number of applications. Often such materials are used once, and then discarded as waste, or are simply considered to be wasted materials, e.g., sewage, bagasse, sawdust, and stover.
SUMMARY OF THE INVENTION [005] High level of expression of recombinant proteins in host cells such as E. coli can lead to accumulation of the recombinant proteins into insoluble aggregates within the host cell. These insoluble aggregates are called inclusion bodies and can also contain other components, such as proteins endogenous to the host cell, ribosomal components, nucleic acids, and cellular débris. Solubilization of the recombinant proteins from the inclusion bodies can be achieved i
through treatment with high concentrations of a solubilizing agent such as urea, which disrupts hydrogen bonds and hydrophobie interactions. However, treatment with a solubilizing agent, such as urea, can resuit in dénaturation of the protein and loss of enzymatic activity. Thus, the aggregation of recombinant proteins into inclusion bodies can reduce the yield of recombinant protein with enzymatic activity that can be isolated from the host cells.
[006] The présent invention is based, at least in part, on the surprising discovery that a heterologously expressed cellobiase that has been solubilized from inclusion bodies by solubilizing agent, such as urea, retains cellobiase activity. Therefore, the methods described herein for solubilization of heterologously expressed cellobiase, or other biomass-degrading enzymes, are useful for increasing the yield of the heterologously expressed enzymes having biomass-degrading activity, e.g., by 30-40%. Furthermore, the presence of the solubilizing agent, e.g., urea, from the addition of the solubilized biomass-degrading enzyme, e.g., cellobiase, does not adversely affect the saccharification reaction for converting biomass to a sugar product and/or the yield of products.
[007] Accordingly, in one aspect, the disclosure features a mixture comprising a polypeptide or a plurality of polypeptides having a biomass-degrading activity and a solubilizing agent, e.g., urea, wherein the polypeptide or plurality thereof has at least 8-10% biomass-degrading activity compared the native polypeptide.
[008] In one embodiment, the mixture further comprises one or more proteins associated with an inclusion body. Altematively, in one embodiment, the mixture does not comprise one or more proteins associated with an inclusion body. In one embodiment, the mixture further comprises cellular débris, one or more ribosomal component, one or more host protein, e.g., protein endogenously expressed by the host cell, and/or host nucleic acid, e.g., DNA and/or RNA.
[009] In one embodiment, the biomass-degrading activity is cellobiase activity, ligninase activity, endoglucanase activity, cellobiohydrolase activity, or xylanase activity.
[0010] In one embodiment, the polypeptide is partially unfolded, partially misfolded, or partially denatured.
[0011] In another aspect, the disclosure features a mixture comprising a polypeptide or a plurality of polypeptides having an amino acid sequence with at least 90% identity to SEQ ID NO: 1 and a solubilizing agent, e.g., urea, wherein the polypeptide or plurality thereof has at least 20% of the activity of the native polypeptide, e.g., SEQ ID NO: 1 or Cel3a from T. reesei.
For example, the mixture further comprises one or more proteins associated with an inclusion body. Altematively, the mixture does not comprise one or more proteins associated with an inclusion body. The mixture may further comprise one or more of the following: cellular débris, one or more ribosomal component, one or more host protein, e.g., protein endogenously expressed by the host cell, and/or host nucleic acid, e.g., DNA and/or RNA. The polypeptide with at least 90% identity to SEQ ID NO: 1 may be partially unfolded, partially misfolded, or partially denatured.
[0012] In one embodiment, the polypeptide comprises an amino acid sequence with at least 90% identity to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a Cel3A enzyme from T. reesei, or a functional variant or fragment thereof. In one embodiment, the Cel3A enzyme comprises (e.g., consists of) the amino acid sequence SEQ ID NO: 1. In one embodiment, the polypeptide is encoded by a nucleic acid sequence comprising (e.g., consisting of) at least 90% identity to SEQ ID NO: 2 or SEQ ID NO: 3.
[0013] In one embodiment, the polypeptide is aglycosylated.
[0014] In one embodiment, the solubilizing agent, e.g., urea, is présent in the mixture at a concentration between 0.2M-6M.
[0015] In one embodiment, the mixture further comprises at least one additional polypeptide having a biomass-degrading activity or a microorganism that produces one or more enzymes having a biomass-degrading activity. In one embodiment, the additional polypeptide is selected from a ligninase, an endoglucanase, a cellobiohydrolase, a cellobiase, and a xylanase, or any combination thereof. In one embodiment, the additional polypeptide is selected from:
a. a polypeptide comprising (e.g., consisting of) an amino acid sequence with at least . 90% identity to SEQ ID NO: 1 ;
b. a Cel3A enzyme from T. reesei, or a functional variant or fragment thereof; or
c. a polypeptide encoded by a nucleic acid sequence comprising (e.g., consisting of) SEQ ID NO: 2 or SEQ ID NO: 3.
[0016] In one embodiment, the additional polypeptide is aglycosylated.
[0017] In one embodiment, the additional polypeptide is glycosylated.
[0018] In one aspect, the disclosure features a method for producing a mixture described herein comprising a polypeptide having biomass-degrading activity, one or more proteins associated with an inclusion body, and a solubilizing agent, e.g., urea, wherein the method comprises contacting a cell expressing the polypeptide having biomass-degrading activity, or lysate thereof, with a solubilizing agent, e.g., urea, at a concentration suitable for solubilizing the polypeptide. In one embodiment, the method further comprises lysing the cell to obtain a lysate, separating a soluble fraction from an insoluble fraction of the lysate, and resuspending the insoluble fraction in the solubilizing agent, e.g., urea. In one embodiment, the concentration of the solubilizing agent, e.g., urea, is between 0.2M-6M, e.g., 6M.
[0019] In one embodiment, the biomass-degrading activity is a cellobiase activity, a ligninase activity, an endoglucanase activity, a cellobiohydrolase, or a xylanase activity.
[0020] In one embodiment, the polypeptide comprises an amino acid sequence with at least 90% identity to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a Cel3A from T. reesei, or a functional variant or fragment thereof.
[0021] In one embodiment, the polypeptide is aglycosylated.
[0022] In one aspect, the disclosure features a method for producing a polypeptide having a biomass-degrading activity comprising expressing the polypeptide in a cell and contacting the cell or a lysate thereof with a solubilizing agent, e.g., urea, at a concentration suitable for solubilizing the polypeptide.
[0023] In another aspect, the disclosure features a method for producing a polypeptide having biomass-degrading activity comprising providing a cell that has been genetically modifîed to produce at least one polypeptide having biomass-degrading activity, wherein at least a portion of said polypeptide having biomass-degrading activity is found in inclusion bodies, and contacting the cell, or a lysate thereof containing the inclusion bodies, with a solubilizing agent, e.g., urea, at a concentration suitable for solubilizing the polypeptide.
[0024] In one embodiment, the methods disclosed herein further comprise lysing the cell to obtain a lysate, separating a soluble fraction from an insoluble fraction of the lysate, and resuspending the insoluble fraction in the solubilizing agent, e.g., urea. In one embodiment, the concentration of the solubilizing agent, e.g., urea, is between 0.2M-6M, e.g., 6M.
[0025] In one embodiment, the biomass-degrading activity is a cellobiase activity, a ligninase activity, an endoglucanase activity, a cellobiohydrolase activity, or a xylanase activity.
[0026] In one embodiment, the aglycosylated polypeptide comprises (e.g., consisting of) an amino acid sequence with at least 90% identity to SEQ ID NO: 1. In one embodiment, the aglycosylated polypeptide comprises a Cel3 A from T. reesei, or a functional variant or fragment thereof.
[0027] In one embodiment, the cell is a prokaryotic or bacterial cell, e.g., E. coli cell, origami E. coli cell.
[0028] In one embodiment, the polypeptide is aglycosylated.
[0029] In one aspect, the disclosure features a method of producing a product (e.g., hydrogen, a sugar, an alcohol) from a biomass (or converting a biomass to a product) comprising contacting a biomass with the mixture described herein comprising a polypeptide having biomass-degrading activity, one or more proteins associated with an inclusion body, and 10 a solubilizing agent, e.g., urea, and, optionally, with a microorganism that produces one or more biomass-degrading enzyme and/or an enzyme mixture comprising biomass-degrading enzymes, under conditions suitable for the production of the product.
[0030] In one embodiment, the method further comprises a step of treating the biomass with an électron beam prior to contacting the biomass with the mixture described herein comprising a polypeptide having biomass-degrading activity, one or more proteins associated with an inclusion body, and a solubilizing agent, e.g., urea.
[0031] In one embodiment, the product is a sugar product. In one embodiment, the sugar product is glucose and/or xylose.
[0032] In one embodiment, the method further comprises a step of isolating the product. In 20 one embodiment, the step of isolating the product comprises précipitation, crystallization, chromatography, centrifugation, and/or extraction.
[0033] In one embodiment, the enzyme mixture comprises at least two of the enzymes selected fromB2AF03, CIP1, CIP2, Cella, Cel3a, Cel5a, Cel6a, Cel7a, Cel7b, Cell2a, Cel45a, Cel74a, paMan5a, paMan26a, Swollenin.
[0034] In one embodiment, the biomass comprises starchy materials, sugar cane, agricultural waste, paper, paper product, paper waste, paper pulp, pigmented papers, loaded papers, coated papers, filled papers, magazines, printed matter, printer paper, polycoated paper, card stock, cardboard, paperboard, cotton, wood, particle board, forestry wastes, sawdust, aspen wood, wood chips, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, agricultural waste, silage, canola straw, wheat straw, barley straw, oat straw, rice straw, jute, hemp, flax, bamboo, sisal, abaca, corn cobs, corn stover, soybean stover, corn fiber, alfalfa, hay, coconut hair, sugar processing residues, bagasse, beet pulp, agave bagasse, algae, seaweed, manure, sewage, offal, agricultural or industrial waste, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, or any combination thereof.
[0035] In one embodiment, the biomass comprises a starchy material or a starchy material that includes a cellulosic component. In some embodiments, the biomass comprises one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof; wherein: a) an agricultural product or waste comprises sugar cane jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, corn cobs, corn stover, com fiber, coconut hair, beet pulp, bagasse, soybean stover, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, or beeswing, or a combination thereof; b) a paper product or waste comprises paper, pigmented papers, loaded papers, coated papers, filled papers, magazines, printed matter, printer paper, polycoated paper, cardstock, cardboard, paperboard, or paper pulp, or a combination thereof; c) a forestry product comprises aspen wood, particle board, wood chips, or sawdust, or a combination thereof; and d) a general waste comprises manure, sewage, or offal, or a combination thereof.
[0036] In one embodiment, the method further comprises a step of treating the biomass prior to introducing the microorganism or the enzyme mixture to reduce the recalcitrance of the biomass, e.g., by treating the biomass with bombardment with électrons, sonication, oxidation, pyrolysis, steam explosion, chemical treatment, mechanical treatment, and/or freeze grinding. [0037] In one embodiment, the microorganism that produces a biomass-degrading enzyme is from species in the généra selected from Bacillus, Coprinus, Myceliophthora,
Cephalosporium, Scytalidium, Pénicillium, Aspergillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, Chrysosporium or Trichoderma. In one embodiment, the microorganism that produces a biomass-degrading enzyme is selected from Aspergillus, Humicola insolens (Scytalidium thermophilum), Coprinus cinereus, Fusarium oxysporum, Myceliophthora thermophila, Meripilus giganteus, Thielavia terrestris, Acremonium persicinum, Acremonium acremonium, Acremonium brachypenium, Acremonium dichromosporum, Acremonium obclavatum, Acremonium pinkertoniae, Acremonium roseogriseum, Acremonium incoloratum, Acremonium furatum, Chrysosporium lucknowense, Trichoderma viride, Trichoderma reesei, or Trichoderma koningii.
[0038] In one embodiment, the microorganism has been induced to produce biomassdegrading enzymes by combining the microorganism with an induction biomass sample under conditions suitable for increasing production of biomass-degrading enzymes compared to an uninduced microorganism. In one embodiment, the induction biomass sample comprises starchy materials, sugar cane, paper, paper products, paper waste, paper pulp, pigmented papers, loaded papers, coated papers, filled papers, magazines, printed matter, printer paper, polycoated paper, card stock, cardboard, paperboard, cotton, wood, particle board, forestry wastes, sawdust, aspen wood, wood chips, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, agricultural waste, silage, canola straw, wheat straw, barley straw, oat straw, rice straw, jute, hemp, flax, bamboo, sisal, abaca, corn cobs, corn stover, soybean stover, corn fiber, alfalfa, hay, coconut haïr, sugar processing residues, bagasse, beet pulp, agave bagasse, algae, seaweed, manure, sewage, offal, agricultural or industrial waste, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, or any combination thereof.
[0039] In one embodiment, the induction biomass comprises a starchy material or a starchy material that includes a cellulosic component. In some embodiments, the induction biomass comprises one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof; wherein: a) an agricultural product or waste comprises sugar cane jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, corn cobs, corn stover, com fiber, coconut haïr, beet pulp, bagasse, soybean stover, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, or beeswing, or a combination thereof; b) a paper product or waste comprises paper, pigmented papers, loaded papers, coated papers, filled papers, magazines, printed matter, printer paper, polycoated paper, cardstock, cardboard, paperboard, or paper pulp, or a combination thereof; c) a forestry product comprises aspen wood, particle board, wood chips, or sawdust, or a combination thereof; and d) a general waste comprises manure, sewage, or offal, or a combination thereof.
[0040] In one embodiment, the présent invention provides advantages to current methods used in the art. These advantages include providing access to insoluble enzymes that would normally be discarded, increasing the yield of desired proteins that retain enzyme activity, purified enzymes for cleaner downstream processing, and organism sélection (e.g., increase availability of organisms that may hâve been previously excluded from use due to propensity to develop inclusion bodies).
Brief Description of the Drawings [0041] FIG. 1 is a chromatogram showing the results of IMAC purification of solubilized Cel3a. The purified solubilized Cel3a peak is indicated by the arrow.
[0042] FIG. 2 is a picture of an SDS-PAGE gel showing the proteins in different fractions of the IMAC purification. Lane 1 shows the molecular weight standards. Lane 2 shows purified Cel3a from the soluble fraction. Lane 3 shows the flow through from IMAC purification of the insoluble fraction. Lane 4 shows the purified solubilized Cel3a from the insoluble fraction.
[0043] FIG. 3 is a graph comparing the cellobiase activity of purified soluble Cel3a and purified solubilized Cel3a from the insoluble fraction.
[0044] FIG. 4 is a graph comparing the cellobiase activity of purified soluble Cel3a, the wash fraction of the insoluble fraction, and Cel3a solubilized from the insoluble fraction without purification.
Detailed Description
Définitions [0045] Unless defined otherwise, ail technical and scientific terms used herein hâve the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains.
[0046] The term “a” and “an” refers to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, “an element” means one element or more than one element.
[0047] The term “aglycosylated”, as used herein, refers to a molécule, e.g., a polypeptide, that is not glycosylated (i.e., it comprises a hydroxyl group or other functional group that is not attached to a glycosylate group) at one or more sites which has a glycan attached when the molécule is produced in its native environment. In some embodiments, the aglycosylated molécule does not hâve any attached glycans. In one embodiment, the molécule has been altered or mutated such that the molécule cannot be glycosylated, e.g., one or more glycosylation site is mutated such that a glycan cannot be attached to the glycosylation site. In another embodiment, an attached glycan can be removed from the molécule, e.g., by an enzymatic process, e.g., by incubating with enzymes that remove glycans or hâve deglycosylating activity. In yet another embodiment, glycosylation of the molécule can be inhibited, e.g., by use of a glycosylation inhibitor (that inhibits a glycosylating enzyme). In another embodiment, the molécule, e.g., the polypeptide, can be produced by a host cell that does not glycosylate, e.g., E. coli. For example, a Cel3A enzyme is aglycosylated when one or more site in the protein that normally has a glycan group attached to it when the Cel3 A enzyme is produced in T. reesei does not hâve a glycan attached at that site.
[0048] The term “biomass”, as used herein, refers to any non-fossilized, organic matter. The various types of biomass include plant biomass (e.g., lignocellulosic and cellulosic biomass), microbial biomass, animal biomass (any animal by-product, animal waste, etc.) and municipal waste biomass (residential and light commercial refuse with recyclables such as métal and glass removed). Plant biomass refers to any plant-derived organic matter (woody or non-woody). Plant biomass can include, but is not limited to, agricultural or food crops (e.g., sugarcane, sugar beets or corn kernels) or an extract therefrom (e.g., sugar from sugarcane and corn starch from corn), agricultural crop wastes and residues such as corn stover, wheat straw, rice straw, sugar cane bagasse, and the like. Plant biomass further includes, but is not limited to, trees, woody energy crops, wood wastes and residues such as softwood forest thinnings, barky wastes, sawdust, paper and pulp industry waste streams, wood fiber, and the like. Additionally, grass crops, such as switchgrass and the like hâve potential to be produced on a large-scale as another plant biomass source. For urban areas, the best potential plant biomass feedstock includes yard waste (e.g., grass clippings, leaves, tree clippings, and brush) and vegetable processing waste.
[0049] The term “biomass degrading enzymes”, as used herein, refers to enzymes that break down components of the biomass matter described herein into intermediates or final products. For example, biomass-degrading enzymes include at least ligninases, endoglucancases, cellobiases, xylanases, and cellobiohydrolases. Biomass-degrading enzymes are produced by a wide variety of microorganisms, and can be isolated from the microorganisms, such as T. reesei.
[0050] The term “biomass degrading activity”, as used herein, refers to enzymatic activity that breaks down components of the biomass matter described herein into intermediates or final products. Biomass-degrading activity includes at least ligninase activity, endoglucanase activity, cellobiase activity, cellobiohydrolase activity, and xylanase activity. For example, a polypeptide having biomass degrading activity is a cellobiase such as Cel3a from T. reesei. [0051] The term “cellobiase”, as used herein, refers to an enzyme that catalyzes the hydrolysis of a dimer, trimer, tetramer, pentamer, hexamer, heptamer, octamer, or an oligomer of glucose, or an oligomer of glucose and xylose, to glucose and/or xylose. For example, the cellobiase is beta-glucosidase, which catalyzes beta-1,4 bonds in cellobiose to release two glucose molécules.
[0052] The term “cellobiase activity”, as used herein, refers to the activity of a category of cellulases that catalyze the hydrolysis of cellobiose to glucose, e.g., catalyzes the hydrolysis of beta-D-glucose residues to release beta-D-glucose. Cellobiase activity can be determined according to the assays described herein, e.g., in Example 4. One unit of cellobiase activity can be defined as [glucose] g/L / [Cel3a] g/L /30 minutes.
[0053] The term “cellobiohydrolase” as used herein, refers to an enzyme that hydrolyzes glycosidic bonds in cellulose. For example, the cellobiohydrolase is 1,4-beta-D-glucan cellobiohydrolase, which catalyzes the hydrolysis of 1,4-beta-D-glucosidic linkages in cellulose, cellooligosaccharides, or any beta- 1,4-linked glucose containing polymer, releasing oligosaccharides from the polymer chain.
[0054] The term “cellobiohydrolase activity”, as used herein, refers to the activity of an enzyme that catalyzes the hydrolysis of glycosidic bonds in cellulose, specifically, the hydrolysis of 1,4-beta-D-glucosidic linkages in cellulose, cellooligosaccharides, or any beta1,4-linked glucose-containing polymer, to release cellobiose from the ends of the saccharide chain, e.g., from the reducing or the non-reducing ends of the chain. Cellobiohydrolase activity can be determined according to the assays described herein. One unit of cellobiohydrolase activity can be defined, for example, as the amount of enzyme that releases 1 μΜ of glucose équivalent from substrate (e.g., Avicel) per minute.
[0055] The term “endoglucanase” as used herein, refers to an enzyme that catalyzes the hydrolysis of internai β-1,4 glycosidic bonds. For example, the endoglucanase is endo- 1,4-(1 ,3; 1,4)-beta-D-glucan 4-glucanohydrolase, which catalyses endohydrolysis of 1,4-beta-Dglycosidic linkages in cellulose, cellulose dérivatives (such as carboxymethyl cellulose and hydroxyethyl cellulose), lichenan, beta- 1,4 bonds in mixed beta- 1, 3 glucans such as cereal beta-D-glucans or xyloglucans, and other plant material containing cellulosic components. [0056] The term “endoglucanase activity” as used herein, refers to the activity of an enzyme that catalyzes the endohydrolysis of the internai glycosidic bonds, e.g., internai beta1,4 glycosidic bonds, of cellulose, cellulose dérivatives (such as carboxymethyl cellulose and hydroxyethyl cellulose), lichenan, beta- 1,4 bonds in mixed beta- 1, 3 glucans such as cereal beta-D-glucans or xyloglucans, and other plant material containing cellulosic components. Endoglucanase activity can be determined according to the assays described herein. One unit of endoglucanase activity can be defined, for example, as the amount of enzyme that increases the concentration of the reducing ends by ΙμΜ from substrate per minute.
[0057] The term “enzyme mixture” as used herein, refers to a combination of at least two different enzymes, or two different variants of an enzyme (e.g., a glycosylated and an aglycosylated version of an enzyme). The enzyme mixture referred to herein includes at least the aglycosylated polypeptide having cellobiase activity described herein. In one embodiment, the enzyme mixture includes one or more of a cellobiase, an endoglucanase, a cellobiohydrolase, a ligninase, and/or a xylanase. In some embodiments, the enzyme mixture includes a cell, e.g., a microorganism, which expresses and, e.g., sécrétés, one or more of the enzymes. For example, the enzyme mixture can include an aglycosylated polypeptide described herein and a cell, e.g., a microorganism, which expresses and, e.g., sécrétés, one or more additional enzymes and/or variants of the polypeptide.
[0058] The term “inclusion body” as used herein, refers to insoluble aggregates produced by a microorganism, e.g., a host cell, containing one or more of the following: a heterologously expressed polypeptide, e.g., a polypeptide having biomass-degrading activity, cellular débris, one or more ribosomal component, one or more protein endogenously expressed from the host cell, one or more nucleic acids (RNA and/or DNA), or any combination thereof. Inclusion bodies commonly occur in host cells, e.g., bacterial cells, during high levels of expression of a recombinant protein. The heterologously expressed polypeptides found in the inclusion body may be partially unfolded, partially misfolded, or partially denatured.
[0059] The term “ligninase” as used herein, refers to an enzyme that catalyzes the breakdown of lignin, commonly found in the cell walls of plants, such as by an oxidation reaction. Ligninases include lignin-modifying enzymes, lignin peroxidases and laccases. [0060] The term “ligninase activity” as used herein, refers to the activity of an enzyme that catalyzes the breakdown of lignin and lignin-like polymers by an oxidation reaction. Ligninase activity can be determined according to the assays described herein.
[0061] The terms “nucleic acid” or “polynucleotide” are used interchangeable, and refer to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucléotides that hâve similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucléotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or ail) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
[0062] The tenu “operably linked”, as used herein, refers to a configuration in which a control or regulatory sequence is placed at a position relative to a nucleic acid sequence that encodes a polypeptide, such that the control sequence influences the expression of a polypeptide (encoded by the DNA sequence). In an embodiment, the control or regulatory sequence is upstream of a nucleic acid sequence that encodes a polypeptide with cellobiase activity. In an embodiment, the control or regulatory sequence is downstream of a nucleic acid sequence that encodes a polypeptide with cellobiase activity.
[0063] The terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds. A protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein’s or peptide’s sequence. Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds. “Polypeptides” include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, dérivatives, analogs, fusion proteins, among others. A polypeptide includes a natural peptide, a recombinant peptide, or a combination thereof. A “plurality of polypeptides” refers to two or more polypeptides, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, 100, 200, or 500 or more polypeptides.
[0064] The term “promoter”, as used herein, refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the spécifie transcription of a polynucleotide sequence.
[0065] The term “regulatory sequence” or “control sequence”, as used interchangeably herein, refers to a nucleic acid sequence which is required for expression of a nucleic acid product. In some instances, this sequence may be a promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory éléments which are required for expression of the gene product. The regulatory/control sequence may, for example, be one which expresses the nucleic acid product in a regulated manner, e.g., inducible manner. [0066] The term “constitutive” promoter refers to a nucléotide sequence which, when operably linked with a polynucleotide which encodes a polypeptide, causes the polypeptide to be produced in a cell under most or ail physiological conditions of the cell. In an embodiment, the polypeptide is a polypeptide having cellobiase activity.
[0067] The term “inducible” promoter refers to a nucléotide sequence which, when operably linked with a polynucleotide which encodes a polypeptide, causes the polypeptide to be produced in a cell substantially only when an inducer which corresponds to the promoter is présent in the cell. In an embodiment, the polypeptide is a polypeptide having cellobiase activity.
[0068] The term “repressible” promoter refers to a nucléotide sequence, which when operably linked with a polynucleotide which encodes a polypeptide, causes the polypeptide to be produced in a cell substantially only until a repressor which corresponds to the promoter is présent in the cell. In an embodiment, the polypeptide is a polypeptide having cellobiase activity.
[0069] The term “solubilizing agent” référés to an agent that has the capacity for disrupting non-covalent bonds, e.g., hydrogen bonds, hydrophobie interactions, van der Waals interactions, dipole-dipole interactions, ionic interactions, pi-stacking, or any combination thereof. The disruption of the non-covalent bonds leads to the solubilization, or dissolution, of previously insoluble matter into solution. Specifically, a solubilizing agent used herein increases the ability of polypeptides having biomass-degrading activity described herein that hâve aggregated into inclusion bodies to dissolve into solution, e.g., water-based solution or a buffer. Examples of suitable solubilizing agents are described herein.
[0070] The term “xylanase” as used herein, refers to enzymes that hydrolyze xylancontaining material. Xylan is polysaccharide comprising units of xylose. A xylanase can be an endoxylanase, a beta-xylosidase, an arabinofuranosidase, an alpha-glucuronidase, an acetylxylan esterase, a feruloyl esterase, or an alpha-glucuronyl esterase.
[0071] The term “xylanase activity” as used herein, refers to the activity of enzymes that catalyze the endohydrolysis of 1,4-btea-D-xylosidic linkages in xylans and xylan-like polymers. Xylanase activity can be determined according to the assays described herein. One unit of xylanase activity will release 1 μΜ of xylose équivalent from xylan per minute.
Description [0072] High level of expression of recombinant proteins in host cells such as E. coli often leads to accumulation of the recombinant proteins into inactive, misfolded and insoluble aggregates within the host cell. These insoluble aggregates are called inclusion bodies and can also contain other components endogenous to the host cell, such as protein, ribosomal components, nucleic acids, and cellular débris. As much as 70-80% of proteins produced by recombinant techniques can form inclusion bodies, thereby significantly reducing the yield of active recombinant protein that can be readily isolated from the host cells.
[0073] Solubilization of the recombinant proteins from the inclusion bodies can be achieved through treatment with chaotropic agents, e.g., high concentrations of urea, which disrupt hydrogen bonds and hydrophobie interactions. However, such solubilization processes often resuit in dénaturation of the protein and loss of native function or enzymatic activity. The soluble denatured proteins can be refolded to their native state after removal of chaotropic agents, however, refolding of recombinant proteins into bioactive forms with enzymatic activity can be cumbersome, costly, and resuit in low recovery of the final product. [0074] The présent invention is based, at least in part, on the surprising discovery that a heterologously expressed cellobiase that has been solubilized from inclusion bodies by urea retains cellobiase activity. The recovery of heterologously expressed cellobiase from the inclusion bodies increased the total yield of cellobiase by 30-40%. Furthermore, the presence of the solubilizing agent, e.g., urea, from the addition of the solubilized biomass-degrading enzyme, e.g., cellobiase, does not adversely affect the saccharification reaction for converting biomass to a sugar product and/or the yield of products.
[0075] Accordingly, the présent invention provides methods for solubilizing a polypeptide having biomass-degrading activity from inclusion bodies, where the resulting solubilized polypeptide retains biomass-degrading activity, whereby the additional processing steps of refolding the polypeptide and removing the solubilizing agent is not required. The présent invention provides methods for increasing the recovery of heterologously-expressed biomassdegrading enzymes from inclusion bodies, while retaining enzymatic activity, and use of the recovered biomass-degrading enzymes in methods for converting a biomass into products, e.g., by saccharification.
Polypeptides Having Biomass-Degrading Activity [0076] The présent disclosure provides a polypeptide, a plurality of polypeptides, having a biomass-degrading activity. In embodiments, the polypeptide having biomass-degrading activity, or plurality thereof, is présent in a mixture with one or more solubilizing agent. Some mixtures may also contain one or more proteins associated with an inclusion body. In other embodiments, the mixture does not contain one or more proteins associated with the inclusion body, e.g., the polypeptide or plurality thereof having biomass-degrading activity was purified from one or more proteins associated with the inclusion body.
[0077] For example, the polypeptide has cellobiase activity, ligninase activity, endoglucanase activity, cellobiohydrolase activity, or xylanase activity.
[0078] In an embodiment, the polypeptide is a cellobiase. A cellobiase is an enzyme that hydrolyzes beta-1,4 bonds in its substrate, e.g., cellobiose, to release two glucose molécules. Cellobiose is a water soluble 1,4-linked dimer of glucose. In an embodiment, the polypeptide is Cel3a. Cel3a (also known as Bgll) is a cellobiase that was identified in Trichoderma reesei. The amino acid sequence for Cel3a (GenBank Accession No. NW_006711153) is provided below : MGDSHSTSGASAEAVVPPAGTPWGTAYDKAKAALAKLNLQDKVGIVSGVGWNGGPC VGNTSPASKISYPSLCLQDGPLGVRYSTGSTAFTPGVQAASTWDVNLIRERGQFIGEEV KASGIHVILGPVAGPLGKTPQGGRNWEGFGVDPYLTGIAMGQTINGIQSVGVQATAKH YILNEQELNRETISSNPDDRTLHELYTWPFADAVQANVASVMCSYNKVNTTWACEDQ YTLQTVLKDQLGFPGYVMTDWNAQHTTVQSANSGLDMSMPGTDFNGNNRLWGPAL
TNAVNSNQVPTSRVDDMVTRILAAWYLTGQDQAGYPSFNISRNVQGNHKTNVRAIAR DGIVLLKNDANILPLKKPASIAWGSAAIIGNHARNSPSCNDKGCDDGALGMGWGSGA VNYPYFVAPYDAINTRASSQGTQVTLSNTDNTSSGASAARGKDVAIVFITADSGEGYIT VEGNAGDRNNLDPWHNGNALVQAVAGANSNVIVWHSVGAIILEQILALPQVKAW WAGLPSQESGNALVDVLWGDVSPSGKLVYTIAKSPNDYNTRIVSGGSDSFSEGLFIDY KHFDDANITPRYEFGYGLSYTKFNYSRLSVLSTAKSGPATGAWPGGPSDLFQNVATV TVDIANSGQVTGAEVAQLYITYPSSAPRTPPKQLRGFAKLNLTPGQSGTATFNIRRRDL SYWDTASQKWVVPSGSFGISVGASSRDIRLTSTLSVAGSGS (SEQ ID NO: 1) [0079] In an embodiment, the polypeptide is a ligninase. A ligninase is an enzyme that breaks down lignin, which is a complex polymer of aromatic alcohols known as monolignols and plays an intégral part of the secondary cell walls of plants and some algae. Ligninases include lignin peroxidases, l,2-bis(3,4-dimethoxyphenyl)propane-l,3-diol:hydrogen-peroxide oxidoreductase, diarylpropane oxygenase, ligninase I, diarylpropane peroxidase, LiP, hydrogen-peroxide oxidoreductase (C-C-bond-cleaving), and some laccases. Examples of ligninases include CIP2 from Trichoderma reesei-, LPOA, GLG2, GLG4, LIP A, GLG5, GLG3, GLG6, and LIPB from Phanerochaete chrysosporium’, ligninase-3 from Phelbia radiate-, Ligninase A and B from Coriolus versicolor; and LPG I and LPGIV Coriolus versicolor. [0080] In an embodiment, the polypeptide is an endoglucanase. An endoglucanase is an enzyme that catalyzes the hydrolysis of cellulose. Specifically, the endoglucanases cleave the internai bonds of the cellulose chain. Endoglucanases are produced by fungi, bacteria, and protozoans. Endoglucanases are also known as beta-1-4 endoglucanase, 4-beta-D-glucan cellobiohydrolase, exo-cellobiohydrolase, beta-l,4-glucan cellobiohydrolase, beta-l,4-glucan cellobiosylhydrolase, 1,4-beta-glucan cellobiosidase, exoglucanase, avicelase, CBH 1, Cl cellulase, cellobiohydrolase I, cellobiohydrolase, exo-beta-l,4-glucan cellobiohydrolase, 1,4beta-D-glucan cellobiohydrolase, or cellobiosidase. Examples of endoglucanases include Cel5A, Cel5B, Cel7B, Cell2A, Cel45A, CelôlA, CelôlB, and Cel74Afrom Trichoderma reesei.
[0081] In an embodiment, the polypeptide is a cellobiohydrolase, also known as exoglucanase. A cellobiohydrolase catalyzes the hydrolysis of 1-4-beta-D-glucosidic linkages in oligosaccharides containing that linkage, e.g., cellulose and cellotetraose, thereby releasing cellobiose from the non-reducing ends of the chains. Examples of cellobiohydrolases include cellobiohydrolase I (CBHI) and cellobiohydrolase II (CBHII) from Trichoderma reesei.
[0082] In an embodiment, the polypeptide is a xylanase. Xylanases are also known as endo-(l-4)-beta-xylan4-xylanohydrolase, endo-l,4-xylanase, endo-l,4-beta-xylanase, beta-1,4xylanase, endo-l,4-beta-D-xylanase, 1,4-beta-xylan xylanohydrolase, beta-xylanase, beta-1,4xylan xylanohydrolase, beta-D-xylanase. A xylanase breaks down a component of plant cell walls called hemicellulose, e.g., dégradés polysaccharides, such as xylan, e.g., beta-l,4-xylan, glucuronoxylan, arabinoxylan, glucomannan, and xyloglucan, to release xylose. Examples of xylanases include Xynl, Xyn2, and Xyn3 from Trichoderma reesei; and TERTU_1599, TERTU_3603, TERTU_2546, and TERTU_4506 from Terendinibacter turnerae T7901. [0083] The présent disclosure also provides functional variants of a polypeptide having biomass-degrading activity described herein. In an embodiment, a functional variant has an amino acid sequence with at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to a biomass-degrading enzyme described herein, or a functional fragment thereof, e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to a biomass-degrading enzyme described herein, or a functional fragment thereof.
[0084] In an embodiment, a functional variant has an amino acid sequence with at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91% identity, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to Cel3a produced by T. reesei or SEQ ID NO: 1, or a functional fragment thereof.
[0085] Percent identity in the context of two or more amino acid or nucleic acid sequences, refers to two or more sequences that are the same. Two sequences are substantially identical if two sequences hâve a specified percentage of amino acid residues or nucléotides that are the same (e.g., 60% identity, optionally 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity over a specified région, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated région as measured using one of the following sequence comparison algorithms or by manual alignaient and visual inspection. Optionally, the identity exists over a région that is at least about 50 nucléotides, 100 nucléotides, 150 nucléotides, in length. More preferably, the identity exists over a région that is at least about 200 or more amino acids, or at least about 500 or 1000 or more nucléotides, in length.
[0086] For sequence comparison, one sequence typically acts as a reference sequence, to which one or more test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculâtes the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch, (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman, (1988) Proc. Nat’l. Acad. Sci. USA 85:2444, by computerized implémentations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection (see, e.g., Brent et al., (2003) Current Protocols in Molecular Biology).
[0087] Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., (1977) Nue. Acids Res. 25:3389-3402; and Altschul et al., (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
[0088] Functional variants may comprise one or more mutations, such that the variant retains biomass-degrading activity that is better than the biomass-degrading activity of a biomass-degrading enzyme described herein produced by the microorganism from which the enzyme originates from. In an embodiment, the functional variant has at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, or at least 99%) of the biomass-degrading activity as a biomassdegrading enzyme as produced by E. coli. In embodiments, the functional variant has at least 200%, at least 300%, at least 400%, at least 500%, at least 1000% or more of the biomass degrading activity as a biomass-degrading enzyme produced by E. coli or the microorganism from which the enzyme originates from. Biomass-degrading activity can be tested using the functional assays described herein. In one embodiment, the functional variant retains cellobiase activity that is better than the cellobiase activity of Cel3a as produced by T. reesei. In another embodiment, the functional variant has at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, or at least 99%) of the cellobiase activity as a Cel3a or enzyme comprising SEQ ID NO:1 as produced by E. coli. In embodiments, the functional variant has increased biomassdegrading activity compared to a biomass-degrading enzyme described herein, e.g., at least 200%, at least 300%, at least 400%, at least 500%, at least 1000% or more of the biomassdegrading activity of a biomass-degrading enzyme described herein, e.g., cellobiase activity as a Cel3a or enzyme comprising SEQ ID NO: 1 produced by E. coli or the microorganism from which the enzyme originates from.
[0089] The mutations présent in a functional variant include amino acid substitutions, additions, and délétions. Mutations can be introduced by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. The mutation may be a conservative amino acid substitution, in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains hâve been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, méthionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, one or more amino acid residues within the polypeptide having cellobiase activity of the disclosure can be replaced with other amino acids from the same side chain family, and the résultant polypeptide retains cellobiase activity comparable (e.g., at least 80%, 85%, 90%, 95%, or 99% ofthe cellobiase activity) to that of the wild-type polypeptide. Alternatively, the mutation may be an amino acid substitution in which an amino acid residue is replaced with an amino acid residue having a different side chain.
[0090] Such mutations may alter or affect various enzymatic characteristics of the biomassdegrading enzyme, e.g., cellobiase, ligninase, endoglucanase, or cellobiohydrolase. For example, such mutations may alter or affect the biomass-degrading activity, thermostability, optimal pH for reaction, enzyme kinetics, or substrate récognition of the biomass-degrading enzyme. In some embodiments, a mutation increases the biomass-degrading activity of the variant in comparison to the biomass-degrading enzyme, e.g., cellobiase produced by T. reesei and/or SEQ ID NO: 1 produced in E.coli. In some embodiments, a mutation increases or decreases the thermostability of the variant in comparison to a wild-type biomass degrading enzyme, e.g., a cellobiase and/or SEQ ID NO:1 produced in E.coli. In an embodiment, a mutation changes the pH range at which the variant optimally performs the biomass-degrading reaction in comparison to wild-type biomass-degrading enzyme, e.g., wild-type cellobiase and/or SEQ ID NO: 1 produced in E.coli. In an embodiment, a mutation increases or decreases the kinetics of the biomass-degrading reaction (e.g., kcat, Km or Ko) in comparison to wild-type biomass-degrading enzyme, e.g., wild-type cellobiase and/or SEQ ID NO:1 produced in E.coli. In an embodiment, a mutation increases or decreases the ability of the cellobiase to recognize or bind to the substrate (e.g., cellobiose) in comparison to wild-type cellobiase and/or SEQ ID NO:1 produced in E.coli.
[0091] The présent invention also provides functional fragments of a polypeptide having biomass-degrading activity, e.g., cellobiase activity, as described herein, e.g., CeI3a or SEQ ID NO: 1. One of ordinary skill in the art could readily envision that a fragment of a polypeptide having biomass-degrading activity as described herein that contains the functional domains responsible for enzymatic activity would retain functional activity, e.g., biomass-degrading activity, and therefore, such fragments are encompassed in the présent invention. In an embodiment, the functional fragment is at least 700 amino acids, at least 650 amino acids, at least 600 amino acids, at least 550 amino acids, at least 500 amino acids, at least 450 amino acids, at least 400 amino acids, at least 350 amino acids, at least 300 amino acids, at least 250 amino acids, at least 200 amino acids, at least 150 amino acids, at least 100 amino acids, or at least 50 amino acids in length. In an embodiment, the functional fragment is 700 to744 amino acids, 650 to 699 amino acids, 600 to 649 amino acids, 550 to 599 amino acids, 500 to 549 amino acids, 450 to 499 amino acids, 400 to 449 amino acids, 350 to 399 amino acids, 300 to 349 amino acids, 250 to 299 amino acids, 200 to 249 amino acids, 150 to 199 amino acids, 100 to 149 amino acids, or 50 to 99 amino acids. With regard to the ranges of amino acid length described above, the lowest and highest values of amino acid length are included within each disclosed range. In an embodiment, the functional fragment has at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% of the biomass-degrading activity as a wild-type biomass-degrading enzyme described herein, or the biomass-degrading enyzme produced in E.coli. In an embodiment, the functional fragment has at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% of the cellobiase activity as wild-type Cel3a or the polypeptide comprising SEQ ID NO: 1 produced in E.coli.
[0092] Assays for detecting cellobiase activity are known in the art. For example, détection of the amount of glucose released from cellobiose can be determined by incubating purified cellobiase with substrate, e.g., cellobiose, D-(+)-cellobiose, and detecting the résultant amount of free glucose after completion of the reaction. The amount of free glucose can be determined using a variety of methods known in the art. For example, dilutions of purified cellobiase are prepared in a buffer containing 50mM sodium citrate, pH 5.0 NaOH. The cellobiose substrate is added to the purified cellobiase in an amount such that the final concentration of cellobiose in the reaction mixture is 30mM. The reaction mixture is incubated under conditions suitable for the reaction to occur, e.g., in a shaker (700 ipm) at 48°C for 30 minutes. To stop the reaction, the reaction mixture is heated for 5 minutes at 100°C. The reaction mixture is filtered through a 0.45pm filter and the filtrate is analyzed to quantify the amount of glucose and/or cellobiase. A YSI instrument that measures analytes such as glucose can be used to détermine the concentration of glucose produced from the reaction. Altematively, UPLC (Ultra Performance Liquid Chromatography) can be used to détermine the concentration of glucose and cellobiose from the reaction. This assay can be formatted in a single reaction or in multiple reaction formats, e.g., 96 well format. In some embodiments, the multiple reaction format may be preferred to generate an activity curve representing cellobiase activity with respect to different concentrations of the purified cellobiase. The concentration of the purified cellobiase can be determined using a standard Bradford assay. Dilutions of the purified cellobiase assay are prepared, e.g., 2-fold dilutions, and are aliquoted into a 96 well plate, e.g., 12 wells of 2fold dilutions. Cellobiose substrate is added as previously described, such that the final concentration of cellobiase in the reaction is 30mM. The plate is sealed and treated under conditions suffîcient for the cellobiase reaction to occur, and then under conditions to stop the reaction. The reaction is then filtered through a 96 well format 0.45 pm membrane (e.g., Durapore) and analyzed by YSI and/or HPLC methods, e.g., UPLC.
[0093] This activity assay can also be used to détermine the concentration, or titer, of a cellobiase in a sample with unknown concentration by generating a standard curve of activity of known concentrations of the cellobiase to extrapolate the concentration for the unknown concentration sample. For example, two-fold serial dilutions of a known concentration of the cellobiase are prepared in one row of a 96 well plate, e.g., 12 two-fold serial dilutions. The other rows contain two-fold serial dilutions of other remaining samples whose titer is to be determined, e.g., the crude lysate sample or solubilized inclusion body sample. The dilutions are incubated with a D-(+)-Cellobiose (Fluka) substrate solution in 50mM sodium citrate monobasic buffer at pH 5.0, at 48°C for 30 minutes. After 30 minutes, the samples are heated to 100°C for 10 minutes to stop the reaction. Samples are analyzed for glucose and cellobiose using the YSI Biochemistry analyser (YSI Life Sciences) and/or HPLC methods. Using the samples of known concentration, a standard curve is generated using the data points within the linear range of the assay. The cellobiase activity detected from the samples with unknown titer can be compared to the standard curve to détermine the titer of cellobiase in these sample. [0094] Units of activity are only relative if calculated using values within the linear range of the assay. The linear range of the assay is defined as using glucose values that are less than 30% of the original soluble substrate load. In addition, glucose values lower than 0.05g/L are omitted due to instrumentation reporting levels. One unit of cellobiase activity is defined as the amount of glucose per the amount of Cel3a per 30 minutes: [Glucose]g/L / [Cel3a]g/L / 30min. [0095] In other embodiments, a colorimetric/fluorometric assay can be used. The purified cellobiase is incubated with substrate cellobiose under conditions for the reaction to occur. Détection of the product glucose is as follows. Glucose oxidase is added to the mixture, which oxidizes glucose (the product) to gluconic acid and hydrogen peroxide. Peroxidase and odianisidine is then added. O-dianisidine reacts with the hydrogen peroxide in the presence of peroxidase to form a colored product. Sulfuric acid is added, which reacts with the oxidized odianisidine reacts to form a more stable colored product. The intensity of the color when measured, e.g., by spectrophotometer or colorimeter, e.g., at 540nm, is directly proportional to the glucose concentration. Such colorimetric/fluorometric glucose assays are commercially available, for example from Sigma Aldrich, Catalog No. GAGO-20.
[0096] Assays for detecting ligninase activity are known in the art. Ligninase activity can be measured by determining the rate of oxidation of veratryl alcohol to veratrylaldehyde (abbreviated as VAO foi' veratryl alcohol oxidation). Reaction mixtures are prepared, and contain dilutions of enzyme, 2 mM veratryl alcohol, 0.4 mM H2O2 and either 20 or 100 mM sodium tartrate, pH 2.9 in a final volume of 0.5 ml. The reactions were started by H2O2 addition and were monitored by spectrophotometry at 310 nm. Protein was deteimined according to Bradford, M.M., (1976) Anal. Biochem. 72:248-254, using bovine sérum albumin (Sigma Chemical Co., St. Louis, MO) as standard or by using the 409 nm absorbance of a protein solution and calculating protein amount from the extinction coefficient of ligninase.
[0097] Assays for detecting endoglucanase activity are known in the art. For example, endoglucanase activity can be determined by measuring the hydrolysis of substrate carboxymethyl cellulose (CMC) and quantifying the concentration of reducing end by BCA method, in which the total concentration of reducing ends is exhibited by a color change of the sample solution in proportion to the concentration of the reducing ends. First, the polypeptide having biomass-degrading activity is diluted in a 50mM citrate buffer at pH 4.8. CMC solution (0.05% w/v CMC in the sodium citrate buffer) is added to a reaction tube and equilibrated at 50 C. The diluted enzyme samples are added to the reaction and incubated at 50C for 10 minutes.
BCA reagents are added and incubated at 75C for 30 minutes. The absorbance is read at 560nm after subtracting the readings for the enzyme blanks and the substrate blank. Enyzme 20 activity can be calculated based on a linear range between reducing end concentration and enzyme concentrations. Other endoglucanase activity assays are known in the art, for example, by determining a réduction in substrate viscosity (Zhang et al., Biotechnol Adv, 2006, 24:452481).
[0098] Assays for detecting cellobiohydrolase activity are known in the art.
Cellobiohydrolase activity can be determined by measuring soluble subrate released from substrate Avicel in a phenol-sulfuric assay. An Avicel solution (1.25% w/v in acetate buffer) is aliquoted into reaction tubes, and dilutions of the enzyme is prepared. Both substrate and enzyme solutions are equilibrated at 50C. The diluted enzyme solutions are added to the substrate and incubated for a time sufficient for the reaction to occur, e.g., at 50C for 2 hours.
The reactions are stopped by submerging the samples into an ice cold water bath. The samples are centrifuged to separate the samples into a soluble and insoluble fraction. The total concentration of soluble sugars in the soluble fraction is determined by phenol-sulfuric assay.
Specifically, an aliquot ofthe soluble fraction is mixed with 5% phénol, and concentrated sulfuric acid is added. The reaction is cooled to room température (about 20-30 minutes), and absorbance of the samples are read at 490 nm. The enzyme activity is calculated on the basis of a linear relationship between total soluble sugar release and the enzyme dilution. Other cellobiohydrolase activity assays are described in Zhang et al., Biofuels: Methods and Protocols, Vol. 581, pages 213-231.
[0099] Assays for detecting xylanase activity are known in the art. Xylanase activity can be detennined by measuring the level of xylose released from a xylan substrate by a colorimétrie assay. Xylan substrate is prepared as a 1.0% w/v solution in 50mM sodium acetate buffer, pH 4.5. Dilutions of the enzyme of prepared. Xylan and the enzyme dilutions are mixed, and incubated under conditions sufficient for the reaction to occur, e.g., 30C for 10 minutes. Then a solution containing 16mM copper sulfate, 1.3M sodium sulfate, 226 mM sodium carbonate, 190 mM sodium bicarbonate, and 43 mM sodium potassium tartrate is added to the reaction. The reaction is then boiled for 10 minutes, and allowed to cool to room température. A solution containing 40mM molybdic acid, 19mM arsenic acid, and 756 mM sulfuric acid is added. The reaction is shaken or vortexed until the foaming stops and any preceiptate présent is dissolved. The reaction is centrifuged to clarify, then the solutions are ready by spectrophotometer at 540nM, and enzyme activity is calculated on the basis of a linear relationship between total soluble sugar release and the enzyme dilution.
Aglycosylated Polypeptides [00100] Any of the polypeptides having biomass-degrading activity described herein, e.g., cellobiase activity, can be glycosylated or aglycosylated. An aglycosylated polypeptide having biomass-degrading activity may be solubilized from an inclusion body, as described herein. Altematively, an aglycosylated polypeptide having biomass-degrading activity may be added to a mixture comprising a polypeptide having biomass-degrading activity that has been solubilized from an inclusion body, in which the polypeptide that was solubilized from an inclusion body can be glycosylated or aglycosylated.
[00101] Glycosylation is the enzymatic process by which a carbohydrate is attached to a glycosyl acceptor, e.g., the nitrogen of arginine or asparginine side chains or the hydroxyl oxygen of serine, threonine, or tyrosine side chains. There are two types of glycosylation: Nlinked and O-linked glycosylation. N-linked glycosylation occurs at consensus site Asn-XSer/Thr, wherein the X can be any amino acid except a proline. O-linked glycosylation occurs at Ser/Thr residues. Glycosylation sites can be predicted using various algorithme known in the art, such as Prosite, publicly available by the Swiss Institute of Bioinformatics, andNetNGlyc 1.0 or NetOGlyc 4.0, publicly available by the Center for Biological Sequence Analysis.
[00102] The présent invention provides methods for producing an aglycosylated polypeptide having biomass-degrading activity. In one embodiment, the nucleic acid encoding the polypeptide has been altered or mutated such that the polypeptide cannot be glycosylated, e.g., one or more glycosylation sites are mutated such that a glycan cannot be attached to the glycosylation site. For example, an aglycosylated polypeptide having biomass-degrading activity encoded by a nucleic acid sequence described herein contains one or more mutations at one or more glycosylation sites hâve been mutated such that a glycan can no longer be attached or linked to the glycosylation site. In another example, the polypeptide having biomassdegrading activity encoded by a nucleic acid sequence described herein contains one or more mutations proximal to one or more glycosylation sites that hâve been mutated such that a glycan can no longer be attached or linked to the glycosylation site. For example, the mutation proximal to a glycosylation site mutâtes the consensus motif recognized by the glycosylating enzyme, or changes the conformation of the polypeptide such that the polypeptide cannot be glycosylated, e.g., the glycoslation site is hidden or steric hindrance due to the new conformation prevents the glycosylating enzymes from accessing the glycosylation site. A mutation proximal to a glycosylation site in the polypeptide having biomass-degrading activity is directly adjacent to, or at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 30 or at least 40 amino acids from the glycosylation site that, as a resuit of the proximal mutation, will not be glycosylated. [00103] In an embodiment, one or more of the following glycosylation sites of a cellobiase, e.g., Cel3a, or SEQ ID NO: 1, are mutated: the threonine at amino acid position 78, the threonine at amino acid position 241, the serine at amino acid position 343, the serine at amino acid position 450, the threonine at amino acid position 599, the serine at amino acid position 616, the threonine at amino acid position 691, the serine at amino acid position 21, the threonine at amino acid position 24, the serine at amino acid position 25, the serine at amino acid position 28, the threonine at amino acid position 38, the threonine at amino acid position
42, the threonine at amino acid position 303, the serine at amino acid position at 398, the serine at amino acid position 435, the serine at amino acid position 436, the threonine at amino acid position 439, the threonine at amino acid position 442, the threonine at amino acid position
446, the serine at amino acid position 451, the serine at amino acid position 619, the serine at amino acid position 622, the threonine at amino acid position 623, the serine at amino acid position 626, or the threonine at amino acid position 630, or any combination thereof. In embodiments, the glycosylation site is mutated from a serine or threonine to an alanine. For example, the aglycosylated polypeptide described herein has one or more of the following mutations: T78A, T241A, S343A, S450A, T599A, S616A, T691A, S21A, T24A, S25A, S28A, T38A, T42A, T303A, T398A, S435A, S436A, T439A, T442A, T446A, S451A, S619A, S622A, T623A, S626A, or T630A, or any combination thereof. Altematively, one or more amino acids proximal to the glycosylation sites described above are mutated.
[00104] Assays to detect whether a polypeptide is modified by a glycan (e.g., whether the polypeptide is glycosylated or aglycosylated) are known in the art. The polypeptide can be purified or isolated and can be stained for détection and quantification of glycan moieties, or the polypeptide can be analyzed by mass spectrometry, and compared to a corresponding reference polypeptide. The reference polypeptide has the same primary sequence as the test polypeptide (of which the glycosylation state is to be determined), but is either glycosylated or aglycosylated.
[00105] The aglycosylated polypeptides described herein may hâve increased biomassdegrading activity, e.g., cellobiase activity, compared to a corresponding glycosylated polypeptide, e.g., glycosylated Cel3a polypeptide. For example, the aglycosylated polypeptide having biomass-degrading activity, e.g., cellobiase activity, has at least 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90% , 100%, or 200% biomass-degrading activity, e.g., cellobiase activity, compared to the glycosylated polypeptide.
Nucleic Acids, Expression Vectors and Host Cells [00106] A polypeptide having biomass-degrading activity as described herein is expressed in host cells. In one embodiment, an expression vector comprising a nucleic acid sequence encoding any of the polypeptides described herein having biomass-degrading activity is introduced into a host cell, and the host cell is cultured under conditions appropriate for expression of the polypeptide having biomass-degrading activity. In embodiments, the expression of the polypeptide having biomass-degrading activity is at a level such that inclusion bodies, or aggregates comprising the polypeptide having biomass-degrading activity, are formed. Also described herein are methods for expressing and isolating the soluble polypeptide having biomass-degrading activity expressed in the host cell. Methods for solubiziling and isolating the polypeptide having biomass-degrading activity from the inclusion bodies is described further in the section titled “Solubilization from Inclusion Bodies”.
[00107] The présent invention also provides a nucleic acid sequence encoding a polypeptide having biomass-degrading activity. In an embodiment, the nucleic acid sequence encodes a ligninase, an endoglucanase, a cellobiohydrolase, a xylanase, or a cellobiase described herein. The nucleic acid sequence encoding a polypeptide having biomass-degrading activity can be codon-optimized for increased expression in host cells. Codon optimization includes changing 10 the nucleic acid sequence to take into considération factors including codon usage bias, cryptic splicing sites, mRNA secondary structure, prématuré polyA sites, interaction of codon and anticodon, and RNA instability motifs, to increase expression of the encoded polypeptide in the host. Various algorithms and commercial services for codon-optimization are known and available in the art.
[00108] In an embodiment, the nucleic acid sequence encodes a Cel3a enzyme from T.
reesei with the amino acid sequence described herein, e.g., SEQ ID NO: 1. In an embodiment, the nucleic acid sequence that encodes Cel3a is provided below:
ATGCGTTACCGAACAGCAGCTGCGCTGGCACTTGCCACTGGGCCCTTTGCTAGGGCAGACAGTCACTCAACATCGG
GGGCCTCGGCTGAGGCAGTTGTACCTCCTGCAGGGACTCCATGGGGAACCGCGTACGACAAGGCGAAGGCCGCATT GGCAAAGCTCAATCTCCAAGATAAGGTCGGCATCGTGAGCGGTGTCGGCTGGAACGGCGGTCCTTGCGTTGGAAAC ACATCTCCGGCCTCCAAGATCAGCTATCCATCGCTATGCCTTCAAGACGGACCCCTCGGTGTTCGATACTCGACAG GCAGCACAGCCTTTACGCCGGGCGTTCAAGCGGCCTCGACGTGGGATGTCAATTTGATCCGCGAACGTGGACAGTT CATCGGTGAGGAGGTGAAGGCCTCGGGGATTCATGTCATACTTGGTCCTGTGGCTGGGCCGCTGGGAAAGACTCCG
CAGGGCGGTCGCAACTGGGAGGGCTTCGGTGTCGATCCATATCTCACGGGCATTGCCATGGGTCAAACCATCAACG GCATCCAGTCGGTAGGCGTGCAGGCGACAGCGAAGCACTATATCCTCAACGAGCAGGAGCTCAATCGAGAAACCAT TTCGAGCAACCCAGATGACCGAACTCTCCATGAGCTGTATACTTGGCCATTTGCCGACGCGGTTCAGGCCAATGTC GCTTCTGTCATGTGCTCGTACAACAAGGTCAATACCACCTGGGCCTGCGAGGATCAGTACACGCTGCAGACTGTGC TGAAAGACCAGCTGGGGTTCCCAGGCTATGTCATGACGGACTGGAACGCACAGCACACGACTGTCCAAAGCGCGAA
TTCTGGGCTTGACATGTCAATGCCTGGCACAGACTTCAACGGTAACAATCGGCTCTGGGGTCCAGCTCTCACCAAT GCGGTAAATAGCAATCAGGTCCCCACGAGCAGAGTCGACGATATGGTGACTCGTATCCTCGCCGCATGGTACTTGA CAGGCCAGGACCAGGCAGGCTATCCGTCGTTCAACATCAGCAGAAATGTTCAAGGAAACCACAAGACCAATGTCAG GGCAATTGCCAGGGACGGCATCGTTCTGCTCAAGAATGACGCCAACATCCTGCCGCTCAAGAAGCCCGCTAGCATT GCCGTCGTTGGATCTGCCGCAATCATTGGTAACCACGCCAGAAACTCGCCCTCGTGCAACGACAAAGGCTGCGACG
ACGGGGCCTTGGGCATGGGTTGGGGTTCCGGCGCCGTCAACTATCCGTACTTCGTCGCGCCCTACGATGCCATCAA TACCAGAGCGTCTTCGCAGGGCACCCAGGTTACCTTGAGCAACACCGACAACACGTCCTCAGGCGCATCTGCAGCA AGAGGAAAGGACGTCGCCATCGTCTTCATCACCGCCGACTCGGGTGAAGGCTACATCACCGTGGAGGGCAACGCGG GCGATCGCAACAACCTGGATCCGTGGCACAACGGCAATGCCCTGGTCCAGGCGGTGGCCGGTGCCAACAGCAACGT CATTGTTGTTGTCCACTCCGTTGGCGCCATCATTCTGGAGCAGATTCTTGCTCTTCCGCAGGTCAAGGCCGTTGTC
TGGGCGGGTCTTCCTTCTCAGGAGAGCGGCAATGCGCTCGTCGACGTGCTGTGGGGAGATGTCAGCCCTTCTGGCA AGCTGGTGTACACCATTGCGAAGAGCCCCAATGACTATAACACTCGCATCGTTTCCGGCGGCAGTGACAGCTTCAG CGAGGGACTGTTCATCGACTATAAGCACTTCGACGACGCCAATATCACGCCGCGGTACGAGTTCGGCTATGGACTG TCTTACACCAAGTTCAACTACTCACGCCTCTCCGTCTTGTCGACCGCCAAGTCTGGTCCTGCGACTGGGGCCGTTG TGCCGGGAGGCCCGAGTGATCTGTTCCAGAATGTCGCGACAGTCACCGTTGACATCGCAAACTCTGGCCAAGTGAC
TGGTGCCGAGGTAGCCCAGCTGTACATCACCTACCCATCTTCAGCACCCAGGACCCCTCCGAAGCAGCTGCGAGGC
TTTGCCAAGCTGAACCTCACGCCTGGTCAGAGCGGAACAGCAACGTTCAACATCCGACGACGAGATCTCAGCTACT
GGGACACGGCTTCGCAGAAATGGGTGGTGCCGTCGGGGTCGTTTGGCATCAGCGTGGGAGCGAGCAGCCGGGATAT CAGGCTGACGAGCACTCTGTCGGTAGCG (SEQ ID NO: 2)
The codon-optimized nucleic acid sequence that encodes Cel3a is provided below:
ATGCGTTATCGTACAGCCGCAGCCCTGGCACTGGCCACAGGTCCGTTCGCACGTGCCGATAGTCACAGTACCAGCG GTGCCAGCGCAGAAGCCGTGGTTCCGCCGGCAGGCACACCGTGGGGCACAGCCTATGATAAAGCCAAAGCCGCCCT
GGCCAAGCTGAATCTGCAGGATAAAGTGGGCATCGTGAGTGGCGTGGGCTGGAACGGTGGTCCGTGCGTTGGCAAC
ACCAGCCCGGCAAGCAAGATCAGCTATCCGAGCTTATGCCTGCAGGATGGTCCGCTGGGCGTGCGCTATAGCACCG
GTAGTACCGCCTTTACACCTGGTGTGCAGGCCGCCAGTACCTGGGACGTTAACCTGATCCGCGAACGTGGCCAATT
TATCGGCGAAGAAGTTAAAGCCAGCGGCATTCATGTTATTCTGGGTCCGGTGGCCGGTCCTCTGGGTAAAACCCCG
CAGGGCGGCCGTAATTGGGAAGGCTTCGGCGTTGATCCGTATTTAACCGGCATCGCAATGGGCCAGACCATTAATG
GCATCCAGAGCGTGGGTGTTCAAGCCACCGCCAAACACTACATATTAAACGAACAGGAACTGAATCGTGAAACCAT
CAGCAGCAATCCGGATGATCGCACCCTGCATGAGCTGTATACATGGCCTTTTGCCGACGCAGTTCAGGCCAACGTG
GCAAGTGTGATGTGTAGCTATAACAAGGTGAACACCACCTGGGCCTGCGAAGACCAGTACACCCTGCAGACCGTTT
TAAAAGACCAACTGGGCTTCCCTGGTTACGTGATGACAGATTGGAATGCCCAGCACACAACCGTTCAGAGCGCAAA
CAGTGGCCTGGATATGAGCATGCCGGGCACCGACTTCAACGGCAATAATCGTCTGTGGGGTCCGGCACTGACCAAT
GCCGTTAACAGCAACCAGGTGCCGACCAGTCGTGTGGACGATATGGTTACCCGTATTCTGGCCGCCTGGTACCTGA
CAGGTCAAGACCAGGCCGGCTACCCGAGCTTCAACATCAGCCGCAACGTGCAGGGTAATCACAAGACCAACGTTCG
CGCAATCGCACGCGATGGTATCGTGCTGTTAAAGAACGATGCCAACATTCTGCCGCTGAAAAAACCGGCCAGCATC GCCGTTGTTGGTAGCGCAGCCATCATTGGCAACCACGCCCGTAACAGTCCGAGCTGCAATGATAAAGGCTGTGACG
ACGGTGCCCTGGGCATGGGTTGGGGTAGTGGTGCCGTGAACTACCCGTATTTCGTGGCCCCGTACGACGCCATTAA
CACCCGTGCAAGTAGCCAGGGTACCCAGGTTACCCTGAGCAACACCGACAACACAAGCAGCGGTGCCAGTGCAGCA
CGTGGTAAGGATGTGGCCATCGTGTTCATCACCGCCGACAGCGGCGAAGGCTACATTACCGTGGAGGGTAATGCCG
GTGATCGCAATAATCTGGACCCGTGGCATAACGGCAACGCCCTGGTTCAGGCAGTGGCAGGCGCAAATAGCAACGT
GATCGTTGTGGTGCATAGCGTGGGTGCCATCATTCTGGAGCAGATCCTGGCCCTGCCGCAAGTTAAGGCAGTTGTG TGGGCAGGTCTGCCGAGCCAAGAAAGTGGCAATGCCCTGGTGGACGTTCTGTGGGGCGATGTTAGTCCGAGCGGCA
AGCTGGTGTATACAATCGCCAAGAGCCCGAACGACTATAACACCCGCATCGTTAGCGGCGGCAGTGATAGCTTCAG
CGAGGGCCTGTTTATCGACTACAAGCATTTCGATGATGCCAATATTACCCCGCGCTACGAATTTGGTTATGGCCTG AGCTATACCAAGTTCAACTACAGCCGCCTGAGCGTTTTAAGTACCGCCAAGAGTGGTCCGGCAACAGGTGCCGTGG
TTCCTGGTGGTCCGAGTGATCTGTTTCAGAATGTGGCCACCGTGACCGTGGATATCGCCAACAGTGGTCAGGTTAC
CGGCGCCGAAGTGGCACAGCTGTACATCACCTATCCGAGCAGTGCACCGCGCACCCCGCCGAAACAGCTGCGTGGC
TTCGCCAAATTAAACCTGACCCCGGGCCAGAGCGGTACAGCAACCTTCAATATTCGCCGCCGTGATCTGAGCTATT GGGACACCGCCAGCCAAAAATGGGTGGTGCCGAGCGGCAGCTTTGGCATTAGTGTGGGTGCAAGTAGCCGCGACAT
TCGCTTAACAAGCACCCTGAGTGTTGCC (SEQ ID NO: 3) [00109] In an embodiment, the nucleic acid sequence encoding a Cel3a enzyme or functional variant thereof comprises at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO: 2. In an embodiment, the nucleic acid sequence encoding a Cel3a enzyme or functional variant thereof comprises at least 50%, at least 55%, at least 60%, at least
65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least
92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO:2 or SEQ ID NO: 3.
[00110] Also provided herein is a nucleic acid sequence encoding an aglycosylated polypeptide having biomass-degrading activity described herein, e.g., Cel3a polypeptide, in which one or more glycoslyation sites présent in the polypeptide has been mutated such that a glycan can no longer be attached or linked to the glycosylation site. In another embodiment, the nucleic acid sequence described herein encoding an aglycosylated polypeptide, e.g., a Cel3a polypeptide, as described above, in which one or more mutations proximal to one or more glycosylation sites présent in the polypeptide has been mutated such that a glycan can no longer be attached or linked to the glycosylation site, as previously described.
[00111] The techniques used to isolate or clone a nucleic acid sequence encoding a polypeptide are known in the art and include isolation from genomic DNA, préparation from cDNA, or a combination thereof. The cloning of the nucleic acid sequences of the présent invention from such genomic DNA can be effected, e.g., by using the well known polymerase chain reaction (PCR) or antibody screening of expression libraries to detect cloned DNA fragments with shared structural features. See, e.g., Innis et al., 1990, PCR: A Guide to Methods and Application, Academie Press, New York. Other amplification procedures such as ligase chain reaction (LCR), ligated activated transcription (LAT) and nucléotide sequencebased amplification (NASBA) may be used. The nucleic acid sequence may be cloned from a strain of Trichoderma reeseï, e.g., wild-type T. reeseï, or T. reeseï RUTC30, or another or related organism and thus, for example, may be an allelic or species variant of the polypeptide encoding région of the nucleic acid sequence.
[00112] The nucleic acid sequence may be obtained by standard cloning procedures used in genetic engineering to relocate the nucleic acid sequence from its natural location to a different site where it will be reproduced. The cloning procedures may involve excision and isolation of a desired fragment comprising the nucléotide sequence encoding the polypeptide, insertion of the fragment into a vector molécule, and incorporation of the recombinant vector into a host cell where multiple copies or clones of the nucléotide sequence will be replicated. The nucléotide sequence may be of genomic, cDNA, RNA, semisynthetic, synthetic origin, or any combinations thereof.
[00113] As used herein, an “expression vector” is a nucleic acid construct for introducing and expressing a nucleic acid sequence of interest into a host cell. In some embodiments, the vector comprises a suitable control sequence operably linked to and capable of effecting the expression of the polypeptide encoded by the nucleic acid sequence described herein. The control sequence may be an appropriate promoter sequence, recognized by a host cell for expression of the nucleic acid sequence. In an embodiment, the nucleic acid sequence of interest is a nucleic acid sequence encoding a polypeptide having biomass-degrading activity, e.g., cellobiase activity, as described herein.
[00114] A promoter in the expression vector of described herein can include promoters obtained from genes encoding extracellular or intracellular polypeptides either homologous or heterologous to the host cell, mutant promoters, truncated promoters, and hybrid promoters. [00115] Examples of suitable promoters for directing transcription of the nucleic acid constructs of the présent invention in a bacterial host cell are the promoters obtained from the E. coli lac operon, E. coli tac promoter (hybrid promoter, DeBoer et al, PNAS, 1983, 80:2125), E. coli rec A, E. coli araBAD, E. coli tetA, and prokaryotic beta-lactamase. Other examples of suitable promoters include viral promoters, such as promoters from bactériophages, including a T7 promoter, a T5 promoter, a T3 promoter, an M13 promoter, and a SP6 promoter. In some embodiments, more than one promoter controls the expression of the nucleic acid sequence of interest, e.g., an E. coli lac promoter and a T7 promoter. Further promoters that may be suitable for use in the présent invention are described in “Useful proteins from recombinant bacteria” in Scientifîc American, 1980, 242:74-94, and Sambrook et al., Molecular Cloning: A Laboratory Manual, 1989. In some preferred embodiments, the promoter is inducible, where the addition of a molécule stimulâtes the transcription and expression of the downstream reading frame.
[00116] Examples of suitable promoters for directing transcription of the nucleic acid constructs of the présent invention in a eukaryotic host cell, e.g., in a fungal or yeast cell are promoters obtained from the genes of Trichoderma Reesei, methanol-inducible alcohol oxidase (AOX promoter), Aspergillus nidulans tryptophan biosynthesis (trpC promoter), Aspergillus nigervar. awamori flucoamylase (glaA), Saccharomyces cerevisiae galactokinase (GAL1), or Kluyveromyces lactis Plac4-PBI promoter.
[00117] A control sequence présent in the expression vector described herein may also be a signal sequence that codes for an amino acid sequence Iinked to the amino terminus of a polypeptide and directs the encoded polypeptide into the cell’s secretory pathway, e.g., a sécrétion signal sequence. The signal sequence may be an endogenous signal sequence, e.g., where the signal sequence is présent at the N-terminus of the wild-type polypeptide when endogenously expressed by the organism from which the polypeptide of interest originates from. The signal sequence may be a foreign, or heterologous, signal peptide, in which the signal sequence is from a different organism or a different polypeptide than that of the polypeptide of interest being expressed. Any signal sequence which directs the expressed polypeptide into the secretory pathway of a host cell may be used in the présent invention. Typically, signal sequences are composed of between 6 and 136 basic and/or hycrophobic amino acids.
[00118] Examples of signal sequences suitable for the présent invention include the signal sequence from Saccharomyces cerevisiae alpha-factor.
[00119] Fusion tags may also be used in the expression vector described herein to facilitate the détection and purification of the expressed polypeptide. Examples of suitable fusion tags include His-tag (e.g., 3xHis, 6x His (SEQ ID NO: 22), or 8xHis (SEQ ID NO: 21)), GST-tag, HSV-tag, S-tag, T7 tag. Other suitable fusion tags include myc tag, hemagglutinin (HA) tag, and fluorescent protein tags (e.g., green fluorescent protein). The fusion tag is typically operably linked to the N or C terminus of the polypeptide to be expressed. In some embodiments, there may be a linker région between the fusion tag sequence and the N-terminus or C-terminus of the polypeptide to be expressed. In an embodiment, the linker région comprises a sequence between 1 to 20 amino acids, that does not affect or alter the expression or function of the expressed polypeptide.
[00120] Utilization of the fusion tags described herein allows détection of the expressed protein, e.g., by western blot by using antibodies that specifically recognize the tag. The tags also allows for purification of the expressed polypeptide from the host cell, e.g., by affinity chromatography. For example, an expressed polypeptide fused to a His-tag can be purified by using nickel affinity chromatography. The His tag has affinity for the Nickel ions, and a nickel column will retain the his-tagged polypeptide, while allowing ail other proteins and cell débris to flow through the column. Elution of the His-tagged polypeptide using an elution buffer, e.g., containing imidazole, releases the His-tagged polypeptide from the column, resulting in substantially purified polypeptide.
[00121] The expression vector described herein may further comprise a selectable marker gene to enable isolation of a genetically modified microbe transformed with the construct as is commonly known to those of skill in the art. The selectable marker gene may confer résistance to an antibiotic or the ability to grow on medium lacking a spécifie nutrient to the host organism that otherwise could not grow under these conditions. The présent invention is not limited by the choice of selectable marker gene, and one of skill in the art may readily détermine an appropriate gene. For example, the selectable marker gene may confer résistance to ampicillin, chloramphenicol, tétracycline, kanamycin, hygromycin, phleomycin, geneticin, or G418, or may complément a deficiency of the host microbe in one of the trp, arg, leu, pyr4, pyr, ura3, ura5, his, or ade genes or may confer the ability to grow on acetamide as a sole nitrogen source.
[00122] The expression vector described herein may further comprise other nucleic acid sequences, e.g., additional control sequences, as is commonly known to those of skill in the art, for example, transcriptional terminators, synthetic sequences to link the various other nucleic acid sequences together, origins of réplication, ribosome binding sites, a multiple cloning site (or polylinker site), a polyadenylation signal and the like. The ribosomal binding site suitable for the expression vector dépends on the host cell used, for example, for expression in a prokaryotic host cell, a prokaryotic RBS, e.g., a T7 phage RBS can be used. A multiple cloning site, or polylinker site, contains one or more restriction enzyme sites that are preferably 15 not présent in the remaining sequence of the expression vector. The restriction enzyme sites are utilized for the insertion of a nucleic acid sequence encoding a polypeptide having cellobiase activity or other desired control sequences. The practice of the présent invention is not limited by the presence of any one or more of these other nucleic acid sequences, e.g., other control sequences.
[00123] Examples of suitable expression vectors for use in the présent invention include vectors for expression in prokaryotes, e.g., bacterial expression vectors. A bacterial expression vector suitable for use in the présent invention in the pET vector (Novagen), which contains the following: a viral T7 promoter which is spécifie to only T7 RNA polymerase (not bacterial RNA polymerase) and also does not occur anywhere in the prokaryotic genome, a lac operator comprising a lac promoter and coding sequence for the lac repressor protein (lac! gene), a polylinker, an fl origin of réplication (so that a single-stranded plasmid can be produced when co-infected with M13 helper phage), an ampicillin résistance gene, and a ColEl origin of réplication (Blaber, 1998). Both the promoter and the lac operator are located 5’, or upstream, of the polylinker in which the nucleic acid sequence encoding a polypeptide described herein is inserted. The lac operator confers inducible expression of the nucleic acid sequence encoding a polypeptide having cellobiase activity. Addition of IPTG (Isopropyl β-D-lthiogalactopyranoside), a lactose métabolite, triggers transcription of the lac operon and induces protein expression of the nucleic acid sequence under control of the lac operator. Use of this system requires the addition of T7 RNA polymerase to the host cell for vector expression. The T7 RNA polymerase can be introduced via a second expression vector, or a host cell strain that is genetically engineered to express T7 RNA polymerase can be used. [00124] An exemplary expression vector for use with the invention is a pET vector, commercially available from Novagen. The pET expression system is described in U.S. Patent Nos. 4,952,496; 5,693,489; and 5,869,320. In one embodiment, the pET vector is a pETDUET vector, e.g., pET-Duetl, commercially available from Novagen. Other vectors suitable for use in the présent invention include vectors containing His-tag sequences, such as those described in U.S. Patent Nos. 5,310,663 and 5,284,933; and European Patent No. 282042. [00125] The présent invention also relates to a host cell comprising the nucleic acid sequence or expression vector of the invention, which are used in the recombinant production of the polypeptides having biomass-degrading activity.
[00126] An expression vector comprising a nucleic acid sequence of the présent invention is introduced into a host cell so that the vector is maintained (e.g., by chromosomal intégration or as a self-replicating extra-chromosomal vector) such that the polypeptide is expressed.
[00127] The host cell may be a prokaryote or a eukaryote. The host cell may be a bacteria, such as an K coli strain, e.g., K12 strains NovaBlue, NovaBlue TIR, JM109, and DH5a. Preferably, the bacteria cell has the capability to fold, or partially fold, exogenously expressed proteins, such as E. coli Origami strains, e.g., Origami B, Origami B (DE3), Origami 2, and Origami 2(DE3) strains. In some embodiments, it may be preferred to use a host cell that is déficient for glycosylation, or has an impaired glycosylation pathway such that proteins expressed by the host cell are not significantly glycosylated.
[00128] The host cell may be a yeast or a filamentous fungus, particularly those classified as Ascomycota. Généra of yeasts useful as host microbes for the expression of modified TrCel3A beta-glucosidases of the présent invention include Saccharomyces, Pichia, Hansenula, Kluyveromyces, Yarrowia, and Arxula. Généra of fungi useful as microbes for the expression of the polypeptides of the présent invention include Trichoderma, Hypocrea, Aspergillus, Fusarium, Humicola, Neurospora, Chrysosporium, Myceliophthora, Thielavia, Sporotrichum and Pénicillium. For example, the host cell may be Pichiapastoris. For example, the host cell may be an industrial strain of Trichoderma reesei,or a mutant thereof, e.g., T. reesei RUTC30.
Typically, the host cell is one which does not express a parental biomass-degrading enzyme, e.g., cellobiase or Cel3a.
[00129] The sélection of the particular host cell, e.g., bacterial cell or a fungal cell, dépends on the expression vector (e.g., the control sequences) and/or the method utilized for producing an aglycosylated polypeptide of the invention, as described in further detail below.
[00130] The expression vector of the invention may be introduced into the host cell by any number of methods known by one skilled in the art of microbial transformation, including but not limited to, transformation, treatment of cells with CaCL, electroporation, biolistic bombardment, lipofection, and PEG-mediated fùsion of protoplasts (e.g. White et al., WO 2005/093072, which is incorporated herein by reference). After selecting the recombinant host cells containing the expression vector (e.g., by sélection utilizing the selectable marker of the expression vector), the recombinant host cells may be cultured under conditions that induce the expression of the polypeptide having biomass-degrading activity of the invention.
[00131] Methods for recovering the soluble polypeptides having biomass-degrading activity expressed from prokaryote and eukaryote cells are known in the art. In embodiments, the method for recovering the polypeptide comprises collecting the cells, e.g., by centrifugation or filtration, and lysing the cells, e.g., by mechanical, chemical, or enzymatic means. For example, cells can be physically broken apart, e.g., by sonication, milling (shaking with beads), or shear forces. Cell membranes can be treated such that they are permeabilized such that the contents of the cells are released, such as treatment with détergents, e.g., Triton, NP-40, or SDS. Cells with cell walls, e.g., bacterial cells, can be permeabilized using enzymes, such as a lysozyme or lysonase. Any combination of the mechanical, chemical, and enzymatic techniques described above are also suitable for recovering expressed polypeptides of interest from the host cell in the context of this invention. For example, when expressing a polypeptide having biomass-degrading activity described herein in a bacterial cell, e.g., an E. coli cell, the cell is typically collected by centrifuging and pelleting the cell culture, and lysed by resuspending the cell pellet in a lysis buffer containing lysozyme. To ensure complété lysis, the resuspended cells are subjected to one of the following methods: sonication, milling, or homogenization. After centrifugation, the soluble polypeptides having biomass-degrading activity are présent in the supernatant, while the insoluble polypeptides having biomassdegrading activity, e.g., in inclusion bodies, are found in the pellet. Methods for recovering the insoluble polypeptides having biomass-degrading activity, e.g., from inclusion bodies, are described further below in the section titled “Solubilization from Inclusion Bodies”.
[00132] The soluble polypeptides having biomass-degrading activity can then be purified or isolated from the cell lysate using standard methods known in the art. For polypeptides having biomass-degrading activity comprising a tag, e.g., a His tag, affinity chromatography can be used to separate the soluble polypeptides from the remainder of the soluble fraction of the lysate.
[00133] In one embodiment, the host cell expressing a polypeptide having biomassdegrading activity described herein is not lysed before addition to the biomass for the saccharification reaction. In some instances, the methods for lysing host cells and extracting the polypeptides having biomass-degrading activity can resuit in protein dénaturation and/or decreased enzyme activity, which leads to increased cost of downstream processing. Thus, the présent invention also provides methods for directly adding the host cells expressing an aglycosylated polypeptide having biomass-degrading activity described herein to the biomass prior to the saccharification step.
[00134] In an embodiment, the host cell, e.g., the E. coli cell, expressing a polypeptide having biomass-degrading activity described herein is isolated, e.g., by centrifugation, and added to the saccharification reaction, e.g., the saccharification reactor containing biomass. The cells are lysed by a combination of shear from the biomass, the impellers, and the increased température. In an embodiment, the culture of host cell, e.g., the E. coli cell, expressing the polypeptide having biomass-degrading activity described herein is added directly from the fermentation tank directly to the saccharification tank and eliminating the need to pellet cells by centrifugation. In an embodiment, the polypeptide is glycosylated or aglycosylated.
Solubilization from Inclusion Bodies [00135] In embodiments, a cell, e.g., a microorganism disclosed herein, has been genetically modified using methods described herein to produce at least one polypeptide having a biomassdegrading activity. At least a portion, e.g., at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90%, of the polypeptide having biomass-degrading activity is found in inclusion bodies in the genetically modified cell. Disclosed herein are methods for solubilizing the at least one polypeptide having biomass-degrading activity from the inclusion bodies.
[00136] Inclusion bodies are insoluble aggregates in host cells comprising heterologously expressed proteins, e.g., a polypeptide having a biomass-degrading activity, when expressed at high levels. Inclusion bodies can be found in the nucléus or the cytoplasm. Inclusion bodies can also contain other components, such as other proteins endogenous to the host cell, e.g., host proteins, ribosomal components, nucleic acids (e.g., RNA and/or DNA), and cellular débris (e.g., cell wall débris, lipids, métabolites). Proteins endogenous to the host cell includes any protein that is encoded by genomic DNA of the host cell. The protein endogenous to the host cell may be localized to the cytoplasm, or may interact with the heterologously expressed protein. Examples of ribosomal components that can be found in an inclusion body include ribosomes, fragments of ribosomal subunits (e.g., 50S subunit or 30S subunit), partially translated polypeptides, transfer RNA, élongation factors, and/or messenger RNA. Examples of nucleic acids that can be found in an inclusion body include genomic DNA of the host, exogenous DNA (e.g., from a plasmid or expression vector introduced into the host cell), messenger RNA, transfer RNA, ribosomal RNA, or any fragments thereof. Examples of cellular débris that can be found in an inclusion body include cell wall or membrane débris (e.g., fragments or components of the cell wall or membrane), nuclear membrane débris (e.g., fragments or components of the nuclear membrane), fragments or components of other host organelles, endotoxins, lipids, and/or métabolites.
[00137] Additional methods for reducing aggregation of inclusion bodies include sonication, incubation at varying températures, acid/base treatment, protease treatment, electrical treatment, mechanical treatment, and addition of organisms that produce proteases. For example, the cells or lysâtes thereof containing inclusion bodies are incubated at températures ranging from -20°C to 0°C, 0°C to 4 °C, 4°C to 20°C, 20°C to 40°C, and 40°C to 80°C.
[00138] To isolate the inclusion bodies, the host cell expressing a polypeptide having biomass-degrading activity is first lysed, using standard methods in the art, such as lysis by lysozyme or other denaturing agents, ultrasound treatment, sonication, or high pressure homogenization. The host cells are lysed under conditions that do not lead to solubilization of 30 an inclusion body. Inclusion bodies are isolated from the host cell using techniques known in the art. For example, the cell lysate is separated such that the inclusion bodies containing polypeptides having biomass-degrading activity and other insoluble matter are présent in an insoluble fraction, while the soluble fraction contains the soluble polypeptides having biomassdegrading activity. Such séparation can be accomplished through centrifugation, whereby the inclusion bodies are found in the pellet, e.g., the insoluble fraction, and the soluble polypeptides are found in the supematant, e.g., the soluble fraction. Other methods suitable for séparation of an insoluble fraction from the soluble fraction include filtration.
[00139] Solubilization of the inclusion bodies to release a polypeptide having biomassdegrading activity comprises adding a solubilizing agent to the insoluble fraction or inclusion bodies. In some embodiments a solubilizing agent can be an agent that prevents protein aggregation or précipitation, or dissolves protein aggregates. In some embodiments, the solubilizing agent includes an agent that disrupts van der Waals interactions, hydrophobie interactions, hydrogen bonding, dipole-dipole interactions, ionic interactions, pi stacking, or any combination thereof.
[00140] In some embodiments, the solubilizing agent can be an agent that disrupts hydrophobie interactions, e.g., such as a detergent. Exemplary détergents include nonionic, zwitterionic, anionic and cationic détergents. In some embodiments, the solubilizing agent can be nonionic, e.g., NP-40 and Triton X-100. In some embodiments, the solubilizing agent can be zwitterionic, e.g., CHAPS and sulfobetaines, e.g., SB3-10 or ASB 14. In some embodiments, the protein agent can be anionic, e.g., sodium dodecyl sulfate (SDS).
[00141] In some embodiments, the solubilizing agent can be an agent that reduces disulfïde bonds, e.g., a thiol reducing agent. Exemplary thiol reducing agents include 2-mercaptoethanol βΜΕ and dithiothreitol (DTT). In some embodiments, the solubilizing agent that reduces disulfïde bonds can be a phosphine, e.g., tributylphosphine (TBP) or triscarboxyethylphosphine (TCEP).
[00142] In some embodiments, the solubilizing agent can be an agent that disrupts hydrogen bonding and hydrophobie interactions. In some embodiments, the solubilizing agent can be a chaotropic compound, e.g., urea and substituted ureas (e.g., thiourea), and guanidinium hydrochloride.
[00143] In some embodiments, the solubilizing agent can be an agent that is a nonpolar solvent. Nonpolar solvents contain bonds between atoms with similar electronegativities, such as carbon and hydrogen, and hâve very low dielectric constants. For example, nonpolar solvents hâve a dielectric constant of less than 5. Examples of nonplar solvents include pentane, hexane, cyclohexane, benzene, toluene, chloroform, diethyl ether.
[00144] In some embodiments, the solubilizing agent can be an agent that is a polar solvent. Polar solvents are characterized by having large dipole moments (or “partial charges”); they contain bonds between atoms with very different electronegativities, such as oxygen and hydrogen. In one embodiment, the polar solvents suitable for use in the invention herein hâve a dielectric constant of at least 5, or at least 20. In a preferred embodiment, the polar solvents hâve a high dielectric constant, e.g., a dielectric constant greater than 25. In some embodiments, the solubilizing agent is a protic polar solvent, which has O-H orN-H bonds, hâve high dielectric constants, e.g., greater than 20, greater than 25, and are good hydrogen bond donors, e.g., formic acid, n-butanol, isopropanol, n-propanol, éthanol, methanol, or nitromethane. In some embodiments, the solubilizing agent can be an aprotic polar solvent, which lack O-H or N-H bonds, and has a dielectric constant between 5 and 20, e.g., dimethylsulfoxide (DMSO), dichloromethane (DCM), tetrahydrofuran (THF), ethyl acetate, acetone, dimethylformamide (DMF), or acetonitrile (MeCN).
[00145] In some embodiments, the solubilizing agent can be an agent that has a positive charge, which may be suitable for disrupting ionic interactions of a net negatively charged molécule. Exemplary positively charged solubilizing agents include N-methyl D-glucamine, choline, arginine, lysine, procaine, tromethamine (TRIS), spermine, N-methyl-morpholine, glucosamine, Ν,Ν-bis 2-hydroxyethyl glycine, diazabicycloundecene, creatine, arginine ethyl ester, amantadine, rimantadine, omithine, taurine, and citrulline. Cationic moieties may additionally include sodium, potassium, calcium, magnésium, ammonium, monoethanolamine, diethanolamine, triethanolamine, tromethamine, lysine, histidine, arginine, morpholine, methylglucamine, and glucosamine.
[00146] In some embodiments, the solubilizing agent can be an agent that has a négative charge, which may be suitable for disrupting ionic interactions of a net positively charged molécule. Exemplary negatively charged solubilizing agents include acetate, propionate, butyrate, pentanoate, hexanoate, heptanoate, levulinate, chloride, bromide, iodide, citrate, succinate, maleate, glycolate gluconate, glucuronate, 3-hydroxyisobutyrate, 2hydroxyisobutyrate, lactate, malate, pyruvate, fumarate, tartarate, tartronate, nitrate, phosphate, benzene sulfonate, methane sulfonate, sulfate, sulfonate, acetic acid, adamantoic acid, alpha keto glutaric acid, D- or L-aspartic acid, benzensulfonic acid, benzoic acid, 10-camphorsulfunic acid, citric acid, 1,2-ethanedisulfonic acid, fumaric acid, D-gluconic acid, D-glucuronic acid, glucaric acid, D- or L-glutamic acid, glutaric acid, glycolic acid, hippuric acid, hydrobromic acid, hydrochloric acid, l-hydroxyl-2-napthoic acid, lactobioinic acid, maleic acid, L-malic acid, mandelic acid, methanesulfonic acid, mucic acid, 1,5 napthalenedisulfonic acid tetrahydrate, 2-napthalenesulfonic acid, nitric acid, oleic acid, pamoic acid, phosphoric acid, ptoluenesulfonic acid hydrate, D-saccharid acid monopotassium sait, salicyclic acid, stearic acid, succinic acid, sulfuric acid, tannic acid, and D- or L-tartaric acid.
[00147] The solubilizing agent is added to an inclusion body, or a fraction containing inclusion bodies, at a sufficient concentration to solubilize a polypeptide having biomass degrading activity from the inclusion body, for example, at a concentration of about 0.01-10M, about 0.05-10M, about 0.1-10M, about 0.2-10M, about 0.5-10M, about 1-10M, about 2-10M, about 5-10M, about 8-10M, about 0.01-6M, about 0.05-6M, about 0.1-6M, about 0.2-6M, about 0.5-6M, about 1-6M, about 2-6M, about 4-6M, or about 5-6M. In an embodiment, the solubilizing agent is added to an inclusion body, or a fraction containing inclusion bodies, at a concentration of about 0.01M, about 0.02M, about 0.05M, about 0.1M, about 0.2M, about 0.5M, about IM, about 2M, about 3M, about 4M, about 5M, about 6M, about 7M, about 8M, about 9M, or about 10M.
[00148] In a preferred embodiment, the solubilizing agent is urea, and is added to an inclusion body, or a fraction containing inclusion bodies, at a concentration of about 0.01-10M, about 0.05-10M, about 0.1-10M, about 0.2-10M, about 0.5-10M, about 1-10M, about 2-10M, about 5-10M, about 8-10M, about 0.01-6M, about 0.05-6M, about 0.1-6M, about 0.2-6M, about 0.5-6M, about 1-6M, about 2-6M, about 4-6M, or about 5-6M. In an embodiment, urea is added to an inclusion body, or a fraction containing inclusion bodies, at a concentration of about 0.01M, about 0.02M, about 0.05M, about 0.1M, about 0.2M, about 0.5M, about IM, about 2M, about 3M, about 4M, about 5M, about 6M, about 7M, about 8M, about 9M, or about 10M. In a preferred embodiment, the urea is added to an inclusion body, or a fraction containing inclusion bodies, at a concentration of 6M.
[00149] After solubilization using a solubilizing agent, the resulting mixture contains a solubilized polypeptide having biomass-degrading activity, as described herein. The resulting mixture can be used directly in an enzymatic processes, such as a reaction for producing products, e.g., a saccharification reaction, as described in further detail in the section titled “Methods of Producing Products Using Solubilized Enzymes”. In this embodiment, the mixture may contain other components of the inclusion body, such as other proteins endogenous to the host cell, ribosomal components, nucleic acids (e.g., RNA and/or DNA), and cellular débris (e.g., cell wall débris, lipids, métabolites).
[00150] In other embodiments, the resulting mixture containing a solubilized polypeptide having biomass-degrading activity is further processed to purify or isolate the solubilized polypeptide having biomass-degrading activity from the other solubilized components of the inclusion bodies. Suitable methods for isolating or purifying the solubilized polypeptide having biomass-degrading activity include affinity purification techniques. For example, the polypeptide having biomass-degrading activity preferably contains a tag or fusion peptide that can be utilized for affinity purification. In an embodiment, the polypeptide having biomassdegrading activity contains a His-tag, e.g., an 8X His tag (SEQ ID NO: 21), and the solubilized polypeptide having biomass-degrading activity can be purified using nickel affinity chromatography, e.g., an immobilized métal ion affinity chromatography (IMAC) system. In one embodiment, ail purification steps occur in the presence of the solubilizing agent used to solubilize the polypeptide from an inclusion body, including in the washing and elution steps of the purification process. Accordingly, in one embodiment, the resulting purified solubilized polypeptide having biomass-degrading activity also contains a solubilizing agent.
[00151] The présent invention provides a mixture comprising a polypeptide having biomassdegrading activity and a solubilizing agent. The mixture is obtained through the solubilization of inclusion bodies, as described above. The resulting mixture may also further comprise one or more proteins associated with the inclusion bodies. The solubilized polypeptide having biomass-degrading activity may also be purified by affinity purification techniques. In this case, the resulting mixture does not comprise one or more proteins associated with the inclusion bodies. The mixture can comprise other components found in inclusion bodies, such as other proteins endogenous to the host cell, ribosomal components, nucleic acids (e.g., RNA and/or DNA), and cellular débris (e.g., cell wall débris, lipids, métabolites).
[00152] In an embodiment, the solubilized polypeptide having biomass-degrading activity can be partially unfolded, partially misfolded, or partially denatured. In an embodiment, the solubilized polypeptide having biomass-degrading activity has at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, at least 10%, at least 8-10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% biomass-degrading activity compared to the native polypeptide having biomass-degrading activity. In an embodiment, the solubilized polypeptide having biomass-degrading activity has about 1-10%, 1-20%, 1-30%, 140%, 1-50%, 1-60%, 1-70%, 1-80%, 1-90%, 1-100%, 10-20%, 10-30%, 10-40%, 10-50%, 1060%, 10-70%, 10-80%, 10-90%, 10-100%, 20-30%, 20-40%, 20-50%, 20-60%, 20-70%, 2080%, 20-90%, 20-100%, 30-40%, 30-50%, 30-60%, 30-70%, 30-80%, 30-90%, 30-100%, 4050%, 40-60%, 40-70%, 40-80%, 40-90%, 40-100%, 50-60%, 50-70%, 50-80%, 50-90%, 50100%, 60-70%, 60-80%, 60-90%, 60-100%, 70-80%, 70-90%, 70-100%, 80-90%, 80-100%, or 90-100% of the biomass-degrading activity compared to the native polypeptide having biomass-degrading activity. In a preferred embodiment, the solubilized polypeptide having biomass-degrading activity has at least 8-10% of the activity of the native polypeptide. The native polypeptide having biomass-degrading activity refers to, e.g., the corresponding polypeptide having biomass-degrading activity isolated from the soluble fraction, the corresponding polypeptide having biomass-degrading activity that is properly folded in its native form (thereby having 100% biomass-degrading activity), or the corresponding polypeptide having biomass-degrading activity endogenously expressed from the microorganism from which the polypeptide originates from. Biomass-degrading activity can be determined by any ofthe assays described herein, e.g., a ligninase activity assay, an endoglucanase activity assay, a cellobiohydrolase activity assay, a cellobiase activity assay, or a xylanase activity assay.
[00153] In one aspect, the mixture comprises a polypeptide having cellobiase activity, e.g., a Cel3a or a functional variant thereof from T. reesei, e.g., a polypeptide with at least 90% identity to SEQ ID NO: 1, and a solubilizing agent, e.g., urea. In one embodiment, the mixture comprises a polypeptide having at least 90% identity to SEQ ID NO: 1 and a solubilizing agent, e.g., urea, wherein the polypeptide has at least 20% of the cellobiase activity compared to the native polypeptide, e.g., SEQ ID NO: 1 or Cel3a from T. reesei. The mixture is obtained through the solubilization of inclusion bodies, as described above. The resulting mixture may also further comprise one or more proteins associated with the inclusion bodies. The solubilized polypeptide having cellobiase activity, e.g., a polypeptide with at least 90% identity to SEQ ID NO: 1, may also be purified by affinity purification techniques. In this case, the resulting mixture does not comprise one or more proteins associated with the inclusion bodies. The mixture can comprise other components found in inclusion bodies, such as other proteins endogenous to the host cell, ribosomal components, nucleic acids (e.g., RNA and/or DNA), and cellular débris (e.g., cell wall débris, lipids, métabolites). In an embodiment, the solubilizing agent is urea, and the urea is présent at 0.2-6M.
[00154] In an embodiment, the solubilized polypeptide having cellobiase activity, or at least 90% identity with SEQ ID NO: 1, can be partially unfolded, partially misfolded, or partially denatured. In an embodiment, the solubilized polypeptide having cellobiase activity, or at least 90% identity with SEQ ID NO: 1, has at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, at least 10%, at least 8-10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% cellobiase activity compared to the native polypeptide. In an embodiment, the solubilized polypeptide having cellobiase activity, or at least 90% identity with SEQ ID NO: 1, has about 1-10%, 1-20%, 1-30%, 1-40%, 1-50%, 160%, 1-70%, 1-80%, 1-90%, 1-100%, 10-20%, 10-30%, 10-40%, 10-50%, 10-60%, 10-70%, 10-80%, 10-90%, 10-100%, 20-30%, 20-40%, 20-50%, 20-60%, 20-70%, 20-80%, 20-90%, 20-100%, 30-40%, 30-50%, 30-60%, 30-70%, 30-80%, 30-90%, 30-100%, 40-50%, 40-60%, 40-70%, 40-80%, 40-90%, 40-100%, 50-60%, 50-70%, 50-80%, 50-90%, 50-100%, 60-70%, 60-80%, 60-90%, 60-100%, 70-80%, 70-90%, 70-100%, 80-90%, 80-100%, or 90-100% ofthe cellobiase activity compared to the native polypeptide. The native polypeptide is, for example, SEQ JD NO: 1 that is properly folded (e.g., 100% folded), Cel3a that is isolated from T. reesei, or a functional variant thereof. Cellobiase activity can be measured using the assays described herein, and can be quantified as the concentration of glucose (g/L) released after 30 minutes or the % of cellobiose converted to glucose in 30 minutes.
Methods for Producing Aglycosylated Polypeptides [00155] The présent invention further provides methods for producing an aglycosylated polypeptide having biomass-degrading activity in a host cell, wherein the host cell, or lysate thereof, is treated with a solubilizing agent at a concentration suitable for solubilizing the aglycosylated polypeptide, as described herein. The method comprises culturing the host cell expressing the polypeptide having biomass-degrading activity under conditions suitable for the expression of the polypeptide. The method may also comprise recovering the aglycosylated polypeptide having biomass-degrading activity from the host cell. In the methods described in further detail below, the polypeptide having biomass-degrading activity has, e.g., ligninase activity, endoglucanase activity, cellobiohydrolase activity, cellobiase activity, or xylanase activity. In an embodiment, the polypeptide having cellobiase activity comprises a Cel3a from T. reesei, or a functional fragment thereof. In another embodiment, the polypeptide having cellobiase activity comprises SEQ ID NO: 1.
Using a host cell déficient for glycosylation [00156] In embodiments, the expression vector comprises a nucleic acid sequence encoding a polypeptide having biomass-degrading activity described herein operably linked to a fusion tag is introduced to and expressed in a cell that does not significantly glycosylate proteins expressed in the cell, e.g., a bacterial host cell. The recombinant host cell is cultured under conditions for expression of the polypeptide, resulting in the production of an aglycosylated polypeptide having biomass-degrading activity. The aglycosylated polypeptide can be purified or isolated from the host cell using affinity chromatography methods for the fusion tag as described herein.
[00157] For example, in this embodiment, the expression vector contains a lac operator and a T7 promoter upstream of the nucleic acid sequence encoding a polypeptide having biomassdegrading activity, and the host cell has the capacity to express T7 RNA polymerase. Expression of the polypeptide having biomass-degrading activity is induced by addition of IPTG. Preferably, the host cell is an E. coli cell, preferably an E. coli Origami cell. In this embodiment, the fusion tag is a His-tag, and the purification of the expressed aglycosylated polypeptide comprises nickel affinity chromatography.
Using a host cell with the capacity for glycosylation [00158] In another embodiment, an expression vector comprising a nucleic acid sequence encoding a polypeptide comprising one or more glycosylation site mutations such that the polypeptide is not glyscosylated, as described herein, is expressed in a host cell, wherein the host cell is capable of glycosylating proteins expressed within the cell, e.g., a yeast or fungal host cell. Alternatively, the host cell is not capable of glycosylating proteins expressed within the cell, e.g., a bacterial host cell. In this embodiment, the polypeptide is operably linked to a fusion tag. The aglycosylated polypeptide can be purified or isolated from the bacterial host cell using affinity chromatography methods for the fusion tag as described herein.
[00159] In yet another embodiment, an expression vector comprising a nucleic acid sequence encoding a polypeptide having biomass-degrading activity described herein is expressed in a host cell, wherein the host cell is capable of glycosylating proteins expressed within the cell. The cells are cultured under conditions sufficient for expression and glycosylation of the polypeptide. In this embodiment, the polypeptide is operably linked to a fusion tag. The glycosylated polypeptide can be purified or isolated from the bacterial host cell using affinity chromatography methods for the fusion tag as described herein. After purification from the host cells and other endogenous host enzymes, e.g., glycosylation enzymes, the glycans of the isolated glycosylated polypeptide can be removed by incubation with deglycosylating enzymes. Deglycosylating enzymes include PNGase F, PNGase A, EndoH (endoglycosidase H), EndoS (endoglycosidase S), EndoD (endoglycosidase D), EndoF (endoglycosidase F), EndoFl (endoglycosidase Fl), or EndoF2 (endoglycosidase F2). Protein deglycosylation mixes containing enzymes sufficient for the complété removal of glycans are commercially available, e.g., from New England Biolabs. The isolated polypeptide is incubated with one or more deglycosylating enzyme under conditions sufficient for the removal of ail of the glycans from the polypeptide. Other methods are known in the art for removing glycans fforn a polypeptide, e.g., β-elimination with mild alkali or mild hydrazinolysis. Assessment of the glycosylation state of the polypeptide can be determined using methods for staining and visualization of glycans known in the art, or mass spectrometry.
[00160] In yet another embodiment, an expression vector comprising a nucleic acid sequence encoding a polypeptide having biomass-degrading activity described herein is expressed in a host cell, wherein the host cell is capable of glycosylating proteins expressed within the cell. The cells are cultured under conditions sufficient for expression of the polypeptide, but in the presence of glycosylation inhibitors. The glycosylation inhibitors are présent at a concentration and for a sufficient time such that the expressed polypeptides are aglycosylated. In this embodiment, the polypeptide is operably linked to a fusion tag. The resulting aglycosylated polypeptide can be purified or isolated from the bacterial host cell using affinity chromatography methods for the fusion tag as described herein.
[00161] Examples of suitable glycosylation inhibitors for use in this embodiment include tunicamycin, Benzyl-GalNAc (Benzyl 2-acetamido-2-deoxy-a-D-galactopyranoside), 2Fluoro-2-deoxy-D-glucose, and 5’CDP (5’ cytidylate diphosphate). In some embodiments, a combination of glycosylation inhibitors is used. Preferably, the concentration of glycosylation inhibitors used in this embodiment is sufficient to inhibit glycosylation of the polypeptide, but do not cause cytotoxicity or inhibition of protein expression of the host cell.
Methods of Converting Biomass into Products [00162] The présent invention provides methods and compositions for converting or processing a biomass into products, using an aglycosylated polypeptide having cellobiase activity, as described herein. Methods for converting a biomass to products, such as sugar products, are known in the art, for example, as described in US Patent Application 2014/0011258, the contents of which are incorporated by reference in its entirety. Briefly, a biomass is optimally pretreated, e.g., to reduce the recalcitrance, and saccharified by a saccharification process that involves incubating the treated biomass with biomass-degrading, or cellulolytic, enzymes to produce sugars (e.g., glucose and/or xylose). The sugar products can then be further processed to produce a final product, e.g., by fermentation or distillation. Final products include alcohols (e.g., éthanol, isobutanol, or n-butanol), sugar alcohols (e.g., erythritol, xylitol, or sorbitol), or organic acids (e.g., lactic acid, pyurvic acid, succinic acid). [00163] Using the processes described herein, the biomass material can be converted to one or more products, such as energy, fuels, foods and materials. Spécifie examples of products include, but are not limited to, hydrogen, sugars (e.g., glucose, xylose, arabinose, mannose, galactose, fructose, cellobiose, disacchaiides, oligosaccharides and polysaccharides), alcohols (e.g., monohydric alcohols or dihyclric alcohols, such as éthanol, n-propanol, isobutanol, secbutanol, tert-butanol or n-butanol), hydrated or hydrous alcohols (e.g., containing greater than 10%, 20%, 30% or even greater than 40% water), biodiesel, organic acids, hydrocarbons (e.g., methane, ethane, propane, isobutene, pentane, n-hexane, biodiesel, bio-gasoline and mixtures thereof), co-products (e.g., proteins, such as cellulolytic proteins (enzymes) or single cell proteins), and mixtures of any of these in any combination or relative concentration, and optionally in combination with any additives (e.g., fuel additives). Other examples include carboxylic acids, salts of a carboxylic acid, a mixture of carboxylic acids and salts of carboxylic acids and esters of carboxylic acids (e.g., methyl, ethyl and n-propyl esters), ketones (e.g., acetone), aldéhydes (e.g., acetaldehyde), alpha and beta unsaturated acids (e.g., acrylic acid) and olefins (e.g., ethylene). Other alcohols and alcohol dérivatives include propanol, propylene glycol, 1,4-butanediol, 1,3-propanediol, sugar alcohols andpolyols (e.g., glycol, glycerol, erythritol, threitol, arabitol, xylitol, ribitol, mannitol, sorbitol, galactitol, iditol, inositol, volemitol, isomalt, maltitol, lactitol, maltotriitol, maltotetraitol, and polyglycitol and other polyols), and methyl or ethyl esters of any of these alcohols. Other products include methyl acrylate, methylmethacrylate, lactic acid, citric acid, formic acid, acetic acid, propionic acid, butyric acid, succinic acid, valeric acid, caproic acid, 3-hydroxypropionic acid, palmitic acid, stearic acid, oxalic acid, malonic acid, glutaric acid, oleic acid, linoleic acid, glycolic acid, gamma-hydroxybutyric acid, and mixtures thereof, salts of any of these acids, mixtures of any of the acids and their respective salts.
Biomass [00164] The biomass to be processed using the methods described herein is a starchy material and/or a cellulosic material comprising cellulose, e.g., a lignocellulosic material. The biomass may also comprise hemicellulose and/or lignin. The biomass can comprise one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, oi' any combination thereof. An agricultural product or waste comprises material that can be cultivated, harvested, or processed for use or consumption, e.g., by humans or animais, or any intermediate, byproduct, or waste that is generated from the cultivation, harvest, or processing methods. Agricultural products or waste include, but are not limited to, sugar cane, jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, corn cobs, corn stover, corn fiber, coconut haïr, beet pulp, bagasse, soybean stover, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, or beeswing, or a combination thereof. A paper product or waste comprises material that is used to make a paper product, any paper product, or any intermediate, byproduct or waste that is generated from making or breaking down the paper product. Paper products or waste include, but are not limited to, paper, pigmented papers, loaded papers, coated papers, corrugated paper, filled papers, magazines, printed matter, printer paper, polycoated paper, cardstock, cardboard, paperboard, or paper pulp, or a combination thereof. A forestry product or waste comprises material that is produced by cultivating, harvesting, or processing of wood, or any intermediate, byproduct, or waste that is generated from the cultivation, harvest, or processing of the wood. Forestry products or waste include, but are not limited to, aspen wood, wood from any genus or species of tree, particle board, wood chips, or sawdust, or a combination thereof. A general waste includes, but is not limited to, manure, sewage, or offal, or a combination thereof.
[00165] The biomass may include, but is not limited to starchy materials, sugar cane, agricultural waste, paper, paper products, paper waste, paper pulp, pigmented papers, loaded papers, coated papers, filled papers, magazines, printed matter, printer paper, polycoated paper, card stock, cardboard, paperboard, cotton, wood, particle board, forestry wastes, sawdust, aspen wood, wood chips, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, agricultural waste, silage, canola straw, wheat straw, barley straw, oat straw, rice straw, jute, hemp, flax, bamboo, sisal, abaca, corn cobs, corn stover, soybean stover, corn fiber, alfalfa, hay, coconut hair, sugar processing residues, bagasse, beet pulp, agave bagasse, algae, seaweed, plankton manure, sewage, offal, agricultural or industrial waste, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, tara, yams, beans, favas, lentils, peas, or mixtures of any of these. In a preferred embodiment, the biomass comprises agriculture waste, such as corn cobs, e.g., corn stover. In another embodiment, the biomass comprises grasses.
[00166] In one embodiment, the biomass is treated prior to contact with the compositions described herein. For example, the biomass is treated to reduce the recalcitrance of the biomass, to reduce its bulk density, and/or increase its surface area. Suitable biomass treatment process may include, but are not limited to: bombardment with électrons, sonication, oxidation, pyrolysis, steam explosion, chemical treatment, mechanical treatment, and freeze grinding. Preferably, the treatment method is bombardment with électrons.
[00167] In some embodiments, électron bombardment is performed until the biomass receives a total dose of at least 0.5 Mrad, e.g. at least 5, 10, 20, 30, or at least 40 Mrad. In some embodiments, the treatment is performed until the biomass receives a dose a of from about 0.5 Mrad to about 150 Mrad, about 1 Mrad to about 100 Mrad, about 5 Mrad to about 75 Mrad, about 2 Mrad to about 75 Mrad, about 10 Mrad to about 50 Mrad, e.g., about 5 Mrad to about 50 Mrad, about 20 Mrad to about 40 Mrad, about 10 Mrad to about 35 Mrad, or from about 20 Mrad to about 30 Mrad. In some implémentations, a total dose of 25 to 35 Mrad is preferred, applied ideally over a couple of seconds, e.g., at 5 Mrad/pass with each pass being applied for about one second. Applying a dose of greater than 7 to 9 Mrad/pass can in some cases cause thermal dégradation of the feedstock material.
[00168] The biomass material (e.g., plant biomass, animal biomass, paper, and municipal waste biomass) can be used as feedstock to produce useful intermediates and products such as organic acids, salts of organic acids, anhydrides, esters of organic acids and fuels, e.g., fuels for internai combustion engines or feedstocks for fuel cells. Systems and processes are described herein that can use as feedstock cellulosic and/or lignocellulosic materials that are readily available, but often can be diffïcult to process, e.g., municipal waste streams and waste paper streams, such as streams that include newspaper, kraft paper, corrugated paper or mixtures of these.
[00169] In order to couvert the feedstock to a form that can be readily processed, the glucanor xylan-containing cellulose in the feedstock can be hydrolyzed to low molecular weight carbohydrates, such as sugars, by a saccharifying agent, e.g., an enzyme or acid, a process referred to as saccharification. The low molecular weight carbohydrates can then be used, for example, in an existing manufacturing plant, such as a single cell protein plant, an enzyme manufacturing plant, or a fuel plant, e.g., an éthanol manufacturing facility.
[00170] The feedstock can be hydrolyzed using an enzyme, e.g., by combining the materials and the enzyme in a solvent, e.g., in an aqueous solution. The enzymes can be made/induced according to the methods described herein.
[00171] Specifically, the enzymes can be supplied by organisms that are capable of breaking down biomass (such as the cellulose and/or the lignin portions of the biomass), or that contain or manufacture various cellulolytic enzymes (cellulases), ligninases or various small molécule biomass-degrading métabolites. These enzymes may be a complex of enzymes that act synergistically to dégradé crystalline cellulose or the lignin portions of biomass. Examples of cellulolytic enzymes include: endoglucanases, cellobiohydrolases, and cellobiases (betaglucosidases).
[00172] During saccharification a cellulosic substrate can be initially hydrolyzed by endoglucanases at random locations producing oligomeric intermediates. These intermediates are then substrates for exo-splitting glucanases such as cellobiohydrolase to produce cellobiose from the ends of the cellulose polymer. Cellobiose is a water-soluble 1,4-linked dimer of glucose. Finally, cellobiase cleaves cellobiose to yield glucose. The efficiency (e.g., time to hydrolyze and/or completeness of hydrolysis) of this process dépends on the recalcitrance of the cellulosic material.
Saccharification [00173] The reduced-recalcitrance biomass is treated with the biomass-degrading enzymes discussed above, generally by combining the reduced-recalcitrance biomass and the biomassdegrading enzymes in a fluid medium, e.g., an aqueous solution. In some cases, the feedstock is boiled, steeped, or cooked in hot water prior to saccharification, as described in U.S. Pat. App. Pub. 2012/0100577 Al by Medoff and Masterman, published on Apr. 26, 2012, the entire contents of which are incoiporated herein.
[00174] Provided herein are mixtures of enzymes that are capable of degrading the biomass, e.g., an enzyme mixture of biomass-degrading enzymes, for use in the saccharification process described herein.
[00175] The saccharification process can be partially or completely performed in a tank (e.g., a tank having a volume of at least 4000 L, 40,000 L, 500,000 L, 2,000,000 L, 4,000,000 L, or 6,000,000L or more) in a manufacturing plant, and/or can be partially or completely performed in transit, e.g., in a rail car, tanker truck, or in a supertanker or the hold of a ship. The time required for complété saccharification will dépend on the process conditions and the biomass material and enzyme used. If saccharification is performed in a manufacturing plant under controlled conditions, the cellulose may be substantially entirely converted to sugar, e.g., glucose in about 12-96 hours. If saccharification is performed partially or completely in transit, saccharification may take longer.
[00176] In a preferred embodiment, the saccharification reaction occurs at a pH optimal for the enzymatic reactions to occur, e.g., at the pH optimal for the activity of the biomassdegrading enzymes. Preferably, the pH of the saccharification reaction is at pH 4-4.5. In a preferred embodiment, the saccharification reaction occurs at a température optimal for the enzymatic reactions to occur, e.g., at the température optimal for the activity of the biomassdegrading enzymes. Preferably, the température of the saccharification reaction is at 42°C — 52°C.
[00177] It is generally preferred that the tank contents be mixed during saccharification, e.g., using jet mixing as described in International App. No. PCT/US2010/035331, filed May 18, 2010, which was published in English as WO 2010/135380 and designated the United States, the full disclosure of which is incorporated by reference herein.
[00178] The addition of surfactants can enhance the rate of saccharification. Examples of surfactants include non-ionic surfactants, such as a Tween® 20 or Tween® 80 polyethylene glycol surfactants, ionic surfactants, or amphoteric surfactants.
[00179] It is generally preferred that the concentration of the sugar solution resulting from saccharification be relatively high, e.g., greater than 5%, 7.5%, 10%, 10.5%, or greater than 40%, or greater than 50, 60, 70, or even greater than 80% by weight. Water may be removed,
e.g., by évaporation, to increase the concentration of the sugar solution. This reduces the volume to be shipped, and also inhibits microbial growth in the solution.
[00180] Alternatively, sugar solutions of lower concentrations may be used, in which case it may be désirable to add an antimicrobial additive, e.g., a broad spectrum antibiotic, in a low concentration, e.g., 50 to 150 ppm. Other suitable antibiotics include amphotericin B, ampicillin, chloramphenicol, ciprofloxacin, gentamicin, hygromycin B, kanamycin, neomycin, penicillin, puromycin, streptomycin. Antibiotics will inhibit growth of microorganisms during transport and storage, and can be used at appropriate concentrations, e.g., between 15 and 10,000 ppm by weight, e.g., between 25 and 500 ppm, or between 50 and 150 ppm. If desired, an antibiotic can be included even if the sugar concentration is relatively high. Alternatively, other additives with anti-microbial of preservative properties may be used. Preferably the antimicrobial additive(s) are food-grade.
[00181] A relatively high concentration solution can be obtained by limiting the amount of water added to the biomass material with the enzyme. The concentration can be controlled, e.g., by controlling how much saccharification takes place. For example, concentration can be increased by adding more biomass material to the solution. In order to keep the sugar that is being produced in solution, a surfactant can be added, e.g., one of those discussed above. Solubility can also be increased by increasing the température of the solution. For example, the solution can be maintained at a température of 40-50° C., 60-80° C., or even higher.
[00182] In the processes described herein, for example after saccharification, sugars (e.g., glucose and xylose) can be isolated. For example, sugars can be isolated by précipitation, crystallization, chromatography (e.g., simulated moving bed chromatography, high pressure chromatography), centrifugation, extraction, any other isolation method known in the art, and combinations thereof.
Mixtures for Use in Saccharification [00183] In an aspect, the présent invention features a mixture for use in a saccharification comprising a polypeptide having biomass-degrading activity that has been solubilized from an inclusion body, as described herein, one or more proteins associated with an inclusion body, and a solubilizing agent. In an embodiment, the mixture may contain other components of the inclusion body, such as other proteins endogenous to the host cell, ribosomal components, nucleic acids (e.g., RNA and/or DNA), and cellular débris (e.g., cell wall débris, lipids, métabolites). The polypeptide having biomass-degrading activity can be glycosylated or aglycosylated.
[00184] In one embodiment, the mixture comprises a polypeptide having cellobiase activity and urea. In an embodiment, the urea is présent at 0.2-6M. In one embodiment, the mixture comprises a Cel3a from T. reesei, or a functional variant or a fragment thereof. In one embodiment, the mixture comprises a polypeptide comprising at least 50%, 55%, 60%, 65%,
Cel3a from T. reesei. In another embodiment, the mixture comprises a polypeptide comprising at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, or 99% identity to SEQ ID NO: 1. The polypeptide having cellobiase activity can be glycosylated or aglycosylated.
[00185] In embodiments, the mixture described herein further comprises at least one additional enzyme derived from a microorganism, wherein the additional enzyme has biomass or cellulose-based material-degrading activity. For example, the additional enzyme is a ligninase, an endoglucanase, a cellobiohydrolase, a xylanase, or a cellobiase. In an embodiment, the mixture further comprises one or more ligninase, one or more endogluconase, one or more cellobiohydrolase, one or more xylanase, or one or more cellobiase. In embodiments, the additional biomass-degrading enzyme is glycosylated. In embodiments, the enzyme mixture further comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, or at least 20 or more additional biomass-degrading enzymes described herein. Typical primary amino acid sequences for several biomass-degrading enzymes are shown below.
[00186] For example, the mixture further comprises a mixture of additional biomassdegrading enzymes produced by a microorganism, e.g., a fungal cell, such as wild-type T. reesei, or a mutant thereof, e.g., T. Reesei RUTC30. In an embodiment, the additional biomassdegrading enzymes are isolated from the microorganisms. In an embodiment, the mixture comprises one or more of the following biomass-degrading enzymes: B2AF03, CIP1, CIP2, Cella, Cel3a, Cel5a, Cel6a, Cel7a, Cel7b, Cell2a, Cel45a, Cel74a, paMan5a, paMan26a, or Swollenin, or any combination thereof. The additional biomass-degrading enzymes, e.g., listed above, can be endogenously expressed and isolated from the microorganism, e.g., fungal cell, from which the enzyme originates from (listed below in Table 1). Altematively, the additional biomass-degrading enzymes, e.g., listed above, can be heterologously expressed using similar methods of expression in a host cell described herein, and isolated from the host cells. In an embodiment, the heterologously expressed additional biomass-degrading enzymes are tagged with a His tag at the C or N terminus of the enzyme and are isolated using nickel affinity chromatography techniques known in the art. For example, the additional biomass-degrading enzymes are selected from Table 1 below.
[00187] Table 1. Examples of Additional Biomass-Degrading Enzymes
Protein MW, kDa no AA’s th. pi no. Cvsteines Organism
B2AF03 87.1 800 5.94 10 Podospora anserina
CIP1 32.9 316 4.93 8 Trichoderma reesei
CIP2 48.2 460 7.0 12 Trichoderma reesei
Cell a 52.2 466 5.3 5 Trichoderma reesei
Cel3a 78.4 744 6.3 6 Trichoderma reesei
Cel5a 44.1 418 4.9 12 Trichoderma reesei
Cel6a 49.6 471 5.1 12 Trichoderma reesei
Cel7a 54.1 514 4.6 24 Trichoderma reesei
Cel7b 48.2 459 4.7 22 Trichoderma reesei
Cell2a 25.1 234 6.6 2 Trichoderma reesei
Cel45a 24.4 242 4.2 16 Trichoderma reesei
Cel74a 87.1 838 5.4 4 Trichoderma reesei
paMan5a 41.1 373 7.0 6 Podospora anserina
paMan26a 51.7 469 4.7 1 Podospora anserina
Swollenin 51.5 493 4.8 28 Trichoderma reesei
[00188] The amino acid sequences for the biomass-degrading enzymes listed in Table 1 are provided below.
[00189] B2AF03 (Podospora anserind)
MKSSVFWGASLTSAVVRAIDLPFQFYPNCVDDLLSTNQVCNTTLSPPERAAALVAALTPEEKLQNIVSK SLGAPRIGLPAYNWWSEALHGVAYAPGTQFWQGDGPFNSSTSFPMPLLMAATFDDELLEKIAEVIGIEG RAFGNAGFSGLDYWTPNVNPFKDPRWGRGSETPGEDVLLVKRYAAAMIKGLEGPVPEKERRVVATCKHY AANDFEDWNGATRHNFNAKISLQDMAEYYFMPFQQCVRDSRVGSIMCAYNAVNGVPSCASPYLLQTILR EHWNWTEHNNYITSDCEAVLDVSLNHKYAATNAEGTAISFEAGMDTSCEYEGSSDIPGAWSQGLLKEST VDRALLRLYEGIVRAGYFDGKQSLYSSLGWADVNKPSAQKLSLQAAVDGTVLLKNDGTLPLSDLLDKSR PKKVAMIGFWSDAKDKLRGGYSGTAAYLHTPAYAASQLGIPFSTASGPILHSDLASNQSWTDNAMAAAK DADYILYFGGIDTSAAGETKDRYDLDWPGAQLSLINLLTTLSKPLIVLQMGDQLDNTPLLSNPKINAIL WANWPGQDGGTAVMELVTGLKSPAGRLPVTQYPSNFTELVPMTDMALRPSAGNSQLGRTYRWYKTPVQA FGFGLHYTTFSPKFGKKFPAVIDVDEVLEGCDDKYLDTCPLPDLPVVVENRGNRTSDYVALAFVSAPGV GPGPWPIKTLGAFTRLRGVKGGEKREGGLKWNLGNLARHDEEGNTVVYPGKYEVSLDEPPKARLRFEIV RGGKGKGKVKGKGKAAQKGGVVLDRWPKPPKGQEPPAIERV (SEQ ID NO: 6) [00190] CIP1 (Trichoderma reesei)
MVRRTALLALGALSTLSMAQISDDFESGWDQTKWPISAPDCNQGGTVSLDTTVAHSGSNSMKVVGGPNG YCGHIFFGTTQVPTGDVYVRAWIRLQTALGSNHVTFIIMPDTAQGGKHLRIGGQSQVLDYNRESDDATL PDLSPNGIASTVTLPTGAFQCFEYHLGTDGTIETWLNGSLIPGMTVGPGVDNPNDAGWTRASYIPEITG VNFGWEAYSGDVNTVWFDDISIASTRVGCGPGSPGGPGSSTTGRSSTSGPTSTSRPSTTIPPPTSRTTT ATGPTQTHYGQCGGIGYSGPTVCASGTTCQVLNPYYSQCL (SEQ ID NO: 7) [00191] CIP2 (Trichoderma reesei)
MASRFFALLLLAIPIQAQSPVWGQCGGIGWSGPTTCVGGATCVSYNPYYSQCIPSTQASSSIASTTLVT SFTTTTATRTSASTPPASSTGAGGATCSALPGSITLRSNAKLNDLFTMFNGDKVTTKDKFSCRQAEMSE LIQRYELGTLPGRPSTLTASFSGNTLTINCGEAGKSISFTVTITYPSSGTAPYPAIIGYGGGSLPAPAG VAMINFNNDNIAAQVNTGSRGQGKFYDLYGSSHSAGAMTAWAWGVSRVIDALELVPGARIDTTKIGVTG CSRNGKGAMVAGAFEKRIVLTLPQESGAGGSACWRISDYLKSQGANIQTASEIIGEDPWFSTTFNSYVN QVPVLPFDHHSLAALIAPRGLFVIDNNIDWLGPQSCFGCMTAAHMAWQALGVSDHMGYSQIGAHAHCAF PSNQQSQLTAFVQKFLLGQSTNTAIFQSDFSANQSQWIDWTTPTLS (SEQ ID NO: 8) [00192] Cella (Trichoderma reesei)
MLPKDFQWGFATAAYQIEGAVDQDGRGPSIWDTFCAQPGKIADGSSGVTACDSYNRTAEDIALLKSLGA KSYRFSISWSRIIPEGGRGDAVNQAGIDHYVKFVDDLLDAGITPFITLFHWDLPEGLHQRYGGLLNRTE FPLDFENYARVMFRALPKVRNWITFNEPLCSAIPGYGSGTFAPGRQSTSEPWTVGHNILVAHGRAVKAY RDDFKPASGDGQIGIVLNGDFTYPWDAADPADKEAAERRLEFFTAWFADPIYLGDYPASMRKQLGDRLP TFTPEERALVHGSNDFYGMNHYTSNYIRHRSSPASADDTVGNVDVLFTNKQGNCIGPETQSPWLRPCAA GFRDFLVWISKRYGYPPIYVTENGTSIKGESDLPKEKILEDDFRVKYYNEYIRAMVTAVELDGVNVKGY FAWSLMDNFEWADGYVTRFGVTYVDYENGQKRFPKKSAKSLKPLFDELIAAA (SEQ ID NO: 9) [00193] Cel3a (Trichoderma reesei)
MRYRTAAALALATGPFARADSHSTSGASAEAVVPPAGTPWGTAYDKAKAALAKLNLQDKVGIVSGVGWN GGPCVGNTSPASKISYPSLCLQDGPLGVRYSTGSTAFTPGVQAASTWDVNLIRERGQFIGEEVKASGIH VILGPVAGPLGKTPQGGRNWEGFGVDPYLTGIAMGQTINGIQSVGVQATAKHYILNEQELNRETISSNP DDRTLHELYTWPFADAVQANVASVMCSYNKVNTTWACEDQYTLQTVLKDQLGFPGYVMTDWNAQHTTVQ SANSGLDMSMPGTDFNGNNRLWGPALTNAVNSNQVPTSRVDDMVTRILAAWYLTGQDQAGYPSFNISRN VQGNHKTNVRAIARDGIVLLKNDANILPLKKPASIAVVGSAAIIGNHARNSPSCNDKGCDDGALGMGWG SGAVNYPYFVAPYDAINTRASSQGTQVTLSNTDNTSSGASAARGKDVAIVFITADSGEGYITVEGNAGD RNNLDPWHNGNALVQAVAGANSNVIVVVHSVGAIILEQILALPQVKAVVWAGLPSQESGNALVDVLWGD
VSPSGKLVYTIAKSPNDYNTRIVSGGSDSFSEGLFIDYKHFDDANITPRYEFGYGLSYTKFNYSRLSVL STAKSGPATGAVVPGGPSDLFQNVATVTVDIANSGQVTGAEVAQLYITYPSSAPRTPPKQLRGFAKLNL TPGQSGTATFNIRRRDLSYWDTASQKWVVPSGSFGISVGASSRDIRLTSTLSVA (SEQ ID NO: 10) [00194] Cel5a (Trichoderma reesei)
MNKSVAPLLLAASILYGGAAAQQTVWGQCGGIGWSGPTNCAPGSACSTLNPYYAQCIPGATTITTSTRP PSGPTTTTRATSTSSSTPPTSSGVRFAGVNIAGFDFGCTTDGTCVTSKVYPPLKNFTGSNNYPDGIGQM QHFVNDDGMTIFRLPVGWQYLVNNNLGGNLDSTSISKYDQLVQGCLSLGAYCIVDIHNYARWNGGIIGQ GGPTNAQFTSLWSQLASKYASQSRVWFGIMNEPHDVNINTWAATVQEVVTAIRNAGATSQFISLPGNDW QSAGAFISDGSAAALSQVTNPDGSTTNLIFDVHKYLDSDNSGTHAECTTNNIDGAFSPLATWLRQNNRQ AILTETGGGNVQSCIQDMCQQIQYLNQNSDVYLGYVGWGAGSFDSTYVLTETPTGSGNSWTDTSLVSSC LARK (SEQ ID NO: 11) [00195] Cel6a (Trichoderma reesei)
MIVGILTTLATLATLAASVPLEERQACSSVWGQCGGQNWSGPTCCASGSTCVYSNDYYSQCLPGAASSS SSTRAASTTSRVSPTTSRSSSATPPPGSTTTRVPPVGSGTATYSGNPFVGVTPWANAYYASEVSSLAIP SLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNG EYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQ LNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGN AVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDS FVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL (SEQ ID NO: 12) [00196] Cel7a (Trichoderma reesei)
MYRKLAVISAFLATARAQSACTLQSETHPPLTWQKCSSGGTCTQQTGSWIDANWRWTHATNSSTNCYD
GNTWSSTLCPDNETCAKNCCLDGAAYASTYGVTTSGNSLSIGFVTQSAQKNVGARLYLMASDTTYQEFT LLGNEFSFDVDVSQLPCGLNGALYFVSMDADGGVSKYPTNTAGAKYGTGYCDSQCPRDLKFINGQANVE GWEPSSNNANTGIGGHGSCCSEMDIWEANSISEALTPHPCTTVGQEICEGDGCGGTYSDNRYGGTCDPD GCDWNPYRLGNTSFYGPGSSFTLDTTKKLTWTQFETSGAINRYYVQNGVTFQQPNAELGSYSGNELND DYCTAEEAEFGGSSFSDKGGLTQFKKATSGGMVLVMSLWDDYYANMLWLDSTYPTNETSSTPGAVRGSC STSSGVPAQVESQSPNAKVTFSNIKFGPIGSTGNPSGGNPPGGNPPGTTTTRRPATTTGSSPGPTQSHY GQCGGIGYSGPTVCASGTTCQVLNPYYSQCL (SEQ ID NO: 13) [00197] Cel7b (Trichoderma reesei)
MAPSVTLPLTTAILAIARLVAAQQPGTSTPEVHPKLTTYKCTKSGGCVAQDTSWLDWNYRWMHDANYN SCTVNGGVNTTLCPDEATCGKNCFIEGVDYAASGVTTSGSSLTMNQYMPSSSGGYSSVSPRLYLLDSDG EYVMLKLNGQELSFDVDLSALPCGENGSLYLSQMDENGGANQYNTAGANYGSGYCDAQCPVQTWRNGTL NTSHQGFCCNEMDILEGNSRANALTPHSCTATACDSAGCGFNPYGSGYKSYYGPGDTVDTSKTFTIITQ FNTDNGSPSGNLVSITRKYQQNGVDIPSAQPGGDTISSCPSASAYGGLATMGKALSSGMVLVFSIWNDN SQYMNWLDSGNAGPCSSTEGNPSNILANNPNTHVVFSNIRWGDIGSTTNSTAPPPPPASSTTFSTTRRS STTSSSPSCTQTHWGQCGGIGYSGCKTCTSGTTCQYSNDYYSQCL (SEQ ID NO: 14) [00198] Cell2a (Trichoderma reesei)
MKFLQVLPALIPAALAQTSCDQWATFTGNGYTVSNNLWGASAGSGFGCVTAVSLSGGASWHADWQWSGG QNNVKSYQNSQIAIPQKRTVNSISSMPTTASWSYSGSNIRANVAYDLFTAANPNHVTYSGDYELMIWLG KYGDIGPIGSSQGTVNVGGQSWTLYYGYNGAMQVYSFVAQTNTTNYSGDVKNFFNYLRDNKGYNAAGQY VLSYQFGTEPFTGSGTLNVASWTASIN (SEQ ID NO: 15) [00199] CeI45a (Trichoderma reesei)
MKATLVLGSLIVGAVSAYKATTTRYYDGQEGACGCGSSSGAFPWQLGIGNGVYTAAGSQALFDTAGASW CGAGCGKCYQLTSTGQAPCSSCGTGGAAGQSIIVMVTNLCPNNGNAQWCPVVGGTNQYGYSYHFDIMAQ NEIFGDNVWDFEPIACPGQAASDWGTCLCVGQQETDPTPVLGNDTGSTPPGSSPPATSSSPPSGGGQQ TLYGQCGGAGWTGPTTCQAPGTCKVQNQWYSQCLP (SEQ ID NO: 16) [00200] Cel74a (Trichoderma reesei)
MKVSRVLALVLGAVIPAHAAFSWKNVKLGGGGGFVPGIIFHPKTKGVAYARTDIGGLYRLNADDSWTAV TDGIADNAGWHNWGIDAVALDPQDDQKVYAAVGMYTNSWDPSNGAIIRSSDRGATWSFTNLPFKVGGNM PGRGAGERLAVDPANSNIIYFGARSGNGLWKSTDGGVTFSKVSSFTATGTYIPDPSDSNGYNSDKQGLM WVTFDSTSSTTGGATSRIFVGTADNITASVYVSTNAGSTWSAVPGQPGKYFPHKAKLQPAEKALYLTYS DGTGPYDGTLGSVWRYDIAGGTWKDITPVSGSDLYFGFGGLGLDLQKPGTLVVASLNSWWPDAQLFRST DSGTTWSPIWAWASYPTETYYYSISTPKAPWIKNNFIDVTSESPSDGLIKRLGWMIESLEIDPTDSNHW LYGTGMTIFGGHDLTNWDTRHNVSIQSLADGIEEFSVQDLASAPGGSELLAAVGDDNGFTFASRNDLGT SPQTVWATPTWATSTSVDYAGNSVKSWRVGNTAGTQQVAISSDGGATWSIDYAADTSMNGGTVAYSAD GDTILWSTASSGVQRSQFQGSFASVSSLPAGAVIASDKKTNSVFYAGSGSTFYVSKDTGSSFTRGPKLG SAGTIRDIAAHPTTAGTLYVSTDVGIFRSTDSGTTFGQVSTALTNTYQIALGVGSGSNWNLYAFGTGPS GARLYASGDSGASWTDIQGSQGFGSIDSTKVAGSGSTAGQVYVGTNGRGVFYAQGTVGGGTGGTSSSTK QSSSSTSSASSSTTLRSSVVSTTRASTVTSSRTSSAAGPTGSGVAGHYAQCGGIGWTGPTQCVAPYVCQ KQNDYYYQCV (SEQ ID NO: 17) [00201] paMan5a (Podospora anserina)
MKGLFAFGLGLLSLVNALPQAQGGGAAASAKVSGTRFVIDGKTGYFAGTNSYWIGFLTNNRDVDTTLDH IASSGLKILRVWGFNDVNNQPSGNTVWFQRLASSGSQINTGPNGLQRLDYLVRSAETRGIKLIIALVNY WDDFGGMKAYVNAFGGTKESWYTNARAQEQYKRYIQAWSRYVNSPAIFAWELANEPRCKGCNTNVIFN WATQISDYIRSLDKDHLITLGDEGFGLPGQTTYPYQYGEGTDFVKNLQIKNLDFGTFHMYPGHWGVPTS FGPGWIKDHAAACRAAGKPCLLEEYGYESDRCNVQKGWQQASRELSRDGMSGDLFWQWGDQLSTGQTHN DGFTIYYGSSLATCLVTDHVRAINALPA (SEQ ID NO: 18) [00202] paMan26a (Podospora anserina)
MVKLLDIGLFALALASSAVAKPCKPRDGPVTYEAEDAILTGTTVDTAQVGYTGRGYVTGFDEGSDKITF QISSATTKLYDLSIRYAAIYGDKRTNVVLNNGAVSEVFFPAGDSFTSVAAGQVLLNAGQNTIDIVNNWG WYLIDSITLTPSAPRPPHDINPNLNNPNADTNAKKLYSYLRSVYGNKIISGQQELHHAEWIRQQTGKTP ALVAVDLMDYSPSRVERGTTSHAVEDAIAHHNAGGIVSVLWHWNAPVGLYDTEENKWWSGFYTRATDFD IAATLANPQGANYTLLIRDIDAIAVQLKRLEAAGVPVLWRPLHEAEGGWFWWGAKGPEPAKQLWDILYE RLTVHHGLDNLIWVWNSILEDWYPGDDTVDILSADVYAQGNGPMSTQYNELIALGRDKKMIAAAEVGAA PLPGLLQAYQANWLWFAVWGDDFINNPSWNTVAVLNEIYNSDYVLTLDEIQGWRS (SEQ ID NO: 19) [00203] Swollenin (Trichoderma reesei)
MAGKLILVALASLVSLSIQQNCAALFGQCGGIGWSGTTCCVAGAQCSFVNDWYSQCLASTGGNPPNGTT SSSLVSRTSSASSSVGSSSPGGNSPTGSASTYTTTDTATVAPHSQSPYPSIAASSCGSWTLVDNVCCPS YCANDDTSESCSGCGTCTTPPSADCKSGTMYPEVHHVSSNESWHYSRSTHFGLTSGGACGFGLYGLCTK GSVTASWTDPMLGATCDAFCTAYPLLCKDPTGTTLRGNFAAPNGDYYTQFWSSLPGALDNYLSCGECIE LIQTKPDGTDYAVGEAGYTDPITLEIVDSCPCSANSKWCCGPGADHCGEIDFKYGCPLPADSIHLDLSD IAMGRLQGNGSLTNGVIPTRYRRVQCPKVGNAYIWLRNGGGPYYFALTAVNTNGPGSVTKIEIKGADTD NWVALVHDPNYTSSRPQERYGSWVIPQGSGPFNLPVGIRLTSPTGEQIVNEQAIKTFTPPATGDPNFYY IDIGVQFSQN (SEQ ID NO: 20) [00204] Other examples of suitable biomass-degrading enzymes for use in the enzyme mixture of the présent invention include the enzymes from species in the généra Bacillus, Coprinus, Myceliophthora, Cephalosporium, Scytalidium, Pénicillium, Aspergillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, Chrysosporium and Trichoderma, especially those produced by a strain selected from the species Aspergillus (see, e.g., EP Pub. No. 0 458 162), Humicola insolens (reclassified as Scytalidium thermophilum, see, e.g., U.S. Pat. No. 4,435,307), Coprinus cinereus, Fusarium oxysporum, Myceliophthora thermophila, Meripilus giganteus, Thielavia terrestris, Acremonium sp. (including, but not limited to, A. persicinum, A. acremonium, A. brachypenium, A. dichromosporum, A. obclavatum, A. pinkertoniae, A. roseogriseum, A. incoloratum, and A. furatum). Preferred strains include Humicola insolens DSM 1800, Fusarium oxysporum DSM 2672, Myceliophthora thermophila CBS 117.65, Cephalosporium sp. RYM-202, Acremonium sp. CBS 478.94, Acremonium sp. CBS 265.95, Acremoniumpersicinum CBS 169.65, Acremonium acremonium AHU 9519, Cephalosporium sp. CBS 535.71, Acremonium brachypenium CBS $66.73, Acremonium dichromosporum CBS 683.73, Acremonium obclavatum CBS 311.74, Acremonium pinkertoniae CBS 157.70, Acremonium roseogriseum CBS 134.56, Acremonium incoloratum CBS 146.62, md Acremonium furatum CBS 299.70H. Biomass-degrading enzymes may also be obtained from Chrysosporium, preferably a strain of Chrysosporium lucknowense. Additional strains that can be used include, but are not limited to, Trichoderma (particularly T. viride, T. reesei, and T. koningii), alkalophilic Bacillus (see, for example, U.S. Pat. No. 3,844,890 and EP Pub. No. 0 458 162), and Streptomyces (see, e.g., EP Pub. No. 0 458 162). [00205] In embodiments, the microorganism is induced to produce the biomass-degrading enzymes described herein under conditions suitable for increasing production of biomassdegrading enzymes compared to an uninduced microorganism. For example, an induction biomass sample comprising biomass as described herein is incubated with the microorganism to increase production of the biomass-degrading enzymes. Further description of the induction process can be found in US 2014/0011258, the contents of which are hereby incorporated by reference in its entirety.
[00206] The biomass-degrading enzymes produced and/or secreted by the aforementioned microorganisms can be isolated and added to the mixture of the présent invention, or directly to the saccharification reaction. Altematively, in one embodiment, the aforementioned microorganisms or host cells expressing the biomass-degrading enzymes described herein and above are not lysed before addition to the saccharification reaction.
[00207] In an embodiment, an enzyme mixture comprising the host cell expressing one or more additional biomass-degrading enzymes as described herein can be used with the mixture comprising the solubilized polypeptide having biomass-degrading activity described herein. [00208] Use of the mixture described herein comprising a polypeptide having biomassdegrading activity solubilized from inclusion bodies and a solubilizing agent does not inhibit, prevent or decrease the yield of sugar products from saccharification compared to saccharification without addition of the solubilized polypeptide. In some embodiments, the yield of sugar products increases upon use of the mixture described herein comprising a polypeptide having biomass-degrading activity solubilized from inclusion bodies and a solubilizing agent. The yield of sugar products increases at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100% compared to when the standard mixture of biomass-degrading enzymes is added to the saccharification without the mixture containing solubilized polypeptide and solubilized agent.
Further Processing [00209] Further processing steps may be performed on the sugars produced by saccharification to produce alternative products. For example, the sugars can be hydrogenated, fermented, or treated with other chemicals to produce other products.
[00210] Glucose can be hydrogenated to sorbitol. Xylose can be hydrogenated to xylitol. Hydrogénation can be accomplished by use of a catalyst (e.g., Pt/gamma-ALCh, Ru/C, Raney Nickel, or other catalysts know in the art) in combination with H2 under high pressure (e.g., 10 to 12000 psi). The sorbitol and/oi' xylitol products can be isolated and purified using methods known in the art.
[00211] Sugar products from saccharification can also be fermented to produce alcohols, sugar alcohols, such as erythritol, or organic acids, e.g., lactic, glutamic or citric acids or amino acids.
[00212] Yeast and Zymomonas bacteria, for example, can be used for fermentation or conversion of sugar(s) to alcohol(s). Other microorganisms are discussed below. The optimum pH for fermentations is about pH 4 to 7. For example, the optimum pH for yeast is from about pH 4 to 5, while the optimum pH for Zymomonas is from about pH 5 to 6. Typical fermentation times are about 24 to 168 hours (e.g., 24 to 96 hrs) with températures in the range of 20° C. to 40° C. (e.g., 26° C. to 40° C.), however thermophilic microorganisms prefer higher températures.
[00213] In some embodiments, e.g., when anaérobie organisms are used, at least a portion of the fermentation is conducted in the absence of oxygen, e.g., under a blanket of an inert gas such as N2, Ar, He, CO2 or mixtures thereof. Additionally, the mixture may hâve a constant purge of an inert gas flowing through the tank during part of or ail of the fermentation. In some cases, anaérobie conditions can be achieved or maintained by carbon dioxide production during the fermentation and no additional inert gas is needed.
[00214] In some embodiments, ail or a portion of the fermentation process can be interrupted before the low molecular weight sugar is completely converted to a product (e.g., éthanol). The intermediate fermentation products include sugar and carbohydrates in high concentrations.
The sugars and carbohydrates can be isolated via any means known in the art. These intermediate fermentation products can be used in préparation of food for human or animal consumption. Additionally or altematively, the intermediate fermentation products can be ground to a fine particle size in a stainless-steel laboratory mill to produce a flour-like substance.
[00215] Jet mixing may be used during fermentation, and in some cases saccharification and fermentation are performed in the same tank.
[00216] Nutrients for the microorganisms may be added during saccharification and/or fermentation, for example the food-based nutrient packages described in U.S. Pat. App. Pub. 2012/0052536, filed Jul. 15, 2011, the complété disclosure of which is incorporated herein by reference.
[00217] “Fermentation” includes the methods and products that are disclosed in U.S. Prov. App. No. 61/579,559, filed Dec. 22, 2012, and U.S. Prov. App. No. 61/579,576, filed Dec. 22, 2012, the contents of both of which are incorporated by reference herein in their entirety.
[00218] Mobile fermenters can be utilized, as described in International App. No. PCT/US2007/074028 (which was filed Jul. 20, 2007, was published in English as WO 2008/011598 and designated the United States), the contents of which is incoiporated herein in its entirety. Similarly, the saccharification equipment can be mobile. Further, saccharification and/or fermentation may be performed in part or entirely during transit.
[00219] The micrôorganism(s) used in fermentation can be naturally-occurring microorganisms and/or engineered microorganisms. For example, the microorganism can be a bacterium (including, but not limited to, e.g., a cellulolytic bacterium), a fungus, (including, but not limited to, e.g., a yeast), a plant, a protist, e.g., a protozoa or a fungus-like protest (including, but not limited to, e.g., a slime mold), or an algae. When the organisms are compatible, mixtures of organisms can be utilized.
[00220] Suitable fermenting microorganisms hâve the ability to convert carbohydrates, such as glucose, fructose, xylose, arabinose, mannose, galactose, oligosaccharides or polysaccharides into fermentation products. Fermenting microorganisms include strains of the genus Saccharomyces spp. (including, but not limited to, S. cerevisiae (baker's yeast), S. distaticus, S. uvarum), the genus Kluyveromyces, (including, but not limited to, K. marxianus, K. fragilis), the genus Candida (including, but not limited to, C. pseudotropicalis, and C. brassicae), Pichia stipitis (a relative of Candida shehatae), the genus Clavispora (including, but not limited to, C. lusitaniae and C. opuntiae), the genus Pachysolen (including, but not limited to, P. tannophilus), the genus Bretannomyces (including, but not limited to, e.g., B. clausenii (Philippidis, G. P., 1996, Cellulose bioconversion technology, in Handbook on Bioethanol: Production and Utilization, Wyman, C. E., ed., Taylor & Francis, Washington,
D.C., 179-212) ). Other suitable microorganisms include, for example, Zymomonas mobilis, Clostridium spp. (including, but not limited to, C. thermocellum (Philippidis, 1996, supra), C. saccharobutylacetonicum, C. saccharobutylicum, C. Puniceum, C. beijernckii, and C. acetobutylicum), Moniliellapollinis, Moniliella megachiliensis, Lactobacillus spp. Yarrowia lipolytica, Aureobasidium sp., Trichosporonoides sp., Trigonopsis variabilis, Trichosporon sp., Moniliellaacetoabutans sp., Typhula variabilis, Candida magnoliae, Ustilaginomycetes sp., Pseudozyma tsukubaensis, yeast species of généra Zygosaccharomyces, Debaryomyces, Hansenula and Pichia, and fungi of the dematioid genus Tonda.
[00221] For instance, Clostridium spp. can be used to produce éthanol, butanol, butyric acid, acetic acid, and acetone. Lactobacillus spp. can be used to produce lactic acid.
[00222] Many such microbial strains are publicly available, either commercially or through depositories such as the ATCC (American Type Culture Collection, Manassas, Va., USA), the NRJRL (Agricultural Research Sevice Culture Collection, Peoria, 111., USA), or the DSMZ (Deutsche Sammlung von Mikroorganismen and Zellkulturen GmbH, Braunschweig, Germany), to name a few.
[00223] Commercially available yeasts include, for example, Red Star®/Lesaffre Ethanol Red (available from Red Star/Lesaffre, USA), FALI® (available from Fleischmann's Yeast, a division of Bums Philip Food Inc., USA), SUPERSTART® (available from Alltech, now Lalemand), GERT STRAND® (available from Gert Strand AB, Sweden) and FERMOL® (available from DSM Specialties).
[00224] Many microorganisms that can be used to saccharify biomass material and produce sugars can also be used to ferment and couvert those sugars to usefùl products.
[00225] After fermentation, the resulting fluids can be distilled using, for example, a “beer column” to separate éthanol and other alcohols from the majority of water and residual solids. The vapor exiting the beer column can be, e.g., 35% by weight éthanol and can be fed to a rectification column. A mixture of nearly azeotropic (92.5%) éthanol and water from the rectification column can be purified to pure (99.5%) éthanol using vapor-phase molecular sieves. The beer column bottoms can be sent to the first effect of a three-effect evaporator. The rectification column reflux condenser can provide heat for this first effect. After the first effect, solids can be separated using a centrifuge and dried in a rotary dryer. A portion (25%) of the centrifuge effluent can be recycled to fermentation and the rest sent to the second and third evaporator effects. Most of the evaporator condensate can be retumed to the process as fairly clean condensate with a small portion split off to waste water treatment to prevent build-up of low-boiling compounds.
[00226] Other types of chemical transformation of the products from the processes described herein can be used, for example, production of organic sugar derived products such (e.g., furfural and furfural-derived products). Chemical transformations of sugar derived products are described in U.S. Prov. App. No. 61/667,481, filed Jul. 3, 2012, the disclosure of which is incorporated herein by reference in its entirety.
Examples [00227] The invention is further described in detail by reference to the following experimental examples. These examples are provided for proposes of illustration only, and are not intended to be limiting unless otherwise specified. Thus, the invention should in no way be construed as being limited to the following examples, but rather, should be construed to encompass any and all variations which become évident as a resuit of the teaching provided herein.
[00228] Without further description, it is believed that one of ordinary skill in the art can, using the preceding description and the following illustrative examples, make and utilize the compounds of the présent invention and practice the claimed methods. The following working examples specifically point out various aspects of the présent invention, and are not to be construed as limiting in any way the remainder of the disclosure.
Example 1: Expression of Cel3a-C’His in E. coli [00229] The mature sequence for Cel3a (amino acids 20-744) was synthesized and codonoptimized for E.coli expression by Genewiz. The Cel3a-C’His referred to in the following examples refers to the codon-optimized mature sequence for Cel3a (aas 20-744) with an 8xHis (SEQ ID NO: 21) tag at the C-terminus. The below primers were used to clone the Cel3aC’His into pET-Duet (Novagen, Catalog No. 71146):
Forward 5’ -CATGCCATGGGCGATAGTCACAGTACCAGC (SEQ ID NO: 4) Reverse 3 ’ CCCAAGÇTTTCATTlAGTGATGATGATGATGATGATGATGGCTGCCGCTGCCGGCAACA
CTCAGGGTGC (SEQ ID NO: 5) (Ncol and HindlII sites are underlined; start and stop codons are in bold; the polyhistidine (8His (SEQ ID NO: 21) tag; and glycine-serine (GSGS (SEQ ID NO: 23)) linker are italized.) The Amplification reaction was performed using PfùUltra II Fusion HS Polymerase (Agilent, Catalog No. 600672).
[00230] The amplified DNA was cloned by restriction digestion using Ncol restriction enzyme (New England Biolabs, R3193) and HindlII restriction enzyme (New England Biolabs, R3104) under conditions suggested by the manufacturer. The digested amplified DNA was ligated into the NcoI-HindlII sites in the pETDuet vector using T4 DNA ligase (New England Biolabs, M0202), followed by transformation of E. coli cloning host Top 10 One Shot (Invitrogen). Plasmid purification was carried out using Qiagen’s plasmid purification kit. [00231] The Cel3A-C’His constructs were transformed into the E. coli expression host Origami B (DE3) (EMD Millipore, Catalog No. 70837) and streaked on plates containing LB medium and 100pg/ml ampicillin (Fisher Scientifïc, Catalog No. BP1760), 15 pg/ml kanamysin (Fisher Scientifïc, Catalog No. BP906) and 12.5pg/ml tétracycline (Fisher Scientified, Catalog No. BP912). Colonies carrying the recombinant DNA were picked from plates for the inoculation of 2 ml starter cultures, and grown ovemight at 37°C, then subsequently used to inoculate 100ml of LB media containing the appropriate antibiotics. Cultures were grown at 37°C until OD600 reached 0.8.
[00232] To induce protein expression, 500μΜ IPTG (Isopropyl-b-D-thiogalactopyranoside; Fisher Scientific, Catalog No. BP1755) was added. The expression culture was further grown for another 4 hours at 37°C. The cells were harvested by centrifugation at 4200 at room température (RT) for 30 minutes using the Sorvall St 16 rotor TX400.
Example 2: Solubilization of Cel3a from the Insoluble Fraction [00233] An E. coli culture expressing an enzyme having biomass-degrading activity, Cel3a, was cultured and enzyme expression was induced, as described in Example 1. Isolation of Cel3a tagged with a His tag at the C-terminus (Cel3a-C’His) from the soluble and insoluble fraction was performed as follows. The cell culture was centrifùged at 4200 rpm for 30 minutes. The supematant was discarded and the cell pellet was re-suspended in lysis buffer with 1 mg/mL lysozyme. Lysonase, e.g., 10 μΐ, of Lysonase Bioprocessing Reagent (EMD Millipore 71320) per gram of cell paste was added and the sample was incubated for 1 hour at ambient température. After 1 hour, the sample was sonicated for a total of 2 minutes in 30 second intervals. Following sonication, the sample was centrifùged for 30 minutes at 10000 rpm. The supematant, or soluble fraction, contains solubilized Cel3a, while the remaining pellet, or insoluble fraction, contains inclusion bodies and insoluble Cel3a.
[00234] The insoluble fraction was re-suspended in buffer containing a solubilizing agent for 15 minutes and vortexed at room température, specifically, 6M Urea pH 8 IMAC binding buffer. The sample was then filtered through a 0.45 pm membrane to préparé for IMAC purification. The amount of 6M Urea pH 8 IMAC binding buffer added was proportional to the amount of cell mass, e.g., 2 or 3 volumes of buffer to 1 volume of cell mass. The amount of binding buffer is increased as the cell mass increases in order to make fïltering of the sample possible.
Example 3: Purification of Cel3a
Purification of Soluble Cel3a [00235] The soluble fraction from Example 2 was transferred to a fresh tube containing ΙΟΟμΙ of pre-equilibrated Bio-Scale™ Profmity (Biorad) Ni-charged IMAC resin slurry (BioRad, Catalog No. 732-4614). The native binding buffer contained 50mM Tris HCl pH 7.5, 150mM NaCl, 0.1% Triton X-100, and 5μΜ imidazole. The protein was batch-bound for 1 hour at room température (RT), and then washed with native buffer containing 25μΜ imidazole. The protein was eluted in 300μ1 of native buffer containing 200μΜ imidazole.
Purification of Insoluble Cel3a [00236] A Bio-Scale™ Mini Profmity IMAC 5mL cartridge (BioRad, Catalog No. 7324614) was equilibrated with 5 column volumes of 6M Urea pH8 IMAC binding buffer at a flow rate of 5mL/min. After column équilibration the resuspended insoluble fraction from Example 2 was loaded at a flow rate of 1 mL/min. The column then received a 15 column volume wash of the 6M Urea pH8 IMAC binding buffer at a flow rate of 5mL/min. The solubilized Cel3a was then eluted from the column with 10 column volumes of 6M Urea pH 4 IMAC elution buffer at a flow rate of 5mL/min. The resulting solubilized Cel3a sample contains 6M urea.
[00237] IMAC chromatography analysis was performed (using IMAC columns, Bio-Scale™ Mini Profmity™ IMAC Cartridges 5mL, Catalog # 732-4614), and as shown in Figure 1, purified solubilized Cel3a was detected.
[00238] SDS-PAGE analysis was performed to assess the amount of Cel3a from the purification described above in the following fractions: purified soluble Cel3a (lane 2 in Figure 2); flow through from the IMAC purification of the insoluble fraction (lane 3 in Figure 2); and the purified Cel3a from the insoluble fraction (solubilized Cel3a) (lane 4 in Figure 2). As shown in Figure 2, Cel3a was successfully isolated from the inclusion bodies of the insoluble fraction using the methods described above.
Example 4: Analysis of Cellobiase Activity of Solubilized Cel3a [00239] Cel3a was purified using IMAC techniques, as described in Example 3. Prior to performing the activity assay, the amount (titer) of purified Cel3a was determined using Bradford assay and/or the nanodrop. For nanodrop quantification, the molar extinction coefficient was estimated by inserting the amino acid sequence of the target form of Cel3a into the ExPASy ProtParam online tool.
[00240] For the activity assay, two fold serial dilutions of samples containing purified Cel3a were prepared using 50 mM sodium citrate, pH 5.0 NaOH as buffer. Dilutions were aliquoted across one row of a 96 well plate. Dilutions were incubated with a D-(+)-Cellobiose (Fluka) substrate solution in 50mM sodium citrate monobasic buffer at pH 5.0, at 48°C for 30 minutes. The plates were immediately sealed using an adhesive plate seal and placed on a microplate incubator shaker set at 48°C, 700 ipm. After 30 minutes, the samples were heated on a heating dry bath for 5 minutes at 100°C to stop the reaction. The plate was then filtered through a 96 well format 0.45pm Durapore membrane. The filtrate samples were analysed for glucose and cellobiose using the YSI Biochemistry analyser (YSI Life Sciences) and/or HPLC (UPLC) methods. The cellobiase activity of the dilutions of purified Cel3a from the soluble and insoluble fractions was plotted on a graph and the results are shown in Figure 3. Figure 3 shows that the solubilized Cel3a has cellobiase activity, even in the presence of urea.
[00241] Cellobiase activity was also assessed for solubilized Cel3a that has not been purified by the IMAC purification methods described in Example 3. The cell pellet of cells expressing Cel3a was washed with lysis buffer before solubilising with the solubilizing buffer containing 6M urea. Cellobiase activity of the crude lysate sample containing solubilized Cel3a in 6M urea buffer is assayed by the cellobiase assay described above. The percentage of cellobiose converted to glucose in 30 minutes was compared between soluble Cel3a, the soluble wash, and the solubilized Cel3a from crude lysate (Figure 4). The solubilized Cel3a without purification also possessed cellobiase activity.
EQUIVALENTS [00242] The disclosures of each and every patent, patent application, and publication cited herein are hereby incorporated herein by reference in their entirety. While this invention has been disclosed with reference to spécifie aspects, it is apparent that other aspects and variations of this invention may be devised by others skilled in the art without departing from the true spirit and scope of the invention. The appended claims are intended to be construed to include ail such aspects and équivalent variations.

Claims (60)

  1. What is claimed is:
    1. A mixture comprising a plurality of polypeptides having biomass-degrading activity and a solubilizing agent, wherein the polypeptides hâve at least 8-10% of the biomass-degrading activity compared to a native polypeptide having biomass-degrading activity.
  2. 2. The mixture of claim 1, further comprising one or more proteins associated with an inclusion body.
  3. 3. The mixture of claim 1, wherein the mixture does not comprise one or more proteins associated with an inclusion body.
  4. 4. The mixture of any of the preceding claims, further comprising cellular débris, one or more ribosomal component, one or more host protein, and/or host nucleic acid comprising DNA and/or RNA.
  5. 5. The mixture of any of the preceding claims, wherein the biomass-degrading activity is cellobiase activity, ligninase activity, endoglucanase activity, cellobiohydrolase activity, or xylanase activity.
  6. 6. The mixture of any of the preceding claims, wherein the polypeptide is partially unfolded, partially misfolded, or partially denatured.
  7. 7. The mixture of claim 1, wherein the polypeptide comprises an amino acid sequence with at least 90% identity to SEQ ID NO: 1.
  8. 8. The mixture of any of the preceding claims, wherein the polypeptide comprises a Cel3A enzyme from T. reesei, or a functional variant or fragment thereof.
  9. 9. The mixture of claim 8, wherein the Cel3A enzyme comprises the amino acid sequence SEQ ID NO: 1, or an amino acid sequence with at least 90% identity thereof.
    2099781.1
  10. 10. The mixture any of the preceding claims, wherein the polypeptide is encoded by a nucleic acid sequence comprising at least 90% identity to SEQ ID NO: 2 or SEQ ID NO: 3.
  11. 11. The mixture of any of the preceding claims, wherein the polypeptide is aglycosylated.
  12. 12. The mixture of any of claims 1-3 or 7, wherein the solubilizing agent comprises urea, and optionally, is présent at a concentration between 0.2M-6M.
  13. 13. The mixture of any of the preceding claims, further comprising at least one additional polypeptide having a biomass-degrading activity or a microorganism that produces one or more enzymes having a biomass-degrading activity.
  14. 14. The mixture of claim 13, wherein the additional polypeptide is selected from a ligninase, an endoglucanase, a cellobiohydrolase, a cellobiase, and a xylanase, or any combination thereof.
  15. 15. The mixture of claim 13 or 14, wherein the additional polypeptide is selected from:
    a. a polypeptide comprising an amino acid sequence with at least 90% identity to SEQ IDNO: 1;
    b. a Cel3A enzyme from T. reesei, or a functional variant or fragment thereof; or
    c. a polypeptide encoded by a nucleic acid sequence comprising (e.g., consisting of) SEQ ID NO: 2 or SEQ ID NO: 3.
  16. 16. The mixture of any of claims 13-15, wherein the additional polypeptide is aglycosylated.
  17. 17. The mixture of any of claims 13-15, wherein the additional polypeptide is glycosylated.
  18. 18. A mixture comprising a plurality of polypeptides having an amino acid sequence with at least 90% identity to SEQ ID NO: 1 and a solubilizing agent, wherein the plurality of polypeptides hâve at least 20%-40% of the activity of the native polypeptide comprising SEQIDNO: 1.
  19. 19. The mixture of claim 18, further comprising one or more proteins associated with an inclusion body.
  20. 20. The mixture of claim 18, wherein the mixture does not comprise one or more proteins associated with an inclusion body.
  21. 21. The mixture of any of claims 18-20, further comprising cellular débris, one or more ribosomal component, one or more host protein, and/or host nucleic acid comprising DNA and/or RNA.
  22. 22. The mixture of any of claims 18-21, wherein the polypeptide is partially unfolded, partially misfolded, or partially denatured.
  23. 23. The mixture any of claims 18-22, wherein the polypeptide is encoded by a nucleic acid sequence comprising at least 90% identity to SEQ ID NO: 2 or SEQ ID NO: 3.
  24. 24. The mixture of any of claims 18-23, wherein the polypeptide is aglycosylated.
  25. 25. The mixture of any of claims 18-20, wherein the solubilizing agent comprises urea, and optionally, is présent at a concentration between 0.2M-6M.
  26. 26. The mixture of any of claims 18-25, further comprising at least one additional polypeptide having a biomass-degrading activity or a microorganism that produces one or more enzymes having a biomass-degrading activity.
  27. 27. The mixture of claim 26, wherein the additional polypeptide is selected from a ligninase, an endoglucanase, a cellobiohydrolase, a cellobiase, and a xylanase, or any combination thereof.
  28. 28. The mixture of claim 26 or 27, wherein the additional polypeptide is selected from:
    a. a polypeptide comprising an amino acid sequence with at least 90% identity to SEQ IDNO: 1;
    b. a Cel3A enzyme from T. reesei, or a functional variant or fragment thereof; or
    c. a polypeptide encoded by a nucleic acid sequence comprising (e.g., consisting of) SEQ ID NO: 2 or SEQ ID NO: 3.
  29. 29. The mixture of any of claims 26-28 wherein the additional polypeptide is aglycosylated.
  30. 30. The mixture of any of claims 26-28, wherein the additional polypeptide is glycosylated.
  31. 31. A method for producing a mixture of any of claims 1-30 comprising contacting a cell expressing the polypeptide having biomass-degrading activity, or lysate thereof, with a solubilizing agent at a concentration suitable for solubilizing the polypeptide.
  32. 32. The method of claim 31, further comprising lysing the cell to obtain a lysate, separating a soluble fraction from an insoluble fraction of the lysate, and resuspending the insoluble fraction in the solubilizing agent.
  33. 33. The method of claim 31 or 32, wherein the solubilizing agent is urea, and optionally, wherein the concentration ofthe solubilizing agent is between 0.2M-6M.
  34. 34. The method of any of claims 31-33, wherein the biomass-degrading activity is a cellobiase activity, a ligninase activity, an endoglucanase activity, a cellobiohydrolase, or a xylanase activity.
  35. 35. The method of any of claims 31-34, wherein the polypeptide comprises an amino acid sequence with at least 90% identity to SEQ ID NO: 1.
  36. 36. The method of any of claims 31-35, wherein the polypeptide comprises a Cel3A from T. reesei, or a functional variant or fragment thereof.
  37. 37. The method of any of claims 31-36 wherein the polypeptide is aglycosylated.
  38. 38. A method for producing a polypeptide having biomass-degrading activity comprising expressing the polypeptide in a cell and contacting the cell or a lysate thereof with a solubilizing agent at a concentration suitable for solubilizing the polypeptide.
  39. 39. A method for producing a polypeptide having biomass-degrading activity comprising providing a cell that has been genetically modified to produce at least one polypeptide having biomass-degrading activity, wherein at least a portion of said polypeptide having biomass-degrading activity is found in inclusion bodies, and contacting the cell, or a lysate thereof containing the inclusion bodies, with a solubilizing agent at a concentration suitable for solubilizing the polypeptide.
  40. 40. The method of claim 38 or 39, wherein the solubilizing agent comprises urea.
  41. 41. The method of any of claims 38-40, wherein the concentration ofthe solubilizing agent is between 0.2M-6M.
  42. 42. The method of any of claims 38-41, further comprising lysing the cell to obtain a lysate, separating a soluble fraction from an insoluble fraction of the lysate, and resuspending the insoluble fraction in the solubilizing agent.
  43. 43. The method of any of claims 38-42, wherein the biomass-degrading activity is a cellobiase activity, a ligninase activity, an endoglucanase activity, a cellobiohydrolase activity, or a xylanase activity.
  44. 44. The method of any of claims 38 or 39, wherein the polypeptide comprises an amino acid sequence with at least 90% identity to SEQ ID NO: 1.
  45. 45. The method of any of claims 38-44, wherein the polypeptide comprises a Cel3A from T. reesei, or a functional variant or fragment thereof.
  46. 46. The method of any of claims 38-45, wherein the cell is a prokaryotic or bacterial cell, e.g.,
    E. coli cell, origami E. coli cell.
  47. 47. The method of any of claims 38-46, wherein the polypeptide is aglycosylated.
  48. 48. A method of producing a product from a biomass comprising contacting a biomass with the mixture of any of claims 1-30, and, optionally, a microorganism that produces one or more biomass-degrading enzyme and/or an enzyme mixture comprising biomass-degrading enzymes, under conditions suitable for the production of the product.
  49. 49. The method of claim 48, further comprising treating the biomass with an électron beam prior to contacting the biomass with the mixture.
  50. 50. The method of claim 48 or 49, wherein the product is a sugar product.
  51. 51. The method of claim 50, wherein the sugar product is glucose and/or xylose.
  52. 52. The method of any of claims 48-51, further comprising isolating the product.
  53. 53. The method of claim 52, wherein the isolating of the product comprises précipitation, crystallization, chromatography, centrifugation, and/or extraction.
  54. 54. The method of any of claims 48-53, wherein the enzyme mixture comprises at least two of the enzymes selected from B2AF03, CIP1, CIP2, Cella, Cel3a, Cel5a, Cel6a, Cel7a, Cel7b, Cell2a, Cel45a, Cel74a, paMan5a, paMan26a, and Swollenin.
  55. 55. The method of any of claims 48-54, wherein the biomass comprises one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof, wherein:
    a) an agricultural product or waste comprises sugar cane jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, corn cobs, com stover, corn fiber, coconut haïr, beet pulp, bagasse, soybean stover, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, or beeswing, or a combination thereof;
    b) a paper product or waste comprises paper, pigmented papers, loaded papers, coated papers, filled papers, magazines, printed matter, printer paper, polycoated paper, cardstock, cardboard, paperboard, or paper pulp, or a combination thereof;
    c) a forestry product comprises aspen wood, particle board, wood chips, or sawdust, or a combination thereof; and
    d) a general waste comprises manure, sewage, or offal, or a combination thereof.
  56. 56. The method of any of claims 48-55, further comprises a step of treating the biomass prior to introducing the microorganism or the enzyme mixture to reduce the recalcitrance of the biomass, wherein the treating comprises bombardment with électrons, sonication, oxidation, pyrolysis, steam explosion, chemical treatment, mechanical treatment, or freeze grinding.
  57. 57. The method of any of claims 48-56, wherein the microorganism that produces a biomassdegrading enzyme is from species in the généra selected from Bacillus, Coprinus, Myceliophthora, Cephalosporium, Scytalidium, Pénicillium, Aspergillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, Chrysosporium or Trichoderma.
  58. 58. The method of any of claims 48-57, wherein the microorganism that produces a biomassdegrading enzyme is selected from Aspergillus, Humicola insolens (Scytalidium thermophilum) Coprinus cinereus, Fusarium oxysporum, Myceliophthora thermophila, Meripilus giganteus, Thielavia terrestris, Acremonium persicinum, Acremonium acremonium, Acremonium brachypenium, Acremonium dichromosporum, Acremonium obclavatum, Acremonium pinkertoniae, Acremonium roseogriseum, Acremonium incoloratum, Acremonium furatum, Chrysosporium lucknowense, Trichoderma viride, Trichoderma reesei, or Trichoderma koningii.
  59. 59. The method of any of claims 48-58, wherein the microorganism has been induced to produce biomass-degrading enzymes by combining the microorganism with an induction biomass sample under conditions suitable for increasing production of biomass-degrading enzymes compared to an uninduced microorganism.
  60. 60. The method of any of claims 48-59, wherein the induction biomass sample comprises one or more of an agricultural product or waste, a paper product or waste, a forestry product, or a general waste, or any combination thereof, wherein:
    a) an agricultural product or waste comprises sugar cane jute, hemp, flax, bamboo, sisal, alfalfa, hay, arracacha, buckwheat, banana, barley, cassava, kudzu, oca, sago, sorghum, potato, sweet potato, taro, yams, beans, favas, lentils, peas, grasses, switchgrass, miscanthus, cord grass, reed canary grass, grain residues, canola straw, wheat straw, barley straw, oat straw, rice straw, com cobs, com stover, com fiber, coconut hair, beet pulp, bagasse, soybean stover, grain residues, rice hulls, oat hulls, wheat chaff, barley hulls, or beeswing, or a combination thereof;
    b) a paper product or waste comprises paper, pigmented papers, loaded papers, coated papers, filled papers, magazines, printed matter, printer paper, polycoated paper, cardstock, cardboard, paperboard, or paper pulp, or a combination thereof;
    c) a forestry product comprises aspen wood, particle board, wood chips, or sawdust, or a combination thereof; and
    d) a general waste comprises manure, sewage, or offal, or a combination thereof.
OA1201700105 2014-09-26 2015-09-25 Solubilized enzyme and uses thereof. OA18252A (en)

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
US62/055702 2014-09-26

Publications (1)

Publication Number Publication Date
OA18252A true OA18252A (en) 2018-09-17

Family

ID=

Similar Documents

Publication Publication Date Title
DK2504017T3 (en) RECOMBINANT BETA-glucosidase OPTIONS FOR PRODUCTION OF soluble sugars FROM cellulosic biomass
US9080163B2 (en) Cellobiohydrolase variants
US9260705B2 (en) Cellobiohydrolase variants
WO2012048171A2 (en) Variant cbh i polypeptides with reduced product inhibition
US20190316108A1 (en) Solubilized enzyme and uses thereof
US20200190462A1 (en) Compositions for enhanced enzyme production
US20190024068A1 (en) Aglycosylated enzyme and uses thereof
US10626381B2 (en) Cellulolytic compositions comprising monooxygenase polysaccharide enzymes with improved activity
EP3330375A1 (en) Expression of recombinant beta-xylosidase enzymes
OA18252A (en) Solubilized enzyme and uses thereof.
OA18211A (en) Aglycosylated enzyme and uses thereof.
WO2013043317A1 (en) Endoglucanase 1b
MEDOFF et al. Patent 2981059 Summary