WO2016120596A1 - Multi-epitopic construct - Google Patents

Multi-epitopic construct Download PDF

Info

Publication number
WO2016120596A1
WO2016120596A1 PCT/GB2016/050150 GB2016050150W WO2016120596A1 WO 2016120596 A1 WO2016120596 A1 WO 2016120596A1 GB 2016050150 W GB2016050150 W GB 2016050150W WO 2016120596 A1 WO2016120596 A1 WO 2016120596A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
construct according
epitope
amino acid
mice
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2016/050150
Other languages
English (en)
French (fr)
Other versions
WO2016120596A8 (en
Inventor
Vijay Kakkar
Xinjie Lu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Thrombosis Research Institute
Original Assignee
Thrombosis Research Institute
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from GBGB1501354.3A external-priority patent/GB201501354D0/en
Priority claimed from GBGB1510195.9A external-priority patent/GB201510195D0/en
Application filed by Thrombosis Research Institute filed Critical Thrombosis Research Institute
Priority to CA2974884A priority Critical patent/CA2974884C/en
Priority to JP2017557501A priority patent/JP6831334B2/ja
Priority to US15/546,858 priority patent/US11332515B2/en
Priority to EP16701871.2A priority patent/EP3250584B1/en
Publication of WO2016120596A1 publication Critical patent/WO2016120596A1/en
Anticipated expiration legal-status Critical
Publication of WO2016120596A8 publication Critical patent/WO2016120596A8/en
Priority to US17/693,785 priority patent/US20220195013A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/775Apolipopeptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0008Antigens related to auto-immune diseases; Preparations to induce self-tolerance
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0012Lipids; Lipoproteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/04Mycobacterium, e.g. Mycobacterium tuberculosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/118Chlamydiaceae, e.g. Chlamydia trachomatis or Chlamydia psittaci
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/295Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Chlamydiales (O)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/35Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6043Heat shock proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6068Other bacterial proteins, e.g. OMP
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6081Albumin; Keyhole limpet haemocyanin [KLH]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/64Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • This invention relates to multiple epitope constructs, immunogenic and vaccine compositions comprising recombinant molecules presenting inserted multiple and different epitopes from a variety of antigens.
  • the invention relates to such compositions for eliciting an immune response against antigens and pathogens involved in the development of atherosclerosis the invention includes inter alia methods of treating and/or preventing the disease and recombinant protein products.
  • Atherosclerosis is increasingly recognized as a complex chronic inflammatory disease of the arterial walls as evidenced by the presence of inflammatory cells, activated immune cells and cytokines in lesions, all of which indicate involvement of the immune system.
  • Dendritic cells DCs
  • a major component of the innate response involves the entry of monocytes into nascent lesions, followed by differentiation of monocytes into macrophages and CD1 1c + cells with DC-like properties.
  • Atherosclerotic plaques are known to contain macrophage- derived foam cells in which macrophages interact with T cells to produce a wide array of cytokines that can exert both pro- and anti-inflammatory effects.
  • C5aR complement component 5a receptor
  • protease- activated receptor (PAR)-1 inhibition showed a strong antithrombotic effect, leading to a significant decrease in platelet aggregation, whereas primary haemostatic function was preserved (Chintala et al 2010 Arterioscler Thromb Vase Biol 30; 2143-2149).
  • C5a is a protein fragment released from complement component C5 and is a 74 amino acid peptide in humans that is generated by the cleavage of C5a convertase on the C5 a-chain during the classical, alternative, and lectin pathways of complement activation.
  • C5a mediates its effects via its G protein-coupled C5a receptor (C5aR/CD88) on the plasma membrane of target cells triggering intracellular signaling, which results in chemotaxis, a respiratory burst and release of pro-inflammatory mediators from granulocytes.
  • C5aR/CD88 G protein-coupled C5a receptor
  • C5a attracts and activates neutrophils, monocytes, and platelets and stimulates the release of inflammatory mediators, including reactive oxidants, proteolytic enzymes, chemokines, cytokines, and complement factors C3 and properdin. Secretion of C3 and properdin by neutrophils, as well as the presence of apoptotic and necrotic decidual tissue, and may accelerate alternative pathway activation creating a proinflammatory amplification loop at sites of leukocyte infiltration that enhances C3 activation and deposition and generates additional C5a.
  • Human C5aR is an integral membrane glycoprotein, consisting of 350 amino acids forming a single poly-peptide chain.
  • C5a/C5aR interactions have been shown to modify the production of IL-12, thus regulating Th-1 cell responses, and to potentiate the production of cytokines such as IL-6, IL-8, and TNF-alpha.
  • the C5aR is expressed abundantly on leukocytes, including neutrophils, monocytes, eosinophils, and lymphocytes.
  • C5aR is also expressed by a wide range of parenchymal cells, including glomerular mesangial and proximal tubular epithelial cells. Parenchymal C5aR expression has been shown to be enhanced in areas of acute inflammation.
  • Ruptured or vulnerable plaques of atherosclerosis are usually characterized by the presence of a large lipid core, a reduced number of smooth muscle cells, a thin fibrous cap, and an increased number of inflammatory cells, such as macrophages and T cells. Macrophages are thought to play a major role in plaque destabilization and rupture. Through the production of matrix metalloproteinases (MMPs), these cells are capable of degrading components of the extracellular matrix, such as collagen, proteoglycans, and elastin.
  • MMPs matrix metalloproteinases
  • MMP-1 , MMP-3, and MMP-9 are present in the shoulder region of atherosclerotic plaques, and it has been shown that overexpression of active MMP-9 in apoE-deficient mice induces plaque disruption.
  • the stimulatory effect of C5a on the expression of MMP-1 and MMP-9 mRNA in monocyte-derived macrophages isolated from different donors and in human macrophages isolated from atherosclerotic plaques has also been reported.
  • C5a anaphylatoxin C5a in the pathogenesis of atherosclerosis. It has recently been reported that there is a predictive value of C5a plasma levels for cardiovascular events in patients with advanced atherosclerosis. Receptors for C5a were detected in atherosclerotic lesions. Furthermore, C5a induces the expression of adhesion molecules by endothelial cells. C5a activates macrophages, causing them to release the inflammatory mediators TNF-alpha, interleukin-1. TNF-alpha, on the other hand, directly induces MMP expression in these cells.
  • C5aR complement component 5a receptor
  • protease- activated receptor (PAR)-1 inhibition showed a strong antithrombotic effect, leading to a significant decrease in platelet aggregation, whereas primary haemostatic function was preserved (Chintala et al 2010 Arterioscler Thromb Vase Biol 30; 2143-2149).
  • a recombinant construct comprising:
  • the scaffold portion is native dendroaspin and comprises an amino acid sequence selected from SEQ ID NO:1 ( Figure 14A).
  • first pathway to atherosclerosis formation is via a C5 interaction and more preferably by a C5a or C5Ar pathway.
  • the C5 epitope is therefore a C5a epitope or a C5a receptor (C5aR) epitope.
  • the C5 epitope may comprise from 5 to 40, e.g. from 8 to 40 amino acid residues or for example from 8 to 35 amino acid residues.
  • the C5a epitope may comprise from 5 to 40 contiguous amino acid residues selected from the C5a sequence (SEQ ID NO:2) ( Figure 14B), e.g. from 8 to 40 amino acid residues, for example from 8 to 35 amino acid residues.
  • the C5a epitope comprises from 8 to 20, e.g. 8 to 15 contiguous amino acid residues selected from the C5a sequence.
  • the C5a epitope is a polypeptide comprising, or consisting of, the amino acid sequence selected from the group comprising EQRAARISLGPR (SEQ ID NO:3), RAARISLGPRCIKAFTE (SEQ ID NO:4) and CVNNDETCEQ (SEQ ID NO:5) or a functional fragment thereof that has antigenic activity.
  • the epitope may comprise a sequence of from 5 to 40 contiguous amino acid residues selected from the C5a sequence and comprising SEQ ID NO 2, 3 or 4.
  • the C5aR epitope comprises from 5 to 50 contiguous amino acid residues selected from the C5aR sequence (SEQ ID NO:6; Figure 14C), for example from 10 to 40 amino acid residues or for example from 14 to 35 amino acid residues.
  • the C5aR epitope comprises from 1 to 31 contiguous amino acid residues or a functional fragment thereof.
  • the C5aR epitope may be at the N-terminal end (containing free amino group) or the C-terminal end (containing free carboxyl group) of the C5aR amino acid sequence.
  • the C5aR epitope is a polypeptide comprising, or consisting of, an amino acid sequence selected from the group comprising MNSFNYTTPDYGHYDDKDTLD (SEQ ID NO:7), TLDLNTPVDKTSN(SEQ ID NO:8) and MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN(SEQ ID NO:9) or a functional fragment thereof that has antigenic activity.
  • Reference herein to a functional fragment encompasses portions of the epitope amino acid sequences that retains sufficient amino acids to provide and act as an antigenic determinant and to possess antigenic activity and thus function as an epitope.
  • a functional fragment also encompasses portions of epitope amino acid sequences that when incorporated and presented in the scaffold portion, elicits an immune response against atherosclerosis that can be determined by, for example and without limitation a reduction in the area occupied by an atherosclerotic lesion.
  • the recombinant construct comprises more than one first species of epitopes.
  • the second species of epitope is a human epitope.
  • the second species of epitope may comprise from 5 to 40, e.g. from 9 to 40 amino acid residues, for example from 9 to 20 amino acid residues.
  • the second species of epitope associated with an anti-arteriosclerotic vascular disease response is selected from the group comprising, or consisting of apolipoprotein (Apo) epitopes, heat-shock protein (HSP) epitopes, chlamydia pneumonia epitopes, protease-activated receptor-1 epitopes (PAR-1) and perilipin epitopes.
  • Apo apolipoprotein
  • HSP heat-shock protein
  • PAR-1 protease-activated receptor-1 epitopes
  • perilipin epitopes perilipin epitopes.
  • the second epitope is a heat-shock protein (HSP) epitope, chlamydia pneumonia epitope, tissue factor or PAR-1 epitope.
  • HSP heat-shock protein
  • said heat-shock protein is a HSP 60 or a HSP 65. More preferably said HSP 60 is a human HSP 60 or a Mycobacterium bovis HSP. More preferably said epitope capable of eliciting a response against HSP 60 is a polypeptide comprising, or consisting of the amino acid sequence selected from the group comprising peptide 1 (AA) 153-160: AELKKQSK; (SEQ ID NO:10), peptide 1 (AA) 153-163: AELKKQSKPVT; (SEQ ID NO:11), peptide 1 (AA) 303-312: PGFGDNRKNQ (SEQ ID NO:12), peptide 2: AA 277-286 PGFGDNRKNQ (SEQ ID NO:13), peptide (AA) 516-528) KGIIDPTKWRTA (SEQ ID NO:14), and mycobacterium (AA) 253-268: EGEALSTLVVNKIRGT (
  • said chlamydia pneumonia is Cpn1 or Cpn2. More preferably, said epitope capable of eliciting a response against Cpn is a polypeptide comprising, or consisting of the amino acid sequence selected from the group comprising the major outer membrane protein (MOMP) (amino acid sequence (AA) 67-74: GDYVFDRI (SEQ ID NO:16), and putative outer membrane protein (Pomp) 5 of Cpn (amino acid sequence (AA) 283-291 : QAVANGGAI (SEQ ID NO:17) or a functional fragment thereof that has antigenic activity.
  • MOMP major outer membrane protein
  • the tissue factor epitope is (AA56-67) and comprises the sequence EWEPKPVNQVYT (SEQ ID NO: 19).
  • the PAR-1 epitope is (AA42-55) and comprises the amino acid sequence SFLLRNPNDKYEPF (SEQ ID NO:19).
  • the recombinant construct of the present invention comprises more than one second epitope for example it may comprises 2, 3, 4, 5, 6, 7, 8, 9 or 10 identical or different second epitopes.
  • the recombinant construct may comprise a C5aR epitope, a Cpn epitope and two different HSP epitopes or it may comprise a C5aR epitope, a Cpn epitope, a HSP epitope and a PAR-1 epitope.
  • the amino acid sequences of the first and/or second epitope are incorporated into (a) loop I and/or loop II; (b) loop I and/or loop III; (c) loop II and/or loop III; or (d) loop I, loop II and loop III of the dendroaspin scaffold.
  • Loop I comprises amino acid residues 4-16, loop II residues 23-36 and loop III residues 40-50.
  • the further amino acids being incorporated may extend into or substitute regions external to the loops, i.e. residues 1-3, 17-22 and 37-39 such that residues of the non-loop regions are augmented or substituted for those of the further amino acid sequence or sequences being inserted.
  • the further amino acid residues are preferably incorporated into either loop I or loop II. In this way the RGD-containing loop III is unaltered and so the integrin binding function of dendroaspin is retained.
  • a preferred location for the inserted further sequence is at a site in dendroaspin scaffold between amino acid residues: 4-16, 18-21 , 23-36, or 52-59.
  • Each inserted further amino acid sequence or portion of a further amino acid sequence is preferably an amino acid sequence in the range 3-40 amino acid residues, more preferably 3-16, even more preferably 3-14 amino acid residues long.
  • the start of the inserted further amino acid sequence may be at any one of amino acid residues 1-57 of the dendroaspin scaffold.
  • the end of the inserted further amino acid sequence may be at any one of amino acid residues 3-59 of the dendroaspin scaffold.
  • the linear distance between these is preferably in the range 1-35 amino acids, more preferably 1-14 amino acids.
  • the RGD-containing loop may be modified by insertion, deletion or substitution of one of more amino acid residues, preferably a maximum of 8 or a minimum of 1 amino acids can be modified within loop III of dendroaspin.
  • Loop I and/or loop II may be modified by insertion, deletion or substitution of one or more amino acid residues.
  • the first or second epitopes may be attached at either or both of the C and/or N terminus ends of the dendroaspin scaffold protein.
  • an expression vector comprising the nucleic acids encoding the proteins incorporated into the construct of the first aspect of the invention.
  • an antigenic composition comprising the protein according to the first aspect of the invention and an antigenic hydrophobic complex.
  • a pharmaceutical composition comprising the immunogenic composition of the present invention, formulated as an injectable or oral product.
  • the pharmaceutical composition further includes a suitable adjuvant, excipient, diluent and/or carrier.
  • composition comprising the protein of the first aspect of the invention, the vector of the invention or the immunogenic composition of the invention.
  • a method of eliciting an anti- atherosclerosis response in a mammal comprising administering a product selected from: the recombinant protein according to the first aspect of the invention; the vector of the invention; the immunogenic composition of the invention; the pharmaceutical composition of the invention; and the pharmaceutical composition of the invention.
  • a method of treating, preventing or reducing atherosclerosis comprising administering to an individual a product selected from: the recombinant protein according to the first aspect of the invention; the vector of the invention; the immunogenic composition of the invention; the pharmaceutical composition of the invention; and the pharmaceutical composition of the invention.
  • the product may be administered in a therapeutically effective amount or therapeutically acceptable amount.
  • a method of treating an individual with early stage atherosclerosis or an individual identified as at risk of developing atherosclerosis comprising administering to an individual a product selected from: the recombinant protein according to the first aspect of the invention; the vector of the invention; the immunogenic composition of the invention; the pharmaceutical composition of the invention; and the pharmaceutical composition of the invention.
  • the product may be administered in a therapeutically effective amount or therapeutically acceptable amount.
  • a vaccine comprising the protein according to the first aspect of the invention or the vector of the invention.
  • a method of eliciting an immune response against epitopes associated with at least two independent pathways associated with atherosclerosis formation comprising:
  • Figure 1 shows a schematic representation of the backbone of the dendroaspin structure (Figure 1A) and a schematic representation of alignment of constructs and dendroaspin scaffold ( Figure 1 B).
  • Figure 2 shows levels of constructed protein-induced IgG, lgG1 , and lgG2c antibodies in the sera of B6; 129S- .d imiHe ⁇ po im2Ss ' y /J mice at 2 weeks and 12 weeks respectively, after the first immunization and in controls (GST-Den (referred as GST-den)- immunized mice).
  • FIG. 2D Cross reaction between human ApoB peptide-induced antiserum and Cpn peptide.
  • Figure 2E Cross reaction between human ApoB peptide- and hHSP60 303"312 peptide-induced antiserum and their antigens.
  • Figure 2F Cross reaction between ApoB peptide-induced antiserum and antigens of either PAR-1 peptide or C5aR peptide.
  • Figure 2G Cross reaction between C5aR peptide-induced antiserum and antigens of either ApoB peptide or PAR-1 peptide. Antiserum used for cross-reaction was taken at week 8.
  • Figure 3 shows detection and quantitation of the lesion areas in the aorta of B6; 129S- Lcf/ "" iHe 7 ⁇ po 3 im2S9y /J mice fed on a high-fat diet after immunization with constructs versus controls (GST-den).
  • A Photomicrograph of lesions observed in atherosclerotic aortas as analyzed with elastin/van Gieson staining.
  • H Percentage of reduction in lesion size in descending aortas (the reduction of control [GST- den] group was set at zero).
  • Figure 4 shows detection and quantitation of the lesion areas in the aorta of B6; 129S- Lcf/ "" iHe 7 ⁇ po 3 im2S9y /J mice fed on a high-fat diet at week 9 after immunization with constructs versus controls (GST-den), GST and alum.
  • Figure 5 shows the assessment of inflammation-associated cells in the lesions of B6; 129S-/-d/A imiHe ' " Apob tm2Sey mice fed a high-fat diet after immunization with constructs AHHC, RHHC, and RPHC.
  • Figure 6 shows the a assessment of IL-10-producing T cells, TNF-a expression in the lesions and cytokine levels in B6; 129S- .d/ imiHe ⁇ po 5 im2Ss ' y /J mice fed a high-fat diet after immunization with constructs AHHC, RHHC, and RPHC.
  • A Photomicrographs showing dual-IHC staining for IL-10 (red) and CD4 (green) (scale bar: 100 ⁇ and 12.5 ⁇ for magnified ones).
  • C Photomicrographs showing IHC staining for TNF-a (green) of lesions (scale bar: 100 ⁇ and 2.5 ⁇ for magnified ones).
  • E-H Cytokine levels measured in plasma.
  • l-L Cytokine levels measured in the supernatant of splenocytes stimulated with ConA.
  • N Percentages of IL-4 + expressing CD4 + spleen cells. Data are expressed as mean of 3 analyses ⁇ SEM. Differences between groups are shown.
  • O Representative analysis of IL-17A expression by CD4 + T-cells in splenocytes from construct-immunized mice fed on a high-fat diet as assessed by flow cytometry.
  • P Levels of IL-17A expression in spleen cells. Data are expressed as mean of 3 analyses ⁇ SEM. Differences between groups are shown.
  • FIG. 7 shows the measurement of cytokines (IFN-gamma and IL-10) from the spleen of immunized mice stimulated by antigens.
  • Splenocytes were cultured in RPMI 1640 with 10% fetal calf serum and induced withl ⁇ g/ml antigen (GST-den, GST-AHHC, GST- RHHC, GST-RPHC, ApoB100 peptide, C5aR peptide, PAR-1 peptide, respectively) for 48 hour.
  • GST-den GST-AHHC, GST- RHHC, GST-RPHC, ApoB100 peptide, C5aR peptide, PAR-1 peptide, respectively
  • IL10 and IFN- ⁇ in supernatant of cultured cell were measured with DuoSet mouse IL-10 kit and mouse IFN- ⁇ Quantikine immunoassay kit (R&D system, Minneapolis) according to manufactory's protocol.
  • Figure 8 shows the investigation of antigen-specific regulatory function in antigen- immunized mice. Inhibition of CD4 + CD25 " effector T cell proliferation by CD4 + CD25 + regulatory T-cells isolated from the spleen of control (GST-den-immunized) and construct- immunized mice when AHHC, RHHC and RPHC were used as antigens.
  • Figure 9 shows the evaluation of expression of smooth muscle alpha actins, vascular cell adhesion molecule (VCAM)-1 and matrix metalloproteinase 9 (MMP9) in lesion site.
  • A Photomicrographs showing IHC staining for smooth muscle alpha actin (red), vascular cell adhesion molecule VCAM-1 (green) (scale bar: 100 ⁇ and 12.5 ⁇ for magnified ones).
  • D Photomicrographs showing IHC staining for MMP9 (green) (scale bar: 100 ⁇ and 12.5 ⁇ for magnified ones).
  • E Scatter plot showing means of anti-MMP9 stained area (N 6).
  • Figure 10 shows representative photomicrographs showing immunohistochemical staining of the aortic root showed anti-ApoB antibody stained areas (red) in the lesion.
  • B Quantitative analysis of ApoB expression in lesions.
  • C Representative photomicrographs showing immunohistochemical staining of the aortic root showed anti-HSP60 antibody stained areas (red) in the lesion.
  • Figure 11 shows the evaluation of monocyte differentiation into macrophages.
  • a and B PBMCs differentiation stimulated by recombinant constructs (1 ⁇ g/ml) as assessed by analyses of CD206 expression by flow cytometry and inhibition of differentiation in the presence of respective construct-induced antibodies.
  • C and D Inhibition of differentiation by respective and other construct induced antibodies.
  • E and F Individual peptide as a stimulator (1 ⁇ g/ml) of monocyte differentiation as analysed by CD206 expression. Data are expressed as average values of 3 analyses.
  • Figure 12 shows the evaluation of the content of TLR4 and MyD88 contents at the lesion sites.
  • A Photomicrographs showing IHC staining for TLR4 (red) (scale bar: 100 ⁇ and 12.5 ⁇ for magnified ones).
  • B Scatter plot showing means of anti-TLR4-stained area (N 6).
  • C Photomicrographs showing IHC staining for MyD88 (red) (scale bar: 100 ⁇ and 12.5 ⁇ for magnified ones).
  • B Scatter plot showing means of anti-MyD88-stained area (N 6).
  • Figure 13 shows (A) Representative photomicrographs showing immunohisto- chemical staining of the aortic root showed anti-CD11 c antibody stained areas (green) overlapped with anti-TLR4 antibody stained area (red) in the lesion (yellow). (B) Measurement of combined area of CD11 c and TLR4) occupied in lesion (%). Scale bar: 141 ⁇ (unenlarged) and 26 ⁇ (enlarged).
  • Table 1 shows the statistical analysis of the effect of immunization with the peptides.
  • Figure 14A shows the SEQ ID NO: 1 of the native dendroaspin amino acid sequence
  • Figure 14B shows the amino acid sequence of C5a SEQ ID NO:2
  • Figure 14C shows the amino acid sequence of C5Ar SEQ ID NO:6.
  • An alternative embodiment is the construct AH h H m R wherein the antigenic epitopes are from ApoB (AA688-707), designated as A, human HSP60 (AA303-312) (SEQ ID NO: 12) designated as H h , mycobacterium (AA253-268) (SEQ ID NO:15) designated as H m and complement component 5a receptor (AA1-31) (SEQ ID NO:9) designated as R. Immunization of B6;
  • mice with these elicited production of high levels of antibodies against each epitope (apart from hHSP60 153"163 and P which induced a low antibody response).
  • Reduction of plaque size in the aortic sinus and descending aorta correlated with alterations in cellular immune responses when compared with controls.
  • Native dendroaspin is a 59 amino acid peptide and the dendroaspin scaffold lends itself to modification.
  • dendroaspin including the RGD motif
  • further functional amino acid sequences e.g. active portions or motifs of agonists, antagonists or inhibitors of factors in the clotting cascade
  • the resulting molecules are particularly useful as anticoagulants and do not suffer from the drawbacks associated with existing anticoagulants (see International application WO 01/57210).
  • Such hybrid polypeptides may comprise a first amino acid sequence including the RGD motif and conferring dendroaspin activity and a further amino acid sequence conferring activity other than that of dendroaspin activity.
  • C5a is a protein fragment released from complement component C5. This 74 amino acid peptide in humans is generated by the cleavage of C5a convertase on the C5 a-chain during the classical, alternative, and lectin pathways of complement activation.
  • the C5a receptor also known as component 5a receptor (C5AR1) or CD88 (cluster of differentiation 88) is a G protein-coupled receptor for Ca.
  • Human C5aR is an integral membrane glycoprotein consisting of 350 amino acids forming a single poly-peptide chain. The C5aR is not released as a soluble receptor and does not circulate. C5aR is expressed on differentiated myeloid cells, such as U937 and HL-60.
  • C5aR is expressed on liver parenchymal cells, lung vascular smooth muscle, lung and umbilical vascular endothelial cells, bronchial and alveolar epithelial cells, HepG2 cells, a hepatoma cell line, mesangial cells, as well as astrocytes and microglial cells, on cultured human fetal astrocytes and astrocyte cell line.
  • Glutathione S-transferase-dendroaspin GST-tagged-den here referred to as a control, Figure 1A
  • GST-recombinant construct AHHC [ApoBI OO peptide, amino acids (aa) 688-707 (numbered including signal peptide), human heat shock protein (hHSP) 60 peptide, aa 303-312 and aa 153- 163, respectively; and Chlamydia pneumoniae (Cpn) derived epitope ("C”, denotes a combination of aa 66-73 from major out membrane protein (MOMP) and aa 283-291 from outer membrane 5 of Cpn)] was described previously and construct RHHC ("R” denotes a C5aR peptide, aa 1-31) and RPHC ("P” denotes an protease activated receptor- 1 (PAR)
  • mice B6; 129S- .d/ imiHe ⁇ po 5 im2Ss ' y /J mice were used, each group of mice consisting of 5- 6-week-old males.
  • Dendroaspin as a control antigen, since dendroaspin was used as a scaffold and previous data showed no effect of dendroaspin on lesion reduction when used for subcutaneous immunization in mice.
  • the immunizing antigens used were constructs AHHC, RHHC and RPHC, respectively.
  • the repetitive immunization multiple sites strategy (RIMMS) was adopted [1] and mice were sacrificed at the end of week 12 (a high-fat diet was started at the end of week 2 and continued for 10 weeks).
  • the control groups followed the diet program after immunization with GST-tagged Den and Alum (adjuvant).
  • aorta tissues were harvested and mounted in optimal cutting temperature compound (OCT) and in paraffin, for immunohistochemical (IHC) analyses and lesion measurement, respectively.
  • OCT optimal cutting temperature compound
  • IHC immunohistochemical
  • Atherosclerotic lesions in aortic roots were examined by an Olympus UULH Optical microscope (Olympus Optical Co. Ltd, Tokyo, Japan) and analyzed with Image-Pro Plus TM software, version 7.0 (Media Cybernetics, Inc., Bethesda, MD, USA). Longitudinally opened descending aortas were evaluated for the extent of atherosclerosis after Oil Red O (ORO) staining.
  • ORO Oil Red O
  • peptide-specific antibody levels in the plasma samples were measured by ELISA following the manufacturer's instructions.
  • One third of spleens were embedded in OCT and the remaining part was homogenized by pressing through 70 ⁇ cell strainer and frozen for further analysis.
  • OCT-embedded samples were used for detection of CD68, CD11 c, Interleukin (IL)- 10 and tumour necrosis factor (TNF)-a, Foxp3, vascular cell adhesion molecule (VCAM)1 , alpha smooth muscle cell (alpha-SMC), matrix metalloproteinase 9 (MMP9) by IHC analyses. Sections of paraffin-embedded tissues were stained with hematoxylin and eosin (HE) and elastin/van Gieson (Sigma) for histological examination by the Olympus U-ULH Optical microscope.
  • HE hematoxylin and eosin
  • HE elastin/van Gieson
  • Spleen cells were processed for staining (30 min at 4 °C) using allophycocyanin- anti-mouse Foxp3, IL-2, IL4 and IL-17 antibodies (BioLegend, Cambridge, UK).
  • mouse C57BL/6 PBMCs were stimulated with different antigens or pre- incubated with antiserum of antigen (in order to see any antagonism of antiserum).
  • Antigen-induced differentiation of monocytes into macrophages was measured by flow cytometry which was compared to cell populations from non-induced cells or control antigen (GST-Den)-induced cells.
  • IL-10 and TNF-a levels in the lesions were quantified by IHC analyses (rat anti- mouse TNF-a and IL-10 purchased from BioLegend, CA, USA). Plasma levels of the cytokines, IL-10, transforming growth factor beta (TGF- ⁇ ), TNF-a and interferon gamma (IFN- ⁇ ) were measured by ELISA following the manufacturer's instructions (R&D systems, Abingdon, UK). Levels of concanavalin A (ConA)-induced IL-10, TGF- ⁇ , TNF-a, and IFN- ⁇ in splenocyte cultures were also measured.
  • IHC analyses rat anti- mouse TNF-a and IL-10 purchased from BioLegend, CA, USA.
  • Plasma levels of the cytokines, IL-10, transforming growth factor beta (TGF- ⁇ ), TNF-a and interferon gamma (IFN- ⁇ ) were measured by ELISA following the manufacturer's instructions (R&D systems, Abingdon, UK).
  • CD4 + CD25 + Treg cells were isolated by using regulatory T cell isolation kit of Miltenyi Biotec (Bergisch Gladbach, Germany) from spleen CD4 + T cells of 6 ⁇ 29S-Ldlr' m1Her Apob tm2S9y /J mice immunized subcutaneously with constructs, respectively.
  • CD4 + CD25 " T effector cells were isolated from spleen CD4 + T cells (unbound to beads binding CD4 + CD25 + cells , 99.5% of CD4 + cells) of same construct-immunized mice respectively.
  • CD4 + CD25 " cells (2* 10 5 ) were co-cultured with CD4 + CD25 + cells (2* 10 5 ), and stimulated with 1 ⁇ related construct or with GST-Den control. After 2 days of culture, the proliferation of T effector cells was measured for the shift in fluorescence intensity of a population of cells by flow cytometry expressed as mean fluorescence intensity (MFI).
  • MFI mean fluorescence intensity
  • Peptide-specific immunoglobulin G in the sera of immunized mice was assessed. Antibody levels were measured by ELISA test in the sera of mice immunized with either dendroaspin (GST-tagged) or constructs within dendroaspin scaffold (GST-tagged) at weeks 2 and week 12 respectively after first immunization. In AHHC-immunized mice, ApoB peptide-, hHSP60 303"312 - and Cpn-peptide-specific antibodies were observed when these peptides were used as ELISA antigens ( Figure 2A).
  • Lesion size was smaller in mice immunized with all three constructs showing 31 ,071 ⁇ 998.7 ⁇ 2 , 24, 123 ⁇ 1967 ⁇ 2 and 21 ,386 ⁇ 2482 ⁇ 2 (P ⁇ 0.001) compared with controls (70200 ⁇ 5718 ⁇ 2 ).
  • the percentage of reduction in lesion size is shown in Figure 3C, showing 55.7 ⁇ 3.4%, 65.6 ⁇ 1.3% and 69.5 ⁇ 1.1 % when assuming reduction in lesion of control animals as zero percent.
  • Plasma levels of atheroprotective cytokines IL-10 were significantly increased in mice immunized with these three constructs compared with controls ( Figures 6E and 6F). Immunization with RPHC had more effect than with other two constructs on promoting the secretion of IL-10 and TGF- ⁇ (P ⁇ 0.05 to ⁇ 0.001). Plasma levels of the atherogenic cytokine TNF-a were significantly reduced by immunization with these three constructs ( Figure 6G). A similar trend was obtained for these constructs in respect of plasma levels of IFN- ⁇ ( Figure 6H).
  • slightly higher plasma levels of IFN- ⁇ from mice immunized with AHHC was observed compared to that of control mice (24 versus 20.8 pg/ml), this difference did not show statistical significance.
  • TNF-a Figure 4K
  • IFN- ⁇ levels Figure 6L
  • TNF-a and IFN- ⁇ in RPHC-immunized mice were significantly decreased in the supernatants of splenocytes of mice immunized with these constructs compared with the control when stimulated with 10 ⁇ g/mL of ConA.
  • levels of TNF-a and IFN- ⁇ in RPHC-immunized mice were lower than those in AHHC-immunized mice (P ⁇ 0.05-0.01) when stimulated with 10 ⁇ g/mL of ConA, respectively.
  • Antigen-induced specific Treg cell function was investigated. To assess whether functional Treg cells were induced by immunization, antigen-specific Treg cells (CD4 + CD25 + T cells) were co-cultured with CD4 + effector T-cells (CD4 + CD25 " T cells). Proliferation of effector T-cells from control mice immunized with GST-Den in response to stimulation with GST-Den at 1 ⁇ did not show suppression in the presence of Treg cells from GST-Den- immunized mice ( Figures 8A and 8B).
  • monocyte differentiation into macrophages in PBMC from C57BL/6 background naive mice in response to treatment with recombinant constructs and the effect of construct-specific immune sera on the differentiation was investigated.
  • monocytes can differentiate into macrophage (or subsets) upon stimulation with macrophage-colony stimulating factor (M-CSF) or atherogenic antigens.
  • M-CSF macrophage-colony stimulating factor
  • AHHC converted into RHHC with a single domain substitution could maintain the same effect on stimulation of monocyte (from naive mice C57BL/6 with same background)
  • PBMCs were stimulated with either RHHC or AHHC. After 3 days, the expression of cell surface marker CD206 (mannose receptor, a macrophage marker) was assessed.
  • CD206 mannose receptor, a macrophage marker
  • EXAMPLE 8 Evaluation of the contents of Toll-like receptor 4(TLR4) and myeloid differentiation factor 88 (MyD88) which are involved in the TLR4 signal pathway related to atherosclerosis at the lesion sites was investigated. The impact of the treatment with these recombinant constructs on TLR4 and MyD88 contents in lesions was examined. The reduction of atherosclerosis in mice treated with these constructs was associated with a decrease in both TLR4 and MyD88 contents.
  • TLR4 Toll-like receptor 4
  • MyD88 myeloid differentiation factor 88
  • Anti-TLR4 stained area was significantly smaller in the plaques of mice immunized with AHHC, RHHC and RPHC, showing 4.6 ⁇ 1.0%, 3.4 ⁇ 0.5% and 4.2 ⁇ 0.6%, respectively, compared with that in controls immunized with dendroaspin (8.1 ⁇ 1.1 %) ( Figures 12A and 12B).
  • anti-MyD88 stained area was significantly smaller in the lesions of mice immunized with these three constructs, showing 9.7 ⁇ 1.2%, 9.6 ⁇ 1.6% and 10.2 ⁇ 1.9%, respectively, compared with that in controls (18.6 ⁇ 2.4%) ( Figures 12C and 12D).
  • HSP60 HSP60 peptides derived from human and mycobacterium, respectively, for their ability to reduce atherosclerotic lesions through immunization in Apob tm2S9y Ldlr tm1 He 7J Mice.
  • Mice were immunized with two Keyhole limpet hemocyanin (KLH)-conjugated peptides derived from mycobacterial heat shock protein (HSP) 60 (AA253-268) (SEQ ID NO:15) designated as mHSP60 253"268 , human HSP60 (AA516-528) (SEQ ID NO:14)designated as hHSP60 516"528 , respectively.
  • KLH Keyhole limpet hemocyanin
  • mice were immunized with these two peptides and two weeks after the first immunization, mice were placed on a high-fat diet. Results indicated that the two peptides showed similar functions apart from that mHSP60 peptide has lower titres for IgG and lgG1 and little for lgG2c, than those of hHSP60 peptide. Similar functions include: induced specific immune responses; lesion reduction; increased Treg expression; increased concentration of atheroprotective cytokines: IL-10 and TGF- ⁇ and decreased concentration of pro-inflammatory cytokines: TNF-a and INF- ⁇ ; inhibition of CD4 + CD25 " T-cell proliferation by Treg cells and down- regulation of TLR4/MyD88 pathway (data not shown).
  • the transcriptional regulator FOXP3 (forkhead box P3) governs mouse CD4 + CD25 + Treg function (Fontenot et al., Nat Immunol. 2003;4:330 -336; Hori S, Nomura T, Sakaguchi S. Science. 2003;299:1057-1061) and it has been shown that transfer of natural CD4 + CD25 + Tregs significantly reduces plaque progression in the ApoE-KO mouse model (Ait-Oufella et al., Nat Med. 2006;12: 178-180; Mor et al Arterioscler Thromb Vase Biol. 2007;27: 893-900).
  • Tregs are capable of influencing the size and composition of atherosclerotic lesions
  • several reports support the theory that antigen-specific responses may be operable in the evolving atheromatous plaque.
  • atherogenic antigen-induced Treg may have a specific function on lesion reduction.
  • the first method to look at the immune response and adoptive transfer in KO mice, involved incorporating construct AH h H m R into a dendroaspin scaffold to generate a recombinant construct.
  • the antigenic epitopes from ApoB was designated as A, human HSP60 (AA303-312) (SEQ ID NO: 12) designated as H h , mycobacterium (AA253- 268) (SEQ ID NO:15) designated as H m and complement component 5a receptor (AA1-31) (SEQ ID NO:9) designated as R.
  • Mice were immunized with AH h H m R by RIMM (repetitive, multiple site immunization strategy) protocol.
  • Treg cells were purified from the blood of immunized mice with AH h H m R (Treg S) and with dendroaspin ( Treg c ) respectively). Adoptive transfer was achieved though retro-orbital plexus of the mice.
  • the second method to evaluate the effect of Treg cells on atherosclerotic lesion formation, involved adoptive transfer of Treg cells from the blood of AGD-den (Control)- and AHhHmR - immunized mice, respectively. Recipients were from the same strain non- immunized naive mice and were fed with a high-fat diet (HFD) for 10 weeks then sacrificed. Histological and immunohistochemical assessment of lesion development, analysis of cytokine level, assessment of Treg activity and foam cell formation were evaluated.
  • HFD high-fat diet

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Cell Biology (AREA)
  • Rheumatology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Heart & Thoracic Surgery (AREA)
  • General Chemical & Material Sciences (AREA)
  • Urology & Nephrology (AREA)
  • Vascular Medicine (AREA)
  • Cardiology (AREA)
  • Pulmonology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Communicable Diseases (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
PCT/GB2016/050150 2015-01-27 2016-01-25 Multi-epitopic construct Ceased WO2016120596A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
CA2974884A CA2974884C (en) 2015-01-27 2016-01-25 Multi-epitopic construct
JP2017557501A JP6831334B2 (ja) 2015-01-27 2016-01-25 複数エピトープ構築物
US15/546,858 US11332515B2 (en) 2015-01-27 2016-01-25 Multi-epitopic construct
EP16701871.2A EP3250584B1 (en) 2015-01-27 2016-01-25 Multi-epitopic construct
US17/693,785 US20220195013A1 (en) 2015-01-27 2022-03-14 Multi-epitopic construct

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
GB1501354.4 2015-01-27
GB1501354.3 2015-01-27
GBGB1501354.3A GB201501354D0 (en) 2015-01-27 2015-01-27 Multi-epitopic construct
GBGB1510195.9A GB201510195D0 (en) 2015-06-11 2015-06-11 Multi-epitopic construct
GB1510195.9 2015-06-11

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/546,858 A-371-Of-International US11332515B2 (en) 2015-01-27 2016-01-25 Multi-epitopic construct
US17/693,785 Continuation US20220195013A1 (en) 2015-01-27 2022-03-14 Multi-epitopic construct

Publications (2)

Publication Number Publication Date
WO2016120596A1 true WO2016120596A1 (en) 2016-08-04
WO2016120596A8 WO2016120596A8 (en) 2018-01-04

Family

ID=55237682

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2016/050150 Ceased WO2016120596A1 (en) 2015-01-27 2016-01-25 Multi-epitopic construct

Country Status (5)

Country Link
US (2) US11332515B2 (cg-RX-API-DMAC7.html)
EP (1) EP3250584B1 (cg-RX-API-DMAC7.html)
JP (4) JP6831334B2 (cg-RX-API-DMAC7.html)
GB (1) GB2539743A (cg-RX-API-DMAC7.html)
WO (1) WO2016120596A1 (cg-RX-API-DMAC7.html)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
USD848466S1 (en) 2015-06-14 2019-05-14 Google Llc Display screen with animated graphical user interface for smart home automation system having a multifunction status

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP6831334B2 (ja) 2015-01-27 2021-02-17 スロムボーシス リサーチ インスティチュート 複数エピトープ構築物
WO2022043686A1 (en) * 2020-08-25 2022-03-03 Thrombosis Research Institute Vaccine

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009125231A2 (en) * 2008-04-10 2009-10-15 Thrombosis Research Institute Anti-atheroma vaccine

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB0002625D0 (en) 2000-02-05 2000-03-29 Trigen Ltd Dendroaspin molecules
WO2001094411A1 (en) * 2000-06-05 2001-12-13 The Regents Of The University Of California Peptides modulating protease activated receptors and methods of using same
GB201206761D0 (en) * 2012-04-17 2012-05-30 Thrombosis Res Inst Anti-atherogenic peptides
JP6831334B2 (ja) 2015-01-27 2021-02-17 スロムボーシス リサーチ インスティチュート 複数エピトープ構築物

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009125231A2 (en) * 2008-04-10 2009-10-15 Thrombosis Research Institute Anti-atheroma vaccine

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
LU XINJIE ET AL: "Immunization With a Combination of 2 Peptides Derived From the C5a Receptor Significantly Reduces Early Atherosclerotic Lesion in Ldlr(tm1Her) Apob(tm2Sgy)J Mice", vol. 32, no. 10, 1 October 2012 (2012-10-01), pages 2358 - 2371, XP008163371, ISSN: 1079-5642, Retrieved from the Internet <URL:http://atvb.ahajournals.org/> [retrieved on 20120726], DOI: 10.1161/ATVBAHA.112.253179 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
USD848466S1 (en) 2015-06-14 2019-05-14 Google Llc Display screen with animated graphical user interface for smart home automation system having a multifunction status

Also Published As

Publication number Publication date
US20180273608A1 (en) 2018-09-27
US11332515B2 (en) 2022-05-17
CA2974884A1 (en) 2016-08-04
JP6831334B2 (ja) 2021-02-17
GB2539743A8 (en) 2017-01-11
JP7662203B2 (ja) 2025-04-15
US20220195013A1 (en) 2022-06-23
JP2021019614A (ja) 2021-02-18
JP2018505697A (ja) 2018-03-01
GB2539743A (en) 2016-12-28
GB201601286D0 (en) 2016-03-09
EP3250584A1 (en) 2017-12-06
JP7204226B2 (ja) 2023-01-16
JP2023030096A (ja) 2023-03-07
WO2016120596A8 (en) 2018-01-04
EP3250584B1 (en) 2021-05-12
JP2025094254A (ja) 2025-06-24

Similar Documents

Publication Publication Date Title
JP7662203B2 (ja) 複数エピトープ構築物
CN110494449B (zh) Alt-803与抗cd38抗体组合用于癌症治疗
KR20180123064A (ko) 질환의 요인이 되는 생체내 단백질을 표적으로 하는 컨쥬게이트 백신
JP2011526485A (ja) 血栓障害および自己免疫障害の処置におけるcd31ペプチドの使用
US20210346476A1 (en) Modified FVIII Apitope Peptides
CN101835483A (zh) 动脉粥样硬化的治疗
JP5784009B2 (ja) Fviii由来ペプチド
Hainline et al. Active immunotherapy for C5a-mediated inflammation using adjuvant-free self-assembled peptide nanofibers
CA2580261A1 (en) Treatment of atherosclerosis
Odales et al. Antitumor efficacy of MUC1-derived variable epitope library treatments in a mouse model of breast cancer
Guan et al. Development of recombinant vaccines against IL-12/IL-23 p40 and in vivo evaluation of their effects in the downregulation of intestinal inflammation in murine colitis
CA2974884C (en) Multi-epitopic construct
JP2018521016A (ja) IL−23−p19ワクチン
WO2013156771A1 (en) Anti-atherogenic peptides
EP2480251B1 (en) Carrier conjugates of il-23-peptides and their induced antibodies
Kitano Role of NKT cell activation in malondialdehyde-modified low density lipoprotein immunization for atherosclerosis prevention
HK1209138B (en) Factor viii-derived peptides for use in the treatment of haemophilia a

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16701871

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2974884

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2017557501

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 15546858

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2016701871

Country of ref document: EP