WO2016141244A1 - scFv-Fc DIMERS THAT BIND TRASFORMING GROWTH FACTOR-β1 WITH HIGH AFFINITY, AVIDITY AND SPECIFICITY - Google Patents

scFv-Fc DIMERS THAT BIND TRASFORMING GROWTH FACTOR-β1 WITH HIGH AFFINITY, AVIDITY AND SPECIFICITY Download PDF

Info

Publication number
WO2016141244A1
WO2016141244A1 PCT/US2016/020779 US2016020779W WO2016141244A1 WO 2016141244 A1 WO2016141244 A1 WO 2016141244A1 US 2016020779 W US2016020779 W US 2016020779W WO 2016141244 A1 WO2016141244 A1 WO 2016141244A1
Authority
WO
WIPO (PCT)
Prior art keywords
binding protein
seq
domain
amino acid
tgf
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/020779
Other languages
English (en)
French (fr)
Other versions
WO2016141244A8 (en
Inventor
Huawei Qiu
Clark Pan
Julie BIRD
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genzyme Corp
Original Assignee
Genzyme Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to RU2017134042A priority Critical patent/RU2733286C2/ru
Priority to CA2978459A priority patent/CA2978459C/en
Priority to EP24220330.5A priority patent/EP4527850A3/en
Priority to EP16710059.3A priority patent/EP3265484B1/en
Priority to KR1020177027371A priority patent/KR102598790B1/ko
Priority to CN201680025665.5A priority patent/CN107889491B/zh
Priority to US15/555,499 priority patent/US10508146B2/en
Priority to KR1020237037758A priority patent/KR102754133B1/ko
Priority to JP2017546178A priority patent/JP6845802B2/ja
Priority to KR1020257000711A priority patent/KR20250009587A/ko
Priority to AU2016226097A priority patent/AU2016226097B2/en
Priority to MX2017011251A priority patent/MX2017011251A/es
Application filed by Genzyme Corp filed Critical Genzyme Corp
Priority to ES16710059T priority patent/ES3014555T3/es
Priority to BR112017018767A priority patent/BR112017018767A2/pt
Priority to SG11201707105TA priority patent/SG11201707105TA/en
Publication of WO2016141244A1 publication Critical patent/WO2016141244A1/en
Publication of WO2016141244A8 publication Critical patent/WO2016141244A8/en
Priority to IL254238A priority patent/IL254238B/en
Anticipated expiration legal-status Critical
Priority to US16/669,211 priority patent/US11325971B2/en
Priority to US17/713,087 priority patent/US11976112B2/en
Priority to US18/627,131 priority patent/US12473356B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/35Valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/626Diabody or triabody
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/72Increased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/23Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a GST-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/73Fusion polypeptide containing domain for protein-protein interaction containing coiled-coiled motif (leucine zippers)

Definitions

  • Compositions comprising the antigen- binding dimer and methods of using the same for treatment of diseases involving TGF i activity are provided.
  • TGFP-induced signaling pathway Many severe diseases are linked to malfunctions of the TGFP-induced signaling pathway. For instance, an increased tissue level of TGFP is believed to be a factor in the development of idiopathic pulmonary fibrosis and myocardial fibrosis. Furthermore, high local tissue levels of TGFP may allow the maintenance and progression of some types of cancer cells. Down-regulation of TGFP signaling therefore may reduce the viability of such tumor cells.
  • TGF isoforms are -25 kDa homodimeric molecules with a similar structural framework in which two monomers are covalently linked via a disulfide bridge.
  • the mammalian isoforms share a sequence identity of 70-82%, but have non-overlapping activities in vascular development and the regulation of immune cell function.
  • Three TGF isoforms have been reported in humans: TGF i, TGFP2, and TGFP3 (Swiss Prot accession numbers P01137, P08112, and P10600, respectively).
  • TGF i and TGF 3 trigger a cellular signaling cascade upon binding to the extracellular domains of two transmembrane receptors, known as TGF receptor types I and II.
  • TGF 2 may bind to TGF receptor types I and II, as well as TGF receptor type III.
  • Antibodies that can bind human TGF i, TGF 2, and TGF 3 have been tested for clinical use.
  • Griitter et al. disclosed GC1008, a human IgG4 monoclonal antibody (Mab; i.e., GC1008) in clinical development for treating malignancy and fibrotic diseases. Proc. Nat'l Acad. Sci. USA 105(51): 20251-56 (2008).
  • GC1008 is a "pan-specific" TGF neutralizing antibody, because it can neutralize all three human TGF isoforms.
  • TGF i are disclosed, for example, in U.S. Patent No. 6,492,497 and U.S. Patent No. 7,151,169, which are incorporated by reference into this disclosure.
  • Metelimumab also known as CAT 192 (IgG4), is a human IgG4 monoclonal antibody that selectively neutralizes TGF- ⁇ . See e.g., U.S. Patent No. 6,492,497. Metelimumab was tested for the treatment of diffuse cutaneous systemic sclerosis, also known as scleroderma, but demonstrated insufficient efficacy.
  • the present disclosure provides TGF i -binding scFv-Fc dimers that are capable of selectively neutralizing human TGF i .
  • the scFv-Fc dimers are formatted as scFv-Fc fusion proteins comprised of two polypeptide monomers, each monomer comprising a single-chain Fv region (scFv), a hinge, and an Fc region.
  • the VH and VL domains of the scFv-Fc dimer exhibit a higher affinity and avidity to TGF i and more effectively neutralize TGF i than when used in the IgGl or IgG4 format.
  • the scFv component may be composed of the same VH and VL domains as the VH and VL domains of metelimumab.
  • the variable domains in the scFv component may be linked together by a linker, e.g. , a [G 4 S]3-type linker.
  • a linker e.g. , a [G 4 S]3-type linker.
  • Each of the scFv components of the scFv-Fc dimers may be fused via a hinge region, e.g. , a human IgGl or IgG4 hinge region, to an Fc region.
  • the monomers of the dimer may be covalently linked by a disulfide bond between cysteine residues in the hinge region.
  • the scFv-Fc dimers may have structural dissimilarities to metelimumab, most notably the absence of CHi and CL domains and the presence of a linker between the VH and VL domains.
  • the scFv- Fc dimers display an apparent affinity toward TGF i nearly two orders of magnitude greater than that of an scFv comprising the same VH and VL domains
  • the scFv-Fc dimers display an apparent affinity toward TGF i over three orders of magnitude greater than that of an IgG- formatted antibody comprising the same VH and VL domains (e.g. , CAT192) in the A549 cell bioassay.
  • the scFv-Fc dimers also display desirable stability and pharmacokinetic properties. Because of their relatively small size and extended half- life in serum, the scFv-Fc dimers are particularly useful for therapeutic applications.
  • the present invention is directed to an isolated binding protein comprising a variable domain that is capable of binding TGF i , wherein the binding protein exhibits a Kd for human TGF i at least about 50% lower than the Kd of the same binding protein for human TGF 2, as measured by surface plasmon resonance.
  • the present invention is directed to an isolated binding protein comprising a variable domain that is capable of binding TGF i , wherein the binding protein exhibits a Kd for human TGF i at least about 50% lower than the Kd of the same binding protein for human TGF 3, as measured by surface plasmon resonance.
  • the present invention is directed to an isolated binding protein comprising a variable domain that is capable of binding TGF i , wherein the binding protein exhibits a Kd for human TGF i at least about 50% lower than the Kd of the same binding protein for human TGF 2, and at least about 50% lower than the Kd of the same binding protein for human TGF 3, as measured by surface plasmon resonance.
  • the present invention is directed to an isolated binding protein that binds TGF i , wherein the binding protein comprises a first polypeptide chain and a second polypeptide chain, the first and the second polypeptide chains each having the formula of:
  • VDi comprises a first variable domain selected from the group consisting of a VL domain isolated from an antibody capable of binding TGF i, and a VH domain isolated from an antibody capable of binding TGF i
  • VD2 comprises a second variable domain selected from the group consisting of a VL domain isolated from an antibody capable of binding TGF i, and a VH domain isolated from an antibody capable of binding TGF i
  • n is 0 or 1
  • m is 0 or 1
  • p is 0 or 1.
  • the present invention is directed to an isolated TGF i- binding scFv-Fc dimer that selectively binds TGF i.
  • the scFv-Fc dimer may comprise two polypeptide monomers, each having the following formula, from N- terminal to C-terminal: (VH domain)- (linker) -(VL domain)-(hinge)-(Fc region).
  • an isolated binding protein that binds TGF i is disclosed, which comprises a first polypeptide chain and a second polypeptide chain.
  • the first and the second polypeptide chains may both have the formula of, from N-terminal to C- terminal: (VH domain)-(linkerl) n -(VL domain)-(linker2) m -(hinge) p -(Fc region), p may be 0 or 1, n may be 0 or 1, and m may be 0 or 1.
  • the first and second polypeptide chains may be identical and may form a dimer.
  • the disclosed TGF i binding protein may comprise a polypeptide chain having the formula of, from N-terminal to C-terminal: (VH domain)-(linkerl) n -(VL domain)-(linker2) m -(hinge) p -(Fc region), wherein p may be 0 or 1, n may be 0 or 1, and m may be 0 or 1.
  • the VH domain of the disclosed binding protein may comprise a variable heavy complementarity determining region 1 (HCDR1) , a variable heavy complementarity determining region 2 (HCDR2), and a variable heavy
  • the HCDR1 may have the amino acid sequence of SEQ ID NO: 22,
  • the HCDR2 may have the amino acid sequence of SEQ ID NO: 23, and the HCDR3 may have the amino acid sequence of SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 30.
  • the framework regions of the VH domain may be selected from a variable heavy germline sequence.
  • the VH domain may be selected, for example, from the human VH domain sequences set forth in SEQ ID NO: 1 or SEQ ID NO: 2, or a variant thereof having modifications in up to four amino acids.
  • the VL domain of the disclosed binding protein may comprise a variable light complementarity determining region 1 (LCDR1) , a variable light complementarity determining region 2 (LCDR2), and a variable light complementarity determining region 3 (LCDR3).
  • the LCDR1 may have the amino acid sequence of SEQ ID NO: 27
  • the LCDR2 may have the amino acid sequence of SEQ ID NO: 28
  • the LCDR3 may have the amino acid sequence of SEQ ID NO: 29.
  • the framework regions of the VL domain may be selected from a variable lambda or kappa germline sequence.
  • the VL domain may be selected, for example, from the human VK domain sequences set forth in SEQ ID NO: 5 or SEQ ID NO: 6, or a variant thereof having modifications of up to four amino acids.
  • each polypeptide of the dimer may comprise the VH domain set forth in SEQ ID NO: 1 and the VK domain set forth in SEQ ID NO: 5, which are the VH and VL domains present in metelimumab, respectively.
  • variable domains in the scFv component may be linked by a flexible linker about 15 amino acids in length.
  • “About” in this context means the linker can vary by up to plus or minus four amino acids in length.
  • the linker is composed predominantly of glycine and serine residues.
  • the linker may be a [G 4 S]3-type linker.
  • the linker may have the amino acid sequence SGGGSGGGGSGGGGS (SEQ ID NO: 3), the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO: 4), or a variant thereof having up to four amino acid modifications.
  • “having up to x amino acids modifications” means that the up to x number of amino acids may be changed to different amino acids by one of skill in the art without significantly altering the structure and function of the polypeptide.
  • p is 1 and the scFv component is connected to an Fc region by a hinge.
  • the hinge may comprise amino acid sequences derived from a human IgGl or IgG4 hinge region.
  • the hinge may comprise the amino acid sequence PKSCDKTHTCPPCPAPELLGGP (SEQ ID NO: 7), or a variant thereof having up to four amino acid modifications.
  • the hinge length may vary from 3-15 amino acids.
  • the hinge is from a human IgGl, it may comprise the amino acid sequence CPPCP (SEQ ID NO: 21).
  • the variant of the hinge of SEQ ID NO: 7, which is also a human IgGl hinge may comprise the amino acid sequence CPPCP (SEQ ID NO: 21).
  • linker2 may comprise the amino acid sequence GGSG (SEQ ID NO: 20), or a variant thereof having up to 2 amino acid modifications.
  • the Fc region may comprise two or three constant domains, e.g., a C3 ⁇ 4 domain and C3 ⁇ 4 domain.
  • the Fc region may be obtained from a human IgGl, a human IgG4, or a variant of a human IgGl or IgG4 having up to ten amino acid modifications, for example.
  • each polypeptide of the dimer has the sequence set forth in SEQ ID NO: 9.
  • the structure of the scFv-Fc dimer of SEQ ID NO: 9 is shown in FIG. 2.
  • the scFv-Fc dimer may bind TGF i selectively.
  • the scFv-Fc dimer may show an apparent dissociation constant less than 1 nM or even less than 0.1 nM.
  • the apparent dissociation constant may be measured by using an A549 bioassay or by surface plasmon resonance, for example.
  • an isolated polynucleotide which may comprise a nucleotide sequence encoding the scFv-Fc dimer.
  • the isolated polynucleotide may be a cDNA, a recombinant DNA or a synthetic DNA.
  • a host cell may comprise the isolated nucleic acid.
  • the host cell may be a human cell, such as a Human Embryonic Kidney 293 (HEK293) cell and cell lines derived therefrom, or it may be a Chinese Hamster Ovary (CHO) cell.
  • a method of making the scFv-Fc dimer may include culturing the host cell under suitable conditions to produce the scFv-Fc dimer.
  • the scFv-Fc dimer may be purified. The degree of purity may be 90%, 95%, 99%, 99.5% or more.
  • the scFv-Fc dimer of the present invention may be an element of a composition.
  • the composition may be a pharmaceutical composition.
  • the pharmaceutical composition may comprise a therapeutically effective amount of the scFv-Fc dimer.
  • the composition may further comprise one or more biologically active components, excipients, or diluents.
  • a method of treating a disease or condition resulting directly or indirectly from TGF i activity in a human may comprise administering a pharmaceutical composition comprising a therapeutically effective amount of the scFv-Fc dimer.
  • the disease or condition may be selected from the group consisting of a fibrotic disease, cancer, an immune-mediated disease, e.g., diffuse cutaneous systemic sclerosis, bone remodeling disease, kidney disease and/or combinations thereof.
  • the scFv-Fc dimer may be used in the manufacture of a medicament for treatment of a disease or disorder selected from the group consisting of a fibrotic disease, cancer, an immune- mediated disease, e.g., diffuse cutaneous systemic sclerosis, bone remodeling disease, kidney disease and/or combinations thereof.
  • the treatment of the disease or disorder may comprise neutralizing TGF i or inhibiting TGF i signaling.
  • the treatment of the disease or disorder may comprise inhibiting TGF i -mediated fibronectin production, vascular endothelial growth factor (VEGF) production, epithelial cell proliferation, endothelial cell proliferation, smooth muscle cell proliferation, or immunosuppression.
  • the treatment of the disease or disorder may comprise increasing natural killer cell activity.
  • FIG. 1 depicts the general structures of the various formats.
  • FIG. 2 depicts the results of a Biacore TGF i binding assay which showed the loss of affinity when the scFv(CAT191) was converted into a full length IgG4 (CAT 192) molecule.
  • FIG. 3 shows the results of an A549 cell bioassay comparing the inhibitory effects by various antibody constructs on TGF i -stimulated IL-11 production: scFv diabody 5aa (SEQ ID NO: 14); CAT191(scFv) (SEQ ID NO: 12); CAT191(scFv-Fc) (SEQ ID NO: 9); and CAT192(IgG4) (light chain SEQ ID NO: 10 and heavy chain SEQ ID NO: 11).
  • FIG. 4 depicts the results of pharmacokinetic tests to determine the half- life of CAT191 (scFv-Fc) following intravenous (IV) administration.
  • FIG. 5 depicts the results of pharmacokinetic tests to determine the half- life of CAT191 (scFv-Fc) following intraperitoneal (IP) administration.
  • FIG. 6 shows the TGF i- specific binding results of CAT191(scFv-Fc) prepared from CHO cells.
  • FIG. 7 shows the cell-based potency assay results of CAT191(scFv-Fc) prepared from CHO cells. DETAILED DESCRIPTION OF THE INVENTION
  • the disclosed scFv-Fc dimers bind and neutralize TGF i selectively and with high affinity and avidity.
  • the scFv regions may be composed of the same VH and VL domains as in metelimumab.
  • scFv-Fc dimers advantageously show greater efficacy in neutralizing TGF i than when the variable domains are used in other formats. Because of their relatively small size and extended half- life in serum, the present scFv-Fc dimers are ideal candidates for therapeutic applications.
  • first element “and/or” a second element means a specific disclosure of the first or second element separately, or the first and second elements in combination.
  • the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise.
  • nucleic acid or protein is removed and/or altered from its natural form using genetic engineering technologies.
  • a “purified” nucleic acid or protein may be substantially pure, e.g., at least 90% pure, or in homogeneous form.
  • binding protein e.g., scFv-Fc dimer
  • the binding protein is capable of binding human TGF i with a higher affinity than binding to human TGF 2 or human TGF 3, e.g., with a dissociation constant with human TGF i at least 50% lower than its dissociation constant with human TGF 2 or human TGF 3, as measured by surface plasmon resonance.
  • the present scFv-Fc dimer variable domains comprise complementarity determining regions (CDRs) from the CDRs disclosed in U.S. Patent
  • LCDR1 RASQGIGDDLG SEQ ID No. 27
  • LCDR2 GTSTLQS SEQ ID No. 28
  • Xi may be any amino acid (preferably E, or F), or absent,
  • X2 may be any amino acid (preferably S, D, or P), or absent,
  • X 3 may be any amino acid (preferably G, P, or A), or absent,
  • X 4 may be any amino acid (preferably V, Q, or S), or absent,
  • X5 may be any amino acid (preferably E, Y, or P), or absent,
  • X 6 may be any amino acid (preferably L, S, or D), or absent.
  • the VH domain comprises the HCDR1 of SEQ ID No. 22, the HCDR2 of SEQ ID No. 23, and one of the HCDR3s selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, and SEQ ID No. 30.
  • the CDR sequences may be separated by anywhere from one to four framework regions, in order from the N-terminal: FW1 - CDR1 - FW2 - CDR2 - FW3 - CDR3 - FW4.
  • the framework regions of the VH domain may be selected from a variable heavy germline sequence. In one embodiment, the FW region sequences may be selected from the same human variable heavy germline sequence.
  • the VL domain comprises the LCDR1 of SEQ ID NO: 7, the LCDR2 of SEQ ID NO: 28, and the LCDR3 of SEQ ID NO: 29.
  • the framework regions of the VL domain may be selected from a variable lambda or kappa germline sequence, e.g., from the same human variable lambda or kappa germline sequence.
  • about 40 variable heavy germline sequences are known in the art, as are about 40 variable kappa germline sequences and about 30 variable lambda germline sequences, e.g., VH3, VKI, VH 1-69, and VH 1- e.
  • composite VH or VL domains may be generated by using the CDR sequences disclosed herein.
  • crystal structures of the VH or VL domains may be used as a guidance to generate composite domain using CDR sequences from one antibody and using the germline FW regions from another antibody. More details can be found in U.S. Patent Application Publication No.
  • the present scFv-Fc dimers may be composed of the same VH and VL domains as in metelimumab, having the sequences set forth in SEQ ID NO: 1 and SEQ ID NO: 5, respectively.
  • the VH domain may be replaced by the VH domain having the sequences set forth in SEQ ID NO: 2; the VL domain may be replaced by the VL domain having the sequences set forth in SEQ ID NO: 6.
  • These VH and VL domains are disclosed in U.S. Patent No. 6,492,497 (e.g., SEQ ID NOS: 4, 6, 8, and 10), incorporated herein by reference.
  • variable domain refers to a hypervariable binding domain of an immunoglobulin, or a ligand binding domain of a receptor, involved in antigen/ligand binding as is known by persons skilled in the art. Variable domains are routinely referred to by their location or origin within an immunoglobulin; e.g., variable domains of the light chain of an immunoglobulin (VL), variable domains of the heavy chain of an immunoglobulin (VH), variable domains of the heavy chain of a camelid immunoglobulin (VHH).
  • VL variable domains of the light chain of an immunoglobulin
  • VH variable domains of the heavy chain of an immunoglobulin
  • VHH camelid immunoglobulin
  • variable domain comprises amino acid additions, substitutions, and/or deletions, compared to the reference sequence.
  • a “variant" of the VH or VL domains may have up to four such amino acid modifications.
  • one of the two domains may comprise an amino acid substitution, while the other domain is unmodified, or both of the domains may comprise amino acid substitutions.
  • Modifications that add or delete amino acid residues may be made at the N-terminus or C-terminus of the VH or VL domain.
  • the N-terminal residue of the VH domain may be deleted.
  • De-immunization can be performed according to the method of Harding et al. (2010) mAbs 2: 256-265, for example.
  • Framework residues of the VH and/or VL domains may be substituted to increase the stability of the scFv-Fc dimers and/or decrease their tendency to aggregate. Poor stability can affect the ability of the expressed scFv-Fc dimers to fold properly when recombinantly expressed, resulting in a fraction of the expressed antibodies being non-functional. Low stability antibodies also may be prone to forming potentially immunogenic aggregates or may have impaired avidity or shelf- life. scFv polypeptides in particular may demonstrate problems with stability, solubility, expression, aggregation, breakdown products, and overall manufacturability in both bacterial and mammalian expression systems.
  • Framework amino acid substitutions that are expected to increase the stability and/or decrease the tendency to aggregate of a VH and/or VL domain, e.g., in an scFv polypeptide, are disclosed in WO 2007/109254, for example. Substitutions in corresponding residues in the present VH and VL domains are expected similarly to increase stability and/or decrease the tendency of scFv-Fc dimers to aggregate.
  • substitutions that can be tolerated are expected to include those that would replace an amino acid of SEQ ID NO: 1, 2, 5, or 6 with a corresponding amino acid that occurs in another human VH or VL domain germline sequence.
  • a substitution of a framework amino acid with an amino acid occurring in any of these germline sequences may be tolerated.
  • a residue of a VH domain of SEQ ID NO: 1 could be substituted with an amino acid appearing in a corresponding position in any VH germline sequence, e.g., the germline sequence from DP- 10 (VH 1-69) or DP-88 (VH 1-e).
  • Corresponding positions in this case are determined by a sequence alignment between the various germline sequences, using alignment techniques well known in the art, e.g., ClustalW.
  • substitutions that are expected to be tolerated are those made to an amino acid with most of its side chain exposed to the solvent, as determined by analysis of the three co-crystal structures.
  • the solvent-accessible surface area of a residue may be estimated using techniques well known in the art.
  • substitutions to amino acids buried within the variable domains will be better tolerated if the side chain of the amino acid does not create steric hindrance with adjoining residues. For this reason, buried amino acids generally are substituted with amino acids with side chains of similar or smaller size. For example, a substitution of a buried He residue with a Leu, Val, Ala, or Gly is expected to be tolerated.
  • variable domains include those expected to confer new useful properties to the antibodies or antigen-binding fragments thereof.
  • putative N-glycosylation sites in the VH and/or VL domains can be removed to prevent or reduce the formation of N-glycoforms.
  • the amino-terminal residue can be substituted with a Gin residue to cause
  • variable domains can be substituted with Cys or Lys residues, for example, which then can be covalently modified and coupled to molecules conferring useful characteristics to the antibodies or antigen-binding fragments thereof, e.g., a detectable label, toxin, targeting moiety, or protein.
  • Cys residue can be coupled to a cytotoxic drug to form a drug conjugate.
  • Cys residues also can be coupled to molecules that increase the serum half- life, e.g., polyethylene glycol (PEG) or serum albumin.
  • PEG polyethylene glycol
  • serum albumin Such amino acid modifications are reviewed in Beck et al. (2010) Nature 10: 345-52, for example.
  • Detectable labels include radiolabels such as 131 I or 99 Tc, which may be attached to antibodies or antigen-binding fragments thereof using methods known in the art. Labels also include enzyme labels such as horseradish peroxidase. Labels further include chemical moieties such as biotin which may be detected via binding to a specific cognate detectable moiety, e.g., labeled avidin. Other moieties can be attached that facilitate purification. For example, antibodies or antigen-binding fragments thereof can be His-tagged using well-known methods of recombinant modification and expression.
  • Linkerl The VH and VL domains of the scFv-Fc dimers are linked together by a linker, termed Linkerl herein.
  • Linkers suitable for making an scFv fragment are well known in the art. See, e.g. , Bird et al. (1988) Science, 242: 423-426; Huston et al. (1988) Proc. Nat'l Acad. Sci. USA 85 : 5879-5883. This can be accomplished by fusing the encoding nucleic acids in-frame and expressing the fusion protein in a suitable host cell, for example. Suitable linkers include those of the [G 4 S]3-type.
  • the [G 4 S]3-type linkers are composed of repeating units of glycine and serine residues. Such linkers may have a sequence of SGGGSGGGGSGGGGS (SEQ ID NO: 3) or GGGGSGGGGSGGGGS (SEQ ID NO: 4) or a variant thereof having up to four amino acid modifications, for example. Modifications can include deletions or insertions that change the linker length, or amino acid substitutions, preferably from Gly to Ser or vice versa.
  • [G 4 S]3-type linkers have been widely used to link variable domains in an scFv structure, because the linkers are hypoallergenic and causes minimal conformational distortions to the variable domains. See, e.g. , Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85: 5879-83.
  • Linker2 In the scFv-Fc dimers, a short linker sequence, termed Linker2 herein, is optionally inserted between the VL domain and the hinge. This linker sequence increases the flexibility of the scFv component with respect to the Fc component.
  • Linker2 has the sequence of GGSG (SEQ ID NO: 20). Suitable modifications to the GGSG linker include altering its length by one to four amino acids or substituting one to two amino acids, preferably from Gly to Ser or vice versa.
  • the hinge region is a flexible domain that joins the scFv portion to the Fc region.
  • the flexibility of the hinge region in IgG and IgA molecules allows the Fab arms to adopt a wide range of angles, permitting binding to epitopes spaced variable distances apart.
  • a suitable hinge region includes, for example, the human IgGl hinge region having the amino acid sequence PKSCDKTHTCPPCPAPELLGGP (SEQ ID NO: 7). This sequence corresponds to a portion of the human IgGl upper hinge, the middle hinge, and an N-terminal portion of the CH 2 domain, as disclosed in FIG. 4B of U.S. Patent No. 8,048,421, for example.
  • the hinge from a human IgGl contains two Cys residues, which can form disulfide bonds with the Cys residues of the hinge on the corresponding monomer.
  • the human IgGl hinge portion that forms the disulfide bonds contains the amino acid sequence CPPCP (SEQ ID NO: 21). Variants of a human IgGl hinge may comprise this sequence.
  • the scFv component is fused in frame to an Fc region, which forms the Fc component of the dimer.
  • Suitable Fc regions contain two or three constant regions.
  • Fc regions include those from human IgGl, as set forth in SEQ ID NO: 8, or IgG4, as set forth in the Cl3 ⁇ 4 and Ct1 ⁇ 4 domains of SEQ ID NO: 11.
  • the Fc region of an antibody mediates its serum half-life and effector functions, such as complement- dependent cytotoxicity (CDC), antibody-dependent cellular cytotoxicity (ADCC) and antibody-dependent cell phagocytosis (ADCP).
  • Modifications can be made to the hinge and Fc region to improve various properties of the scFv-Fc dimers.
  • one, two, three, four , five or up to ten amino acids of a naturally occurring human Fc region can be modified, in addition to modifications of the hinge region.
  • the Fc region can be modified to increase the serum half- life of the scFv-Fc dimer.
  • the half-life of an IgG depends on its pH-dependent binding to the receptor FcRn.
  • FcRn which is expressed on the surface of endothelial cells, binds the IgG in a pH-dependent manner and protects it from degradation.
  • the four human IgG isotypes bind the activating Fey receptors (FcyRI, FcyRIIa, FcyRIIIa), the inhibitory FcyRIIb receptor, and the first component of complement (Clq) with different affinities, resulting in different effector functions. Binding of IgG to the FcyRs or Clq, for example, depends on residues located in the IgG hinge region and Cl3 ⁇ 4 domain. Single or multiple amino acid substitutions of these residues can affect effector function by modulating the IgG interaction with FcyRs or Clq. Other substitutions are known to affect effector function. These modifications are reviewed in Strohl (2009) "Optimization of Fc-mediated effector functions of monoclonal antibodies," Curr. Opin. Biotechnol. 20:685-91, for example.
  • Amino acid modifications to a CH3 domain also can be used to delete carboxy-terminal Lys residues to decrease the number of charge variants.
  • Amino acid modifications also can be used to improve the pharmacological function of recombinant antibodies or antigen-binding fragments thereof.
  • amino acid modifications can be used to increase complement activation, enhance antibody-dependent cellular cytotoxicity (ADCC) by increasing FcyRIIIA binding or decreasing FcyRIIIB binding, and/or increase serum half- life by increasing FcRn binding.
  • ADCC enhance antibody-dependent cellular cytotoxicity
  • a further aspect of the present invention provides nucleic acids encoding scFv-Fc dimers.
  • the isolated nucleic acid may be a synthetic DNA, a non-naturally occurring mRNA, or a cDNA, for example. Examples include the nucleic acids encoding the VH and VL domains set forth in SEQ ID NOS: 3, 5, 7, and 9 of U.S.
  • Additional nucleic acids include the sequence set forth in SEQ ID NO: 13 of the present invention, which encodes the diabody-5aa set forth in SEQ ID NO: 14, and the sequence set forth in SEQ ID NO: 15, which encodes the leucine zipper peptide-derived dimer having the amino acid sequence set forth in SEQ ID NO: 16.
  • Additional nucleic acids include the sequence set forth in SEQ ID NO: 17, which encodes CAT191(scFv-Fc), which has the amino acid sequence set forth in SEQ ID NO: 9.
  • the nucleic acid may be inserted within a plasmid, vector, or transcription or expression cassette.
  • the nucleic acids encoding the scFv-Fc dimers may be made and the expressed antibodies may be tested using conventional techniques well known in the art, such as disclosed in Borsi et al. (2002) Int. J.
  • a recombinant host cell may comprise one or more constructs above.
  • Methods of preparing scFv-Fc dimers comprise expressing the encoding nucleic acid in a host cell under conditions to produce the scFv-Fc dimers, and recovering the antibodies.
  • the process of recovering the antibodies may comprise isolation and/or purification of the antibodies.
  • the method of production may comprise formulating the antibodies into a composition including at least one additional component, such as a pharmaceutically acceptable excipient.
  • host cell is intended to refer to a cell into which exogenous DNA has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell, but, to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell” as used herein.
  • host cells include prokaryotic and eukaryotic cells selected from any of the Kingdoms of life.
  • Preferred enkaryotic cells include protist, fungal, plant and animal cells. Most preferably host cells include but are not limited to the prokaryotic cell line E. Coli; mammalian cell lines CHO, HEK 293 and COS; the insect cell line Sf9; and the fungal cell
  • Suitable vectors comprising a nucleic acid encoding scFv-Fc dimers can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator sequences, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
  • Vectors may be plasmids, phage, phagemids, adenoviral, AAV, lentiviral, for example.
  • Techniques and protocols for manipulation of nucleic acid for example in preparation of nucleic acid constructs, mutagenesis, sequencing, introduction of DNA into cells, and gene expression, are well known in the art.
  • vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • viral vector Another type of vector, wherein additional DNA segments may be ligated into the viral genome.
  • vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • Other vectors e.g., non-episomal mammalian vectors
  • certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors").
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • plasmid and “vector” may be used interchangeably as the plasmid is the most commonly used form of vector.
  • the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adena-associated viruses), which serve equivalent functions.
  • viral vectors e.g., replication defective retroviruses, adenoviruses and adena-associated viruses
  • nucleic acids into a host cell can be accomplished using techniques well known in the art.
  • suitable techniques may include calcium phosphate transfection, DEAE-Dextran, electroporation, liposome- mediated transfection, and transduction using retroviruses or other viruses, for example.
  • suitable techniques may include calcium chloride transformation, electroporation, and transfection using bacteriophage.
  • the introduction may be followed by causing or allowing expression from the nucleic acid, e.g. by culturing host cells under conditions for expression of the gene.
  • the nucleic acid of the invention is integrated into the genome, e.g., chromosome, of the host cell. Integration may be promoted by inclusion of sequences which promote recombination with the genome, in accordance with standard techniques.
  • Suitable host cells include bacteria, mammalian cells, plant cells, insect cells, fungi, yeast and transgenic plants and animals.
  • Mammalian cell lines available in the art for expression of a heterologous polypeptide include Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney cells, mouse melanoma cells, rat myeloma cells, human embryonic kidney cells, e.g., HEK293 cells, human embryonic retina cells, and many others.
  • the expression of antibodies and antibody fragments in prokaryotic cells, such as E. coli is well established in the art.
  • scFv-Fc dimers may be glycosylated, either naturally or the choice of expression host, e.g., CHO, HEK293, or NSO (ECACC 85110503) cells, or they may be unglycosylated, for example if produced by expression in a prokaryotic cell.
  • Glycosylation may also be intentionally altered, for example by inhibiting fucosylation, in order to increase ADCC activity of the resulting scFv-Fc dimer.
  • the scFv-Fc dimers may be used in a method of treatment or diagnosis of the human or animal body, such as a method of treatment (which may include prophylactic treatment) of a disease or disorder in a human patient, which comprises administering an effective amount to treat the patient.
  • Treatable conditions include any in which TGF i plays a role, e.g., a fibrotic disease, cancer, an immune-mediated disease, and wound healing, e.g., diffuse systemic sclerosis, bone remodeling disease, kidney disease and/or combinations thereof.
  • TGF i TGF i glomerulonephritis
  • neural scarring Logan et al. (1994) Eur. J. Neurosci. 6: 355- 363
  • dermal scarring Shah et al. (1992) Lancet 339: 213-214; Shah et al. (1994) /. Cell Science 107: 1137-1157; Shah et al. (1995) /. Cell Science 108: 985-1002
  • pulmonary fibrosis Giri et al. (1993) Thorax 48: 959-966.
  • TGF i, 2, and 3 have been shown to be effective in models of lung fibrosis, radiation induced fibrosis (U.S. Patent No. 5,616,561), myelofibrosis, burns, Dupuytren's contracture, gastric ulcers, and rheumatoid arthritis (Wahl et al. (1993) Exp. Medicine 111: 225-230).
  • the scFv-Fc dimers are useful to treat a disease and condition resulting directly or indirectly from TGF i activity.
  • the scFv-Fc dimers may selectively inhibit the activity of a human TGF i isoform in vitro or in vivo.
  • TGF i isoforms include, but are not limited to, TGF -mediated signaling, extracellular matrix (ECM) deposition, inhibiting epithelial and endothelial cell proliferation, promoting smooth muscle proliferation, inducing Type III collagen expression, inducing TGF- ⁇ , fibronectin, VEGF, and IL-11 expression, binding Latency Associated Peptide, tumor-induced immunosuppression, promotion of angiogenesis, activating myofibroblasts, promotion of metastasis, and inhibition of NK cell activity.
  • ECM extracellular matrix
  • the scFv-Fc dimers are useful to treat focal segmental glomerulosclerosis (FSGS), hepatic fibrosis (HF), acute myocardial infarction (AMI), idiopathic pulmonary fibrosis (IPF), scleroderma (SSc), and Marfan Syndrome.
  • FSGS focal segmental glomerulosclerosis
  • HF hepatic fibrosis
  • AMI acute myocardial infarction
  • IPF idiopathic pulmonary fibrosis
  • SSc scleroderma
  • Marfan Syndrome Marfan Syndrome
  • the scFv-Fc dimers are useful to treat diseases and conditions including, but not limited to, a fibrotic diseases (such as glomerulonephritis, neural scarring, dermal scarring, pulmonary fibrosis, lung fibrosis, radiation induced fibrosis, hepatic fibrosis, myelofibrosis), burns, immune mediated diseases, inflammatory diseases (including rheumatoid arthritis), transplant rejection, cancer, Dupuytren's contracture, and gastric ulcers.
  • a fibrotic diseases such as glomerulonephritis, neural scarring, dermal scarring, pulmonary fibrosis, lung fibrosis, radiation induced fibrosis, hepatic fibrosis, myelofibrosis
  • a fibrotic diseases such as glomerulonephritis, neural scarring, dermal scarring, pulmonary fibrosis, lung fibrosis, radiation induced fibrosis, hepatic fibro
  • renal insufficiencies including but not limited to: diabetic (type I and type II) nephropathy, radiation-induced nephropathy, obstructive nephropathy, diffuse systemic sclerosis, pulmonary fibrosis, allograft rejection, hereditary renal disease (e.g., polycystic kidney disease, medullary sponge kidney, horseshoe kidney), glomerulonephritis, nephrosclerosis, nephrocalcinosis, systemic lupus erythematosus, Sjogren's syndrome, Berger's disease, systemic or glomerular hypertension, tubulointerstitial nephropathy, renal tubular acidosis, renal tuberculosis, and renal infarction.
  • diabetic type I and type II
  • radiation-induced nephropathy obstructive nephropathy
  • diffuse systemic sclerosis e.g., pulmonary fibrosis
  • pulmonary fibrosis fibrosis
  • renin- angiotensin-aldosterone system including, but not limited to: renin inhibitors, angiotensin-converting enzyme (ACE) inhibitors, Ang II receptor antagonists (also known as "Ang II receptor blockers”), and aldosterone antagonists.
  • ACE angiotensin-converting enzyme
  • Ang II receptor antagonists also known as "Ang II receptor blockers”
  • aldosterone antagonists aldosterone antagonists.
  • the scFv-Fc dimers also are useful to treat diseases and conditions associated with the deposition of ECM, including, systemic sclerosis, postoperative adhesions, keloid and hypertrophic scarring, proliferative vitreoretinopathy, glaucoma drainage surgery, corneal injury, cataract, Peyronie's disease, adult respiratory distress syndrome, cirrhosis of the liver, post myocardial infarction scarring, post angioplasty restenosis, scarring after subarachnoid hemorrhage, multiple sclerosis, fibrosis after laminectomy, fibrosis after tendon and other repairs, scarring due to tattoo removal, biliary cirrhosis (including sclerosing cholangitis), pericarditis, pleurisy,
  • diseases and conditions associated with the deposition of ECM including, systemic sclerosis, postoperative adhesions, keloid and hypertrophic scarring, proliferative vitreoretinopathy, glaucoma
  • tracheostomy penetrating central nervous system injury, eosinophilic myalgic syndrome, vascular restenosis, veno-occlusive disease, pancreatitis and psoriatic arthropathy.
  • the scFv-Fc dimers further are useful to promote re-epithelialization in diseases and conditions such as venous ulcers, ischaemic ulcers (pressure sores), diabetic ulcers, graft sites, graft donor sites, abrasions and burns, diseases of the bronchial epithelium, such as asthma, ARDS, diseases of the intestinal epithelium, such as mucositis associated with cytotoxic treatment, esophageal ulcers (reflux disease), stomach ulcers, small intestinal and large intestinal lesions (inflammatory bowel disease).
  • diseases and conditions such as venous ulcers, ischaemic ulcers (pressure sores), diabetic ulcers, graft sites, graft donor sites, abrasions and burns, diseases of the bronchial epithelium, such as asthma, ARDS, diseases of the intestinal epithelium, such as mucositis associated with cytotoxic treatment, esophageal ulcers (reflux disease),
  • the scFv-Fc dimers also may be used to promote endothelial cell proliferation, for example, in stabilizing atherosclerotic plaques, promoting healing of vascular anastomoses, or to inhibit smooth muscle cell proliferation, such as in arterial disease, restenosis and asthma.
  • the scFv-Fc dimers are useful to enhance the immune response to
  • macrophage-mediated infections are also useful to reduce immunosuppression caused, for example, by tumors, AIDS, or granulomatous diseases.
  • the scFv-Fc dimers are useful to treat hyperproliferative diseases, such as cancers including, but not limited to, breast, prostate, ovarian, stomach, renal, pancreatic, colorectal, skin, lung, cervical and bladder cancers, glioma, mesothelioma, as well as various leukemias and sarcomas, such as Kaposi's sarcoma, and are useful to treat or prevent recurrences or metastases of such tumors.
  • the scFv-Fc dimers of the invention also are useful to inhibit cyclosporin-mediated metastases.
  • treatment includes any medical
  • Methods of treatment comprise administering a scFv-Fc dimer or
  • compositions comprising the scFv-Fc dimer.
  • the scFv-Fc dimers may be used in the manufacture of a medicament for administration.
  • a method of making a medicament or pharmaceutical composition comprises formulating a scFv-Fc dimer with a pharmaceutically acceptable excipient.
  • a composition may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
  • Administration is preferably in a "therapeutically effective amount" sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom of a particular disease or condition.
  • the actual amount administered, and rate and time-course of administration, will depend on the nature and severity of the disease or condition being treated. Prescription of treatment, e.g., decisions on dosage etc., may be determined based on preclinical and clinical studies the design of which is well within the level of skill in the art.
  • the precise dose will depend upon a number of factors, including whether the scFv-Fc dimer is for diagnosis or for treatment, the size and location of the area to be treated, and the nature of any detectable label or other molecule attached to the scFv- Fc dimer.
  • a typical dose of a scFv-Fc dimer for example, can be in the range 100 ⁇ g to 1 gram for systemic applications, and 1 ⁇ g to 1 mg for topical applications.
  • the dose for a single treatment of an adult patient may be adjusted proportionally for children and infants. Treatments may be repeated at daily, twice-weekly, weekly, monthly or other intervals, at the discretion of the physician. Treatment may be periodic, and the period between administrations is about two weeks or more, preferably about three weeks or more, more preferably about four weeks or more, or about once a month.
  • Dose levels of about 0.1, 0.3, 1, 3, 10, or 15 mg per kg body weight of the patient are expected to be useful and safe.
  • 0.5-5 mg/kg in rat and mouse has been an effective dose in an acute setting. Therefore, for long-term dosing, 0.3-10 mg/kg may be administered to humans, based on an expected half- life of 21 days.
  • Doses may be sufficient for efficacy, while low enough to facilitate optimal administration.
  • a dose of less than 50 mg facilitates subcutaneous administration.
  • Intravenous administration may be used as the route of delivery for severe diseases, where high doses and the long dosing intervals may be required.
  • Subcutaneous injection can increase the potential immune response to a product.
  • Local administration for localized disease can reduce the amount of administered product and increase the concentration at the site of action, which can improve safety.
  • the scFv-Fc dimers of the invention may be administered by injection, for example, subcutaneously, intravenously, intracavity (e.g., after tumor resection), intralesionally, intraperitoneally, or intramuscularly.
  • ScFv-Fc dimers also may be delivered by inhalation or topically (e.g., intraocular, intranasal, rectal, into wounds, on skin), or orally.
  • a scFv-Fc dimer will usually be administered in the form of a pharmaceutical composition, which may comprise at least one component in addition to the scFv-Fc dimer.
  • pharmaceutical compositions may comprise a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. Such materials could include, for example, any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic, and absorption delaying agents.
  • Some examples of pharmaceutically acceptable carriers are water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, and the like, as well as combinations thereof.
  • isotonic agents for example, sugars, polyalcohols, such as mannitol, sorbitol, or sodium chloride in the composition.
  • additional examples of pharmaceutically acceptable substances are wetting agents or auxiliary substances, such as emulsifying agents, preservatives, or buffers, which increase the shelf life or effectiveness.
  • the carrier or other material will depend on the route of administration.
  • the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen- free and has suitable pK, isotonicity, and stability.
  • a parenterally acceptable aqueous solution which is pyrogen- free and has suitable pK, isotonicity, and stability.
  • isotonic vehicles such as sodium chloride injection, Ringer's injection, and lactated Ringer's injection.
  • Preservatives, stabilizers, buffers, antioxidants, and/or other additives may be included.
  • a scFv-Fc dimer may be formulated in liquid, semi-solid, or solid forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or
  • Formulations may include excipients, or combinations of excipients, for example: sugars, amino acids and surfactants.
  • Liquid formulations may include a wide range of scFv-Fc dimer concentrations and pH. Solid formulations may be produced by lyophilization, spray drying, or drying by supercritical fluid technology, for example.
  • compositions can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
  • Sterile injectable solutions can be prepared by incorporating the scFv-Fc dimer in an appropriate solvent with one or a combination of ingredients enumerated above, followed by filtered sterilization.
  • dispersions are prepared by
  • a sterile vehicle that contains a basic dispersion medium and other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile- filtered solution thereof.
  • the proper fluidity of a solution can be maintained, for example, by using a coating such as lecithin, by maintaining the particle size of a dispersion, or by using surfactants.
  • Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • the active compound may be prepared with a carrier that will protect the scFv-Fc dimer against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
  • a controlled release formulation including implants, transdermal patches, and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art.
  • a method of using a scFv-Fc dimer may comprise causing or allowing binding to TGF .
  • Such binding may take place in vivo, e.g., following administration of a scFv-Fc dimer to a patient, or it may take place in vitro, e.g., in ELISA, Western blotting, immunocytochemistry, immunoprecipitation, affinity chromatography, or cell based assays, or in ex vivo based therapeutic methods, e.g., methods in which cells or bodily fluids are contacted ex vivo with a scFv-Fc dimer and then
  • kits comprising a scFv-Fc dimer.
  • the scFv-Fc dimer may be labeled to allow its reactivity in a sample to be determined.
  • Kits may be employed in diagnostic analysis, for example.
  • a kit may contain instructions for use of the components.
  • Ancillary materials to assist in or to enable performing such a method may be included within the kit.
  • the reactivity of a scFv-Fc dimer in a sample may be determined by any appropriate means, e.g., radioimmunoassay (RIA).
  • Radioactively labeled antigen may be mixed with unlabeled antigen (the test sample) and allowed to bind to the scFv-Fc dimer. Bound antigen is physically separated from unbound antigen and the amount of radioactive antigen bound to the scFv-Fc dimer is determined.
  • a competitive binding assay also may be used with non-radioactive antigen, using an antigen or an analogue linked to a reporter molecule.
  • the reporter molecule may be a
  • fluorochrome phosphor
  • Suitable fluorochromes include fluorescein, rhodamine, phycoerythrin and Texas Red.
  • Suitable criminogenic dyes include diaminobenzidine.
  • Other reporters include macromolecular colloidal particles or particulate material such as latex beads that are colored, magnetic or paramagnetic, and biologically or chemically active agents that can directly or indirectly cause detectable signals to be visually observed, electronically detected or otherwise recorded. These molecules may be enzymes that catalyze reactions that develop or change colors or cause changes in electrical properties, for example. They may be molecularly excitable, such that electronic transitions between energy states result in characteristic spectral absorptions or emissions. They may include chemical entities used in conjunction with biosensors. Biotin/avidin or biotin/streptavidin and alkaline phosphatase detection systems may be employed. The signals generated by antibody- reporter conjugates may be used to derive quantifiable absolute or relative data of the relevant antibody binding in samples.
  • the present invention also provides the use of a scFv-Fc dimer for measuring antigen levels in a competition assay.
  • the scFv-Fc dimer can be linked to a reporter molecule so that a physical or optical change occurs on binding, for example.
  • the reporter molecule may directly or indirectly generate detectable, and preferably measurable, signals.
  • the reporter molecules may be linked directly or indirectly, covalently, e.g., via a peptide bond or non-covalently.
  • the scFv-Fc dimer and a protein reporter may be linked by a peptide bond and recombinantly expressed as a fusion protein.
  • CAT192(IgG4) (metelimumab) is a human IgG4 monoclonal antibody that selectively neutralizes TGF- ⁇ .
  • TGF i (20-600RU) was immobilized to a CM5 chip on Biacore using NHS/EDC chemistry.
  • Various amounts of CAT192(IgG4) were injected over the surface to monitor the binding to TGF i determined by surface plasmon resonance. The data were analyzed with a 1 : 1 binding model to determine binding constants.
  • CAT192(IgG4) was found to bind TGF i with relatively low affinity as determined by surface plasmon resonance, when compared to the binding by the parental CAT191scFv as shown in FIG.2.
  • Representative results of an A549 assay are shown in FIG. 3.
  • the A549 assay was conducted according to the procedure disclosed in Rapoza et al. (2006) "Development of an in vitro potency assay for therapeutic TGF antagonists: the A549 cell bioassay," /. Immunol.
  • CAT192(IgG4) affinity can be slightly enhanced by certain denaturing conditions, suggesting that antibody folding may have caused the loss of affinity during the conversion of scFv to IgG4.
  • IgG4 folding has been proposed to be unique (Aalberse and Schuurman "IgG4 breaking the rules", Immunology 105 :9-19).
  • the Fab arm exchange in IgG4 and the interaction of Fabs with Fc CH2 domain may possibly explain this loss of affinity by CAT192(IgG4). Therefore, CAT192 was remodeled to produce the IgGl version by replacing IgG4 Fc (CHI, CH2 and CH3 domains) with the consensus IgGl sequence.
  • the DNA coding the CAT192 (IgGl) was synthesized from GeneArt and subcloned into expression vector pCEP4(- E+I)Dest.
  • CAT192(IgGl) was produced from HEK293 transfection and purified with Protein A column. Remodeling CAT 192 from IgG4 to IgGl, however, did not increase its affinity. Fab fragments generated from the IgGl and IgG4 did not increase its affinity either. It was concluded that the high affinity of CAT191(scFv) (SEQ ID NO: 12) was lost during conversion to a full-length antibody format, whether it was a IgGl or IgG4. This was unexpected, because scFv components obtained from a library are often engineered to a full-length IgG format for therapeutic development.
  • CAT191(scFv) (SEQ ID NO: 12) was found to bind TGFpl with high affinity, using surface plasmon resonance, but CAT191(scFv) lacked the avidity needed for effective neutralization of TGF i. Accordingly, various other formats were tested, using the scFv component as a basic building block. General formats of antibody fragments, including the tested formats, are depicted in FIG. 1.
  • Tested formats included a diabody, a peptide-derived dimer (e.g., a leucine zipper peptide-derived dimer), and an scFv-Fc dimer.
  • scFv CAT191 diabody had the (Gly4Ser)3-type linker replaced with a short 5aa linker (GSSGG) (SEQ ID NO: 19) to create a non-covalent divalent binder (diabody dimer).
  • GSSGG short 5aa linker
  • Each monomer had the sequence set forth in SEQ ID NO: 14.
  • Each monomer of the leucine zipper peptide- derived dimer had the sequence set forth in SEQ ID NO: 16.
  • each monomer of the scFv-Fc dimer had the sequence set forth in SEQ ID NO: 9.
  • the diabody and the peptide derived dimer were expressed in E. Coli and the scFv-Fc was expressed in HEK293 cells.
  • the leucine zipper peptide-derived dimer was difficult to express, and the partially purified dimer only showed intermediate affinity, as measured by surface plasmon resonance.
  • the diabody (scFv 5aa) only showed intermediate affinity, but no avidity.
  • a scFv-Fc dimer produced from transient HEK293 transfection was found to bind to TGF i specifically with high affinity and avidity.
  • the binding results expressed as apparent dissociation constants obtained with surface plasmon resonance are summarized below in Table 2.
  • FIG. 3 shows the A549 bioassay results for the diabody (“scFv diabody 5aa”), CAT191(scFv) (“scFv”), the scFv-Fc dimer (“CAT191 (scFv- Fc”), and CAT192(IgG4) ("CAT192").
  • scFv diabody 5aa CAT191(scFv)
  • scFv-Fc dimer CAT191 (scFv- Fc)
  • CAT192(IgG4) CAT192
  • CAT191(scFv-Fc) was cloned and produced in larger scale in CHO cells.
  • CAT191 scFv-Fc coding sequence was PCR amplified from a pCEP4 based expression vector using a gene specific forward and reverse primer set.
  • the PCR amplified CAT191 coding sequence was subcloned into a shuttle vector to facilitate sequence verification and molecular cloning. After sequence verification, the CAT191 coding sequence was cloned into Genzyme expression vectors pGZ600 and pGZ620. Both vectors used the hamster ⁇ -actin promoter to drive expression of the CAT191 transgene. They also contained the DHFR selectable marker that was driven by a separate promoter (SV40) to enable selection in CHO cells. CHO-8D6 host cell line was transfected with either the pGZ600-CAT191 or pGZ620-CAT191 expression plasmid.
  • the transfected cells were placed into nucleotide-deficient growth medium for selection to generate pools of stable transfectants. After pools recovered from selection, a second round of selection was performed in the presence of 20nM methotrexate. The CHO pools selected this way was scaled up and the conditioned media was used for purification using Protein A column.
  • the CHO cell-produced protein was characterized by SDS-PAGE, Biacore binding, SEC-HPLC, and the A549 cell potency assay. The results confirmed that the scFv-Fc dimer had a higher affinity and potency, and it specifically neutralized TGF i. The potency compared favorably to the pan-specific GC1008 antibody (FIG. 6 and FIG. 7).
  • CAT191(scFv-Fc) stored at -80°C was monitored for a year by SEC-HPLC, Biacore TGF i binding, and the A549 potency assay. No change in aggregation, affinity, or potency was observed during the test period. Material stored at 4°C displayd a slight but steady increase in aggregation over 1 year. The unique combination of the smaller size, high selectivity, potency against TGF i, and long in vivo half- life made CAT191(scFv-Fc) an ideal candidate for therapeutic applications.
  • SEQ ID No. 1 Human IgGl VH domain Clone SL15 (SQN4 US6492497)
  • SEQ ID No. 2 Human IgGl VH domain Clone JT182 (SQN10 US6492497)
  • SEQ ID No. 5 Human IgGl VK domain Clone SL15A: (SQN6 US6492497)
  • SEQ ID No. 6 Human IgGl VK domain Clone SL15S: (SQN8 US6492497)
  • SEQ ID No. 7 Human IgGl hinge region
  • SEQ ID No. 10 CAT192 (IgG4) Light Chain
  • SEQ ID No. 13 Diabody-5aa encoding nucleic acid
  • VQPGRSLRLS C AAS GFTES S YGMHW VRQ APGKELEW VA VI SYDGSIKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARTGEYS G YDTDPQ YS WGQGTT VT VS S GS S GGEI VLTQSPS SLS AS VGDR VTITCRS S QGI GDDLGWYQQKPGKAPILLIYGTS TLQS G VPS RFS GS GS GTDFTLTINSLQPEDF ATYYCLQDSNYPLTFGGGTRLEIKRAAAHHHHHHGAAEQKLISEEDLNGAA
  • SEQ ID No. 15 Leucine zipper peptide-derived dimer encoding nucleic acid gaggtgcagctggtggagtctgggggaggcgtggtccagcctgggaggtccctgagactctcctgtgcagcctctggatt caccttcagtagctatggcatgcactgggtccgccaggctccaggcaaggagctggagtgggtgggtggcagttatatcatatga tggaagtattaaatactatgcagactccgtgaagggccgattcaccatctccagagacaattccaagaacacgctgtatctg caaatgaacagcctgagagctgtgtgtatctg caaatgaacagcctgagagctgaggacacggctgtgtattactg
  • SEQ ID No. 17 CAT191(scFv-Fc) encoding nucleic acid

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Endocrinology (AREA)
  • Dermatology (AREA)
  • Urology & Nephrology (AREA)
  • Pulmonology (AREA)
  • Rheumatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2016/020779 2015-03-04 2016-03-03 scFv-Fc DIMERS THAT BIND TRASFORMING GROWTH FACTOR-β1 WITH HIGH AFFINITY, AVIDITY AND SPECIFICITY Ceased WO2016141244A1 (en)

Priority Applications (19)

Application Number Priority Date Filing Date Title
AU2016226097A AU2016226097B2 (en) 2015-03-04 2016-03-03 scFv-Fc dimers that bind Transforming Growth Factor-Beta1 with high affinity, avidity and specificity
EP24220330.5A EP4527850A3 (en) 2015-03-04 2016-03-03 Scfv-fc dimers that bind transforming growth factor-beta1 with high affinity, avidity and specificity
EP16710059.3A EP3265484B1 (en) 2015-03-04 2016-03-03 Scfv-fc dimers that bind transforming growth factor-beta1 with high affinity, avidity and specificity
KR1020177027371A KR102598790B1 (ko) 2015-03-04 2016-03-03 전환 성장 인자-β1에 높은 친화성, 결합력 및 특이성으로 결합하는 scFv-Fc 이량체
CN201680025665.5A CN107889491B (zh) 2015-03-04 2016-03-03 以高亲和性、亲合力及特异性结合转化生长因子-β1的scFv-Fc二聚体
CA2978459A CA2978459C (en) 2015-03-04 2016-03-03 Scfv-fc dimers that bind transforming growth factor-.beta.1 with high affinity, avidity and specificity
KR1020237037758A KR102754133B1 (ko) 2015-03-04 2016-03-03 전환 성장 인자-β1에 높은 친화성, 결합력 및 특이성으로 결합하는 scFv-Fc 이량체
JP2017546178A JP6845802B2 (ja) 2015-03-04 2016-03-03 トランスフォーミング増殖因子β1に高親和性、アビディティおよび特異性で結合するscFv−Fc二量体
KR1020257000711A KR20250009587A (ko) 2015-03-04 2016-03-03 전환 성장 인자-β1에 높은 친화성, 결합력 및 특이성으로 결합하는 scFv-Fc 이량체
MX2017011251A MX2017011251A (es) 2015-03-04 2016-03-03 DIMEROS SCFV-FC QUE SE UNEN AL FACTOR DE CRECIMEINTO TRANSFORMANTE ß1 CON ALTA AFINIDAD, AVIDEZ Y ESPECIFICIDAD.
US15/555,499 US10508146B2 (en) 2015-03-04 2016-03-03 ScFv-Fc dimers that bind transforming growth factor-BETA1 with high affinity, avidity and specificity
RU2017134042A RU2733286C2 (ru) 2015-03-04 2016-03-03 ДИМЕРЫ SCFV-FC, КОТОРЫЕ СВЯЗЫВАЮТСЯ С ТРАНСФОРМИРУЮЩИМ ФАКТОРОМ РОСТА β1 С ВЫСОКОЙ АФФИННОСТЬЮ, АВИДНОСТЬЮ И СПЕЦИФИЧНОСТЬЮ
ES16710059T ES3014555T3 (en) 2015-03-04 2016-03-03 Scfv-fc dimers that bind transforming growth factor-beta1 with high affinity, avidity and specificity
BR112017018767A BR112017018767A2 (pt) 2015-03-04 2016-03-03 dímeros de scfv-fc que ligam o fator de crescimento de transformação beta1 com afinidade, avidez e especificidade altas
SG11201707105TA SG11201707105TA (en) 2015-03-04 2016-03-03 scFv-Fc DIMERS THAT BIND TRANSFORMING GROWTH FACTOR-ß1 WITH HIGH AFFINITY, AVIDITY AND SPECIFICITY
IL254238A IL254238B (en) 2015-03-04 2017-08-31 Scfv-fc dimers that bind transforming growth factor-ß1 with high affinity, avidity and specificity
US16/669,211 US11325971B2 (en) 2015-03-04 2019-10-30 scFv-Fc dimers that bind transforming growth factor-β1 with high affinity, avidity and specificity
US17/713,087 US11976112B2 (en) 2015-03-04 2022-04-04 scFv-Fc dimers that bind transforming growth factor-β1 with high affinity, avidity and specificity
US18/627,131 US12473356B2 (en) 2015-03-04 2024-04-04 scFv-Fc dimers that bind transforming growth factor-β1 with high affinity, avidity and specificity

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562128133P 2015-03-04 2015-03-04
US62/128,133 2015-03-04

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/555,499 A-371-Of-International US10508146B2 (en) 2015-03-04 2016-03-03 ScFv-Fc dimers that bind transforming growth factor-BETA1 with high affinity, avidity and specificity
US16/669,211 Division US11325971B2 (en) 2015-03-04 2019-10-30 scFv-Fc dimers that bind transforming growth factor-β1 with high affinity, avidity and specificity

Publications (2)

Publication Number Publication Date
WO2016141244A1 true WO2016141244A1 (en) 2016-09-09
WO2016141244A8 WO2016141244A8 (en) 2016-10-20

Family

ID=55538640

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/020779 Ceased WO2016141244A1 (en) 2015-03-04 2016-03-03 scFv-Fc DIMERS THAT BIND TRASFORMING GROWTH FACTOR-β1 WITH HIGH AFFINITY, AVIDITY AND SPECIFICITY

Country Status (15)

Country Link
US (4) US10508146B2 (https=)
EP (2) EP4527850A3 (https=)
JP (1) JP6845802B2 (https=)
KR (3) KR20250009587A (https=)
CN (1) CN107889491B (https=)
AR (1) AR103839A1 (https=)
AU (1) AU2016226097B2 (https=)
BR (1) BR112017018767A2 (https=)
ES (1) ES3014555T3 (https=)
IL (1) IL254238B (https=)
MX (2) MX2017011251A (https=)
RU (1) RU2733286C2 (https=)
SG (2) SG10201912449UA (https=)
TW (1) TWI726870B (https=)
WO (1) WO2016141244A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11299751B2 (en) 2016-04-29 2022-04-12 Voyager Therapeutics, Inc. Compositions for the treatment of disease
US11326182B2 (en) 2016-04-29 2022-05-10 Voyager Therapeutics, Inc. Compositions for the treatment of disease
EP4265644A4 (en) * 2020-12-18 2024-10-02 Shenzhen Majory Biotechnology Co., Ltd. BISPECIFIC ANTIBODY FOR SPECIFICALLY NEUTRALIZING A TGF-BETA SIGNAL OF T HELP CELLS, PHARMACEUTICAL COMBINATION AND USE THEREOF

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TWI733661B (zh) 2015-03-04 2021-07-21 美商健臻公司 以高親合性、結合性及特異性結合轉化生長因子-β1的經修飾IgG抗體
TWI726870B (zh) 2015-03-04 2021-05-11 美商健臻公司 具有高親和性、結合性及專一性之結合轉形生長因子-β1的scFv-Fc二聚體
US20220119513A1 (en) * 2020-06-08 2022-04-21 Zoetis Services Llc Anti-tgfb antibodies and therapeutic uses thereof
CN116179493A (zh) * 2021-09-29 2023-05-30 成都美杰赛尔生物科技有限公司 敲除两种免疫检测点基因的免疫细胞及其制备方法与应用

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5616561A (en) 1995-03-31 1997-04-01 Regents Of The University Of California TGF-β antagonists as mitigators of radiation-induced tissue damage
WO2000066631A1 (en) * 1999-04-30 2000-11-09 Cambridge Antibody Technology Limited SPECIFIC ANTIBODIES AND ANTIBODY FRAGMENTS FOR TGFβ¿1?
US20020099179A1 (en) 1989-12-21 2002-07-25 Linda K. Jolliffe Cdr-grafted antibodies
WO2004098637A1 (en) 2003-04-30 2004-11-18 Genzyme Corporation Tgf-beta antagonists combined with renin-angiotensin-aldosteron-system antagonists for treating renal insufficiency
WO2006116002A2 (en) * 2005-04-22 2006-11-02 Eli Lilly And Company Tgf beta 1 specific antibodies
WO2007076391A1 (en) * 2005-12-23 2007-07-05 Eli Lilly And Company Tgf-beta binding compositions
WO2007109254A2 (en) 2006-03-17 2007-09-27 Biogen Idec Ma Inc. Stabilized polypeptide compositions
US20100174053A1 (en) * 2005-04-15 2010-07-08 Macrogenics, Inc. Covalent diabodies and uses thereof
US8048421B2 (en) 2006-03-23 2011-11-01 Kyowa Hakko Kirin Co., Ltd. Agonist antibody to human thrombopoietin receptor
WO2014164709A2 (en) * 2013-03-11 2014-10-09 Genzyme Corporation Engineered anti-tgf-beta antibodies and antigen-binding fragments

Family Cites Families (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2146552B1 (es) * 1998-11-24 2001-04-16 Inst Cientifico Tecnol Navarra Peptidos inhibidores de tgf/31
EP1486560A3 (en) 1999-04-30 2005-02-09 Cambridge Antibody Technology LTD Specific antibodies and antibody fragments for TGFBETA1
CN1961003B (zh) 2004-03-31 2013-03-27 健泰科生物技术公司 人源化抗TGF-β抗体
CN101084007A (zh) 2004-09-22 2007-12-05 金齐姆公司 TGF-β拮抗剂限制免疫抑制剂肾毒性的用途
DK2083863T3 (da) 2006-10-03 2015-06-22 Genzyme Corp Antistoffer mod tgf-beta til anvendelse til behandling af spædbørn med risiko for udvikling af bronkopulmonal dysplasi
EA019512B1 (ru) 2008-07-02 2014-04-30 Эмерджент Продакт Дивелопмент Сиэтл, Ллс Il-6-опосредованная иммунотерапия
US20120294868A1 (en) 2009-04-24 2012-11-22 Edwards James R Anti-tgf-beta induction of bone cell function and bone growth
US9409950B2 (en) * 2010-12-23 2016-08-09 Biogen Ma Inc. Linker peptides and polypeptides comprising same
TWI588156B (zh) 2011-03-28 2017-06-21 賽諾菲公司 具有交叉結合區定向之雙重可變區類抗體結合蛋白
SG195253A1 (en) 2011-06-03 2013-12-30 Xoma Technology Ltd Antibodies specific for tgf-beta
US20140072581A1 (en) 2012-07-23 2014-03-13 Zymeworks Inc. Immunoglobulin Constructs Comprising Selective Pairing of the Light and Heavy Chains
HUE046702T2 (hu) 2013-03-20 2020-03-30 Genzyme Corp Eljárások üvegcsontbetegség kezelésére
TWI726870B (zh) 2015-03-04 2021-05-11 美商健臻公司 具有高親和性、結合性及專一性之結合轉形生長因子-β1的scFv-Fc二聚體
TWI733661B (zh) 2015-03-04 2021-07-21 美商健臻公司 以高親合性、結合性及特異性結合轉化生長因子-β1的經修飾IgG抗體

Patent Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020099179A1 (en) 1989-12-21 2002-07-25 Linda K. Jolliffe Cdr-grafted antibodies
US5616561A (en) 1995-03-31 1997-04-01 Regents Of The University Of California TGF-β antagonists as mitigators of radiation-induced tissue damage
US7151169B2 (en) 1999-04-30 2006-12-19 Cambridge Antibody Technology Limited Specific binding members for TGFβ1
US6492497B1 (en) 1999-04-30 2002-12-10 Cambridge Antibody Technology Limited Specific binding members for TGFbeta1
WO2000066631A1 (en) * 1999-04-30 2000-11-09 Cambridge Antibody Technology Limited SPECIFIC ANTIBODIES AND ANTIBODY FRAGMENTS FOR TGFβ¿1?
WO2004098637A1 (en) 2003-04-30 2004-11-18 Genzyme Corporation Tgf-beta antagonists combined with renin-angiotensin-aldosteron-system antagonists for treating renal insufficiency
US20100174053A1 (en) * 2005-04-15 2010-07-08 Macrogenics, Inc. Covalent diabodies and uses thereof
WO2006116002A2 (en) * 2005-04-22 2006-11-02 Eli Lilly And Company Tgf beta 1 specific antibodies
US20080050375A1 (en) * 2005-04-22 2008-02-28 Julian Davies Binding compositions: related reagents
WO2007076391A1 (en) * 2005-12-23 2007-07-05 Eli Lilly And Company Tgf-beta binding compositions
WO2007109254A2 (en) 2006-03-17 2007-09-27 Biogen Idec Ma Inc. Stabilized polypeptide compositions
US8048421B2 (en) 2006-03-23 2011-11-01 Kyowa Hakko Kirin Co., Ltd. Agonist antibody to human thrombopoietin receptor
WO2014164709A2 (en) * 2013-03-11 2014-10-09 Genzyme Corporation Engineered anti-tgf-beta antibodies and antigen-binding fragments

Non-Patent Citations (27)

* Cited by examiner, † Cited by third party
Title
AALBERSE; SCHUURMAN: "IgG4 breaking the rules", IMMUNOLOGY, vol. 105, pages 9 - 19
ANDERSEN ET AL., CURR. OPIN. BIOTECHNOL., vol. 13, 2002, pages 117 - 23
BECK ET AL., NATURE, vol. 10, 2010, pages 345 - 52
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BORDER ET AL., NATURE, vol. 346, 1990, pages 371 - 374
BORSI ET AL., INT. J. CANCER, vol. 102, 2002, pages 75 - 85
GIRI ET AL., THORAX, vol. 48, 1993, pages 959 - 966
GRIITTER ET AL.: "GC1008, a human IgG4 monoclonal antibody (Mab; i.e., GC1008) in clinical development for treating malignancy and fibrotic diseases", PROC. NAT'LACAD. SCI. USA, vol. 105, no. 51, 2008, pages 20251 - 56
HARDING ET AL., MABS, vol. 2, 2010, pages 256 - 265
HOLLIGER PHILIPP ET AL: "ENGINEERED ANTIBODY FRAGMENTS AND THE RISE OF SINGLE DOMAINS", NATURE BIOTECHNOLOGY, GALE GROUP INC, vol. 23, no. 9, 1 September 2005 (2005-09-01), pages 1126 - 1136, XP008076746, ISSN: 1087-0156, DOI: 10.1038/NBT1142 *
HOMES; FOOTE, J IMMUNOL., vol. 158, no. 5, 1 March 1997 (1997-03-01), pages 2192 - 201
HUSTON ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 83
LOGAN ET AL., EUR. J. NEUROSCI., vol. 6, 1994, pages 355 - 363
OLAFSEN T ET AL: "Antibody Vectors for Imaging", SEMINARS IN NUCLEAR MEDICINE, GRUNE AND STRATTON,, ORLANDO, FL, US, vol. 40, no. 3, 1 May 2010 (2010-05-01), pages 167 - 181, XP026985337, ISSN: 0001-2998, [retrieved on 20100327] *
PETERS ET AL., J. BIOL. CHEM., vol. 287, no. 29, 2012, pages 24525 - 33
PLIICKTHUN, BIOLTECHNOLOGY, vol. 9, 1991, pages 545 - 551
POWERS D B ET AL: "Expression of single-chain Fv-Fc fusions in Pichia pastoris", JOURNAL OF IMMUNOLOGICAL METHODS, ELSEVIER SCIENCE PUBLISHERS B.V.,AMSTERDAM, NL, vol. 251, no. 1-2, 1 May 2001 (2001-05-01), pages 123 - 135, XP004233079, ISSN: 0022-1759, DOI: 10.1016/S0022-1759(00)00290-8 *
RAPOZA ET AL.: "Development of an in vitro potency assay for therapeutic TGFp antagonists: the A549 cell bioassay", J. IMMUNOL. METHODS, vol. 316, 2006, pages 18 - 26
SHAH ET AL., J. CELL SCIENCE, vol. 107, 1994, pages 1137 - 1157
SHAH ET AL., J. CELL SCIENCE, vol. 108, 1995, pages 985 - 1002
SHAH ET AL., LANCET, vol. 339, 1992, pages 213 - 214
STROHL WR.: "Optimization of Fc-mediated effector functions of monoclonal antibodies", CURR OPIN BIOTECHNOL., vol. 20, no. 6, 2009, pages 685 - 91
STROHL: "Optimization of Fc-mediated effector functions of monoclonal antibodies", CURR. OPIN. BIOTECHNOL., vol. 20, 2009, pages 685 - 91
VACCARO C. ET AL.: "Engineering the Fc region of immunoglobulin G to modulate in vivo antibody levels", NAT BIOTECHNOL., vol. 23, no. 10, 2005, pages 1283 - 8
WAHL ET AL., EXP. MEDICINE, vol. 177, 1993, pages 225 - 230
ZHANG ET AL., ANAL. CHEM., vol. 82, 2010, pages 1090 - 99

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11299751B2 (en) 2016-04-29 2022-04-12 Voyager Therapeutics, Inc. Compositions for the treatment of disease
US11326182B2 (en) 2016-04-29 2022-05-10 Voyager Therapeutics, Inc. Compositions for the treatment of disease
EP4265644A4 (en) * 2020-12-18 2024-10-02 Shenzhen Majory Biotechnology Co., Ltd. BISPECIFIC ANTIBODY FOR SPECIFICALLY NEUTRALIZING A TGF-BETA SIGNAL OF T HELP CELLS, PHARMACEUTICAL COMBINATION AND USE THEREOF

Also Published As

Publication number Publication date
US20240343790A1 (en) 2024-10-17
ES3014555T3 (en) 2025-04-23
MX2017011251A (es) 2018-02-19
MX2022007456A (es) 2022-06-27
US11976112B2 (en) 2024-05-07
KR20170120173A (ko) 2017-10-30
US20200131258A1 (en) 2020-04-30
IL254238B (en) 2022-01-01
RU2733286C2 (ru) 2020-10-01
SG11201707105TA (en) 2017-09-28
AU2016226097A8 (en) 2017-11-09
AU2016226097B2 (en) 2022-01-13
CN107889491A (zh) 2018-04-06
SG10201912449UA (en) 2020-02-27
WO2016141244A8 (en) 2016-10-20
IL254238A0 (en) 2017-10-31
RU2017134042A3 (https=) 2019-10-08
JP2018508218A (ja) 2018-03-29
US11325971B2 (en) 2022-05-10
KR20250009587A (ko) 2025-01-17
JP6845802B2 (ja) 2021-03-24
CN107889491B (zh) 2022-01-07
RU2017134042A (ru) 2019-04-05
TWI726870B (zh) 2021-05-11
KR20230156798A (ko) 2023-11-14
CA2978459A1 (en) 2016-09-09
US20180222970A1 (en) 2018-08-09
US12473356B2 (en) 2025-11-18
EP3265484C0 (en) 2024-12-25
EP3265484B1 (en) 2024-12-25
BR112017018767A2 (pt) 2018-04-17
EP4527850A3 (en) 2025-06-04
AR103839A1 (es) 2017-06-07
KR102598790B1 (ko) 2023-11-07
US20220363740A1 (en) 2022-11-17
AU2016226097A1 (en) 2017-10-26
US10508146B2 (en) 2019-12-17
KR102754133B1 (ko) 2025-01-15
EP4527850A2 (en) 2025-03-26
TW201706303A (zh) 2017-02-16
EP3265484A1 (en) 2018-01-10

Similar Documents

Publication Publication Date Title
US12162933B2 (en) Modified-IgG antibodies that bind transforming growth factor-β1 with high affinity, avidity and specificity
US12473356B2 (en) scFv-Fc dimers that bind transforming growth factor-β1 with high affinity, avidity and specificity
HK40117203A (en) Scfv-fc dimers that bind transforming growth factor-beta1 with high affinity, avidity and specificity
CA2978459C (en) Scfv-fc dimers that bind transforming growth factor-.beta.1 with high affinity, avidity and specificity
HK40119111A (en) Modified-igg antibodies that bind transforming growth factor-beta1 with high affinity, avidity and specificity
CA2978439C (en) Modified-igg antibodies that bind transforming growth factor-beta1 with high affinity, avidity and specificity
HK40091838A (en) Modified-igg antibodies that bind transforming growth factor-beta1 with high affinity, avidity and specificity
HK40091838B (en) Modified-igg antibodies that bind transforming growth factor-beta1 with high affinity, avidity and specificity
HK1249113A1 (en) Modified-igg antibodies that bind transforming growth factor-beta1 with high affinity, avidity and specificity

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16710059

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2978459

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 11201707105T

Country of ref document: SG

Ref document number: MX/A/2017/011251

Country of ref document: MX

Ref document number: 254238

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2017546178

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 15555499

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017018767

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20177027371

Country of ref document: KR

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2016710059

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2017134042

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 2016226097

Country of ref document: AU

Date of ref document: 20160303

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112017018767

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170831