WO2016106221A1 - Anti-mertk agonistic antibodies and uses thereof - Google Patents
Anti-mertk agonistic antibodies and uses thereof Download PDFInfo
- Publication number
- WO2016106221A1 WO2016106221A1 PCT/US2015/067118 US2015067118W WO2016106221A1 WO 2016106221 A1 WO2016106221 A1 WO 2016106221A1 US 2015067118 W US2015067118 W US 2015067118W WO 2016106221 A1 WO2016106221 A1 WO 2016106221A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- mertk
- antigen
- binding fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/135—Amines having aromatic rings, e.g. ketamine, nortriptyline
- A61K31/138—Aryloxyalkylamines, e.g. propranolol, tamoxifen, phenoxybenzamine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
- A61K31/337—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having four-membered rings, e.g. taxol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
- A61K31/403—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
- A61K31/404—Indoles, e.g. pindolol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/4353—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems
- A61K31/436—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a six-membered ring having oxygen as a ring hetero atom, e.g. rapamycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/445—Non condensed piperidines, e.g. piperocaine
- A61K31/4523—Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems
- A61K31/4535—Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a heterocyclic ring having sulfur as a ring hetero atom, e.g. pizotifen
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/475—Quinolines; Isoquinolines having an indole ring, e.g. yohimbine, reserpine, strychnine, vinblastine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/513—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/655—Azo (—N=N—), diazo (=N2), azoxy (>N—O—N< or N(=O)—N<), azido (—N3) or diazoamino (—N=N—N<) compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/66—Phosphorus compounds
- A61K31/675—Phosphorus compounds having nitrogen as a ring hetero atom, e.g. pyridoxal phosphate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present disclosure provides antibodies that specifically bind to Mer Tyrosine Kinase (MERTK) (e.g., human MERTK, or both human and mouse MERTK) and compositions comprising such antibodies, wherein said antibody agonizes MERTK signaling on endothelial cells.
- MERTK Mer Tyrosine Kinase
- the present disclosure also provides methods for treating cancer, by administering an antibody that specifically binds to MERTK and agonizes MERTK signaling on endothelial cells.
- MERTK Mer Tyrosine Kinase
- MERTK also referred to as c-mer, MER, Proto- oncogene c-Mer, Receptor Tyrosine Kinase MerTK, Tyrosine-protein Kinase Mer, STK Kinase, RP38, or MGC133349
- TAM family of receptor tyrosine kinases which also include AXL and TYR03 kinases.
- MERTK transduces signals from the extracellular space via activation by binding of ligands, most notably Gas-6, a soluble protein.
- the MERTK receptor exists in both membrane bound and soluble forms.
- the extracellular domain can be cleaved to generate a soluble extracellular domain, which is hypothesized to act as a decoy receptor to negatively regulate MERTK receptor activation on cells by reducing the ability and/or availability of soluble Gas-6 ligand to bind membrane-bound MERTK (Sather S et al, (2007) Blood 109: 1026-1033).
- MERTK has dual roles related to cancer progression, angiogenesis, and metastasis.
- Gas-6 activation of MERTK on endothelial cells results in inhibition of endothelial cell recmitment by cancer cells in a co-culture system.
- Endothelial recruitment is a key feature of cancer cells that allows for tumor angiogenesis, tumor growth, and metastasis.
- MERTK plays an opposite role in cancer cells, where its over-expression leads to increased metastasis, likely by releasing cleaved MERTK to generate soluble MERTK extracellular domain protein as a decoy receptor.
- tumor cells secrete a soluble form of the extracellular MERTK receptor that acts as a decoy receptor to reduce the ability (and/or availability) of soluble Gas-6 ligand to activate MERTK on endothelial cells, ultimately leading to endothelial recruitment, angiogenesis, and cancer progression (Png KJ et al, (2012) Nature 481 : 190-194).
- an anti- MERTK antibody or antigen-binding fragment thereof described herein specifically recognizes the extracellular portion of human MERTK.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein specifically recognizes the extracellular portion of human MERTK.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein competes with Gas-6 for binding to MERTK (e.g., human MERTK, or both human and mouse MERTK).
- MERTK e.g., human MERTK, or both human and mouse MERTK.
- an anti-MERTK antibody or antigen- binding fragment described herein is monoclonal.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein is an immunoglobulin comprising two identical light chains and two identical heavy chains.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a light chain variable region (VL) comprising:
- the anti-MERTK antibody or antigen-binding fragment thereof comprises one, two, or all three of the VH CDRs above.
- the antibody or antigen-binding fragment thereof comprises a VH CDRl in Table 1 or Table 3.
- the anti-MERTK antibody or antigen-binding fragment thereof comprises a VH CDR2 in Table 1 or Table 3.
- the anti-MERTK antibody or antigen-binding fragment thereof comprises a VH CDR3 in Table 1 or Table 3.
- the anti-MERTK antibody or antigen-binding fragment thereof comprises a VH CDRl, a VH CDR2, and a VH CDR3 of the antibody M6 (Table 1).
- the anti-MERTK antibody or antigen-binding fragment thereof comprises a VH CDRl, a VH CDR2, and a VH CDR3 of the antibody M19 (Table 3).
- the anti-MERTK antibody or antigen-binding fragment thereof comprises one, two, or all three of the VL CDRs above.
- the anti-MERTK antibody or antigen-binding fragment thereof comprises a VL CDRl in Table 2 or Table 4.
- the anti-MERTK antibody or antigen-binding fragment thereof comprises a VL CDR2 in Table 2 or Table 4.
- the anti-MERTK antibody or antigen-binding fragment thereof comprises a VL CDR3 in Table 2 or Table 4.
- the anti-MERTK antibody or antigen-binding fragment thereof comprises a VL CDRl, a VL CDR2, and a VL CDR3 of the antibody M6 (Table 2).
- the anti-MERTK antibody or antigen- binding fragment thereof comprises a VL CDRl, a VL CDR2, and a VL CDR3 of the antibody Ml 9 (Table 4).
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises: (a) a VH CDR1 of GYTFTNYGMN (SEQ ID NO: 3); and/or
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- VL CDR2 comprising, of WAS (SEQ ID NO: 20);
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen -binding fragment thereof that specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprising a heavy chain variable region sequence comprising the amino acid sequence of SEQ ID NO: 49.
- an anti-MERTK antibody or antigen-binding fragment thereof that specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprising a heavy chain variable region sequence comprising the amino acid sequence of SEQ ID NO: 51.
- an anti-MERTK antibody or antigen -binding fragment thereof that specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprising a light chain variable region sequence comprising the amino acid sequence of SEQ ID NO: 50.
- an anti-MERTK antibody or antigen-binding fragment thereof that specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprising a light chain variable region sequence comprising the amino acid sequence of SEQ ID NO: 52.
- an anti-MERTK antibody or antigen -binding fragment thereof that specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprising (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 50.
- an antibody or fragment thereof that specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprising (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 51 ; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 52.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- an antibody provided herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises heavy and/or light chain constant regions.
- the heavy chain constant region is selected from the group of human immunoglobulins consisting of IgGi, IgG 2> IgG 3 , IgG 4; IgAi, and IgA 2 .
- the light chain constant region is selected from the group of human immunoglobulins consisting of 3 ⁇ 4GK and IgG .
- the antibody comprises a constant region having increased binding affinity to one or more human Fc gamma receptor(s).
- the antibody comprises a constant region having decreased binding affinity to one or more human Fc gamma receptor(s).
- an anti-MERTK antibody or antigen -binding fragment thereof that binds to the same epitope of MERTK (e.g., human MERTK, or both human and mouse MERTK) as the antibody described herein.
- an anti-MERTK antibody or antigen-binding fragment thereof that competes with an anti-MERTK antibody or an antigen-binding fragment thereof described herein for binding to MERTK (e.g. , human MERTK, or both human and mouse MERTK).
- a first anti-MERTK antibody or antigen-binding fragment thereof that competes with an anti-MERTK antibody or an antigen-binding fragment thereof described herein for binding to MERTK (e.g. , human MERTK, or both human and mouse MERTK), wherein the competition is exhibited as reduced binding of the first anti-MERTK antibody or antigen-binding fragment thereof to MERTK (e.g.
- human MERTK or both human and mouse MERTK
- 80% e.g., 85%, 90%, 95%, or 98%, or between 80% to 85%, 80% to 90%, 85% to 90%, or 85% to 95%) in the presence of the anti-MERTK antibody or antigen- binding fragment thereof described herein.
- an antibody provided herein which specifically binds to MERTK (e.g. , human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells is a human antibody, humanized antibody, murine antibody or chimeric antibody.
- an antibody provided herein, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) with a KD in the range of about 3 pM to 400 pM.
- an antibody provided herein is isolated.
- an antibody provided herein is a monoclonal antibody.
- nucleic acid molecules encoding a heavy chain variable region and/or a light chain variable region, or a heavy chain and/or a light chain of an anti-MERTK antibody described herein.
- the nucleic acid molecule encodes a heavy chain variable region comprising the nucleic acid sequence of SEQ ID NO: 53 or SEQ ID NO: 55.
- the nucleic acid molecule encodes a light chain variable region comprising the nucleic acid sequence of SEQ ID NO: 54 or SEQ ID NO: 56.
- the nucleic acid molecule is isolated.
- a vector (e.g., an isolated vector) comprises a polynucleotide encoding a heavy chain variable region and/or a light chain variable region, or a heavy chain and/or a light chain of an anti-MERTK antibody described herein.
- a host cell comprises the polynucleotide or vector. Examples of host cells include E. coli, Pseudomonas, Bacillus, Streptomyces, yeast, CHO, YB/20, NS0, PER-C6, HEK-293T, NIH-3T3, HeLa, BHK, Hep G2, SP2/0, Rl .
- an anti- MERTK antibody or antigen-binding fragment thereof that specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprising culturing a host cell so that the polynucleotide is expressed and the antibody is produced.
- compositions comprising an anti-MERTK antibody or an antigen-binding fragment thereof, a
- the pharmaceutical composition can be used to treat cancer.
- provided herein is a method of treating cancer in a subject, comprising administering to the subject an effective amount of an anti-MERTK antibody or an antigen-binding fragment thereof described herein.
- provided herein is a method for treating cancer in a subject comprising administering to the subject a pharmaceutical composition described herein.
- the method of treating cancer results in inhibition of the migration of endothelial cells, inhibition of angiogenesis, and/or inhibition of tumor progression.
- the cancer treated by the methods provided herein is a cancer of the lung, breast, bone, ovary, stomach, pancreas, larynx, esophagus, testes, liver, parotid, biliary tract, colon, rectum, cervix, uterus, endometrium, kidney, bladder, prostate or thyroid.
- the cancer treated is a sarcoma, squamous cell carcinoma, melanoma, glioma, glioblastoma, neuroblastoma or Kaposi's sarcomas.
- the cancer treated by the methods provided herein is breast cancer. In a specific embodiment, the cancer treated by the methods provided herein is triple-negative breast cancer.
- the method of treating cancer further comprises administering to the subject an additional therapeutic agent.
- additional therapeutic agents that can be administered to a subject in combination with an anti- MERTK antibody or antigen-binding fragment thereof described herein or a
- the additional therapeutic agents administered to a subject in combination with an anti-MERTK antibody or antigen-binding fragment thereof described herein is an agent used to treat breast cancer, an agent used to treat melanoma, an immunotherapy, or an angiogenesis inhibitor.
- the additional therapeutic agent is an agent used to treat breast cancer that is selected from the group consisting of Tamoxifen, Raloxifene, Paclitaxel (TAXOL ® ), Cyclophosphamide, Docetaxel, Vinblastine, Fluorouracil,
- the additional therapeutic agent is an agent used to treat melanoma that is selected from the group consisting of a BRAF inhibitor, a MEK inhibitor, and dacarbazine.
- the additional therapeutic agent is an antibody that is a CTLA-4 inhibitor, a PD-1 inhibitor, or a PD-L1 inhibitor.
- the additional therapeutic agent is an angiogenesis inhibitor that is selected from the group consisting of a VEGF inhibitor, a VEGFR2 inhibitor, Sunitinib, and Sorafenib.
- the subject treated by the methods described herein is a human.
- an antibody or an antigen-binding fragment thereof that specifically binds to human Mer Tyrosine Kinase (MERTK), wherein the antibody agonizes human MERTK signaling of endothelial cells.
- MERTK Mer Tyrosine Kinase
- the antibody or antigen- binding fragment thereof further specifically binds to murine MERTK.
- the antibody specifically recognizes the extracellular domain of human MERTK, and the extracellular domain comprises the amino acid sequence of SEQ ID NO: 58.
- the antibody competes with Gas-6 for binding to human MERTK.
- the antibody is a monoclonal antibody.
- the antibody is an immunoglobulin comprising two identical light chains and two identical heavy chains.
- each of the heavy chains comprises a variable region (VH), which comprises a
- each of the light chains comprises a variable region (VL), which comprises a complementarity determining region (CDR) 1 of SEQ ID NO: 15, a CDR2 of SEQ ID NO: 19, and a CDR3 of SEQ ID NO: 22.
- VL variable region
- each of the heavy chains comprises a variable region (VH) and the VH comprises a CDRl of SEQ ID NO: 2, a CDR2 of SEQ ID NO: 7, and a CDR3 of SEQ ID NO: 12.
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 16, a CDR2 of SEQ ID NO: 20, and a CDR3 of SEQ ID NO: 23.
- each of the heavy chains comprises a variable region (VH) and the VH comprises a CDRl of SEQ ID NO: 3, a CDR2 of SEQ ID NO: 8, and a CDR3 of SEQ ID NO: 11.
- each of the light chains comprises a variable region (VL), which comprises a complementarity determining region (CDR) 1 of SEQ ID NO: 15, a CDR2 of SEQ ID NO: 19, and a CDR3 of SEQ ID NO: 22.
- each of the heavy chains comprises a variable region (VH) and the VH comprises a CDRl of SEQ ID NO: 4, a CDR2 of SEQ ID NO: 9, and a CDR3 of SEQ ID NO: 13.
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 17, a CDR2 of SEQ ID NO: 21, and a CDR3 of SEQ ID NO: 24.
- each of the heavy chains comprises a variable region (VH) and the VH comprises a CDRl of SEQ ID NO: 5, a CDR2 of SEQ ID NO: 10, and a CDR3 of SEQ ID NO: 14.
- each of the light chains comprises a variable region (VL) and the VL comprises CDRl of SEQ ID NO: 18, a CDR2 of SEQ ID NO: 20, and a CDR3 of SEQ ID NO: 22.
- each of the heavy chains comprises a variable region (VH) and the VH comprises CDRl of SEQ ID NO: 3, a CDR2 of SEQ ID NO: 6, and a CDR3 of SEQ ID NO: 11.
- each of the light chains comprises a variable region (VL), which comprises a complementarity determining region (CDR) 1 of SEQ ID NO: 15, a CDR2 of SEQ ID NO: 19, and a CDR3 of SEQ ID NO: 22.
- each of the heavy chains comprises a variable region (VH) and the VH comprises a CDRl of SEQ ID NO: 25, a CDR2 of SEQ ID NO: 30, and a CDR3 of SEQ ID NO: 35.
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 39, a CDR2 of SEQ ID NO: 43, and a CDR3 of SEQ ID NO: 46.
- each of the heavy chains comprises a variable region (VH) and the VH comprises a CDRl of SEQ ID NO: 26, a CDR2 of SEQ ID NO: 31, and a CDR3 of SEQ ID NO: 36.
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 40, a CDR2 of SEQ ID NO: 44, and a CDR3 of SEQ ID NO: 47.
- each of the heavy chains comprises a variable region (VH) and the VH comprises a CDRl of SEQ ID NO: 27, a CDR2 of SEQ ID NO: 32, and a CDR3 of SEQ ID NO: 35.
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 39, a CDR2 of SEQ ID NO: 43, and a CDR3 of SEQ ID NO: 46.
- each of the heavy chains comprises a variable region (VH) and the VH comprises a CDRl of SEQ ID NO: 28, a CDR2 of SEQ ID NO: 33, and a CDR3 of SEQ ID NO: 37.
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 41, a CDR2 of SEQ ID NO: 45, and a CDR3 of SEQ ID NO: 48.
- each of the heavy chains comprises a variable region (VH) and the VH comprises a CDRl of SEQ ID NO: 29, a CDR2 of SEQ ID NO: 34, and a CDR3 of SEQ ID NO: 38.
- VH variable region
- each of the heavy chains comprises a variable region (VH) and the VH comprises a CDRl of SEQ ID NO: 27, a CDR2 of SEQ ID NO: 30, and a CDR3 of SEQ ID NO: 35.
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 39, a CDR2 of SEQ ID NO: 43, and a CDR3 of SEQ ID NO: 46.
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 42, a CDR2 of SEQ ID NO: 44, and a CDR3 of SEQ ID NO: 46.
- VL variable region
- each of the light chains comprises a variable region (VL), which comprises a
- CDR complementarity determining region
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 16, a CDR2 of SEQ ID NO: 20, and a CDR3 of SEQ ID NO: 23.
- VL variable region
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 17, a CDR2 of SEQ ID NO: 21, and a CDR3 of SEQ ID NO: 24.
- VL variable region
- each of the light chains comprises a variable region (VL) and the VL comprises CDRl of SEQ ID NO: 18, a CDR2 of SEQ ID NO: 20, and a CDR3 of SEQ ID NO: 22.
- VL variable region
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 39, a CDR2 of SEQ ID NO: 43, and a CDR3 of SEQ ID NO: 46.
- VL variable region
- each of the light chains comprises a variable region (VL) and the VL comprises a CDRl of SEQ ID NO: 40, a CDR2 of SEQ ID NO: 44, and a CDR3 of SEQ ID NO: 47.
- VL variable region
- each of the light chains comprises a variable region (VL) and the VL comprises a CDR1 of SEQ ID NO: 41, a CDR2 of SEQ ID NO: 45, and a CDR3 of SEQ ID NO: 48.
- VL variable region
- each of the light chains comprises a variable region (VL) and the VL comprises a CDR1 of SEQ ID NO: 42, a CDR2 of SEQ ID NO: 44, and a CDR3 of SEQ ID NO: 46.
- VL variable region
- the heavy chain comprises a variable region (VH), which comprises SEQ ID NO: 49.
- the light chain comprises a variable region (VL), which comprises SEQ ID NO: 50.
- the light chain comprises a variable region (VL), which comprises SEQ ID NO: 50.
- the heavy chain comprises a variable region (VH), which comprises SEQ ID NO: 51.
- the light chain comprises a variable region (VL), which comprises SEQ ID NO: 52.
- the light chain comprises a variable region (VL), which comprises SEQ ID NO: 52.
- the antibody or antigen-binding fragment thereof comprises a human- derived constant region.
- the heavy chain constant region has an isotype selected from the group consisting of gammal, gamma2, gamma3, and gamma4.
- the antibody or antigen-binding fragment thereof is humanized.
- the antibody binds human MERTK with a dissociation constant (K D ) in the range of about 3 picomolar (pM) to 400 pM.
- the antibody binds murine MERTK with a K D in the range of about 3 pM to 400 pM.
- the antibody or antigen-binding fragment inhibits the migration of endothelial cells in vitro in the presence of breast cancer cells, wherein the migration is inhibited by more than 30% as compared to endothelial cells treated with a control antibody.
- the antibody or antigen-binding fragment promotes the phosphorylation of MERTK of human vascular endothelial cells in vitro.
- the antibody or antigen-binding fragment does not promote the phosphorylation of MERTK on cancer cells in vitro.
- the antibody or antigen-binding fragment inhibits tumor angiogenesis in vivo.
- the antibody or antigen-binding fragment does not inhibit the migration of glioblastoma multiforme cell line A172 in an in vitro trans-well migration assay in the absence of endothelial cells.
- the antibody or antigen-binding fragment does not decrease the expression level of MERTK on the glioblastoma multiforme cell line A172.
- an antibody or antigen-binding fragment thereof that specifically binds to human MERTK, comprising a heavy chain variable region (VH), wherein the VH comprises a complementarity determining region (CDR) 1 of SEQ ID NO: 1, a VH CDR2 of SEQ ID NO: 6, and a VH CDR3 of SEQ ID NO: 11.
- VH heavy chain variable region
- CDR complementarity determining region
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a complementarity determining region (CDR) 1 of SEQ ID NO: 15, a CDR2 comprising the amino acid sequence of SEQ ID NO: 19, and a CDR3 comprising the amino acid sequence of SEQ ID NO: 22.
- VL light chain variable region
- CDR complementarity determining region
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises a CDR1 of SEQ ID NO: 2, a CDR2 of SEQ ID NO: 7, and a CDR3 of SEQ ID NO: 12.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a CDR1 of SEQ ID NO: 16, a CDR2 of SEQ ID NO: 20, and a CDR3 of SEQ ID NO: 23.
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises a CDR1 of SEQ ID NO: 3, a CDR2 of SEQ ID NO: 8, and a CDR3 of SEQ ID NO: 11.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a complementarity determining region (CDR) 1 of SEQ ID NO: 15, a CDR2 comprising the amino acid sequence of SEQ ID NO: 19, and a CDR3 comprising the amino acid sequence of SEQ ID NO: 22.
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises a CDR1 of SEQ ID NO: 4, a CDR2 of SEQ ID NO: 9, and a CDR3 of SEQ ID NO: 13.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a CDR1 of SEQ ID NO: 17, a CDR2 of SEQ ID NO: 21, and a CDR3 of SEQ ID NO: 24.
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises a CDR1 of SEQ ID NO: 5, a CDR2 of SEQ ID NO: 10, and a CDR3 of SEQ ID NO: 14.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises CDR1 of SEQ ID NO: 18, a CDR2 of SEQ ID NO: 20, and a CDR3 of SEQ ID NO: 22.
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises CDR1 of SEQ ID NO: 3, a CDR2 of SEQ ID NO: 6, and a CDR3 of SEQ ID NO: 11.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a complementarity determining region (CDR) 1 of SEQ ID NO: 15, a CDR2 comprising the amino acid sequence of SEQ ID NO: 19, and a CDR3 comprising the amino acid sequence of SEQ ID NO: 22.
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises a CDR1 of SEQ ID NO: 25, a CDR2 of SEQ ID NO: 30, and a CDR3 of SEQ ID NO: 35.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a CDR1 of SEQ ID NO: 39, a CDR2 of SEQ ID NO: 43, and a CDR3 of SEQ ID NO: 46.
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises a CDR1 of SEQ ID NO: 26, a CDR2 of SEQ ID NO: 31, and a CDR3 of SEQ ID NO: 36.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a CDR1 of SEQ ID NO: 40, a CDR2 of SEQ ID NO: 44, and a CDR3 of SEQ ID NO: 47.
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises a CDR1 of SEQ ID NO: 27, a CDR2 of SEQ ID NO: 32, and a CDR3 of SEQ ID NO: 35.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a CDR1 of SEQ ID NO: 39, a CDR2 of SEQ ID NO: 43, and a CDR3 of SEQ ID NO: 46.
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises a CDR1 of SEQ ID NO: 28, a CDR2 of SEQ ID NO: 33, and a CDR3 of SEQ ID NO: 37.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a CDR1 of SEQ ID NO: 41, a CDR2 of SEQ ID NO: 45, and a CDR3 of SEQ ID NO: 48.
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises a CDR1 of SEQ ID NO: 29, a CDR2 of SEQ ID NO: 34, and a CDR3 of SEQ ID NO: 38.
- VH heavy chain variable region
- an antibody or antigen-binding fragment thereof of that specifically binds to human MERTK comprising a heavy chain variable region (VH), wherein the VH comprises a CDR1 of SEQ ID NO: 27, a CDR2 of SEQ ID NO: 30, and a CDR3 of SEQ ID NO: 35.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a CDR1 of SEQ ID NO: 39, a CDR2 of SEQ ID NO: 43, and a CDR3 of SEQ ID NO: 46.
- the antibody or antigen-binding fragment thereof of further comprises a light chain variable region (VL), wherein the VL comprises a CDR1 of SEQ ID NO: 42, a CDR2 of SEQ ID NO: 44, and a CDR3 of SEQ ID NO: 46.
- VL light chain variable region
- the antibody is an immunoglobulin
- the antigen-binding fragment is a portion of an immunoglobulin
- the antibody or antigen-binding fragment thereof is an immunoglobulin.
- the antibody or antigen-binding fragment thereof is humanized.
- the antibody or antigen-binding fragment thereof comprises a human-derived constant region. In one further embodiment of such a specific embodiment, the antibody or antigen-binding fragment thereof is a humanized immunoglobulin.
- the antibody is not a monoclonal antibody or an immunoglobulin comprising two identical light chains and two identical heavy chains
- the antibody or antigen-binding fragment thereof is a bispecific antibody.
- an immunoglobulin that specifically binds to human MERTK comprising (i) a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 51, and (ii) a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 52.
- an immunoglobulin that specifically binds to human MERTK, comprising (i) a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 49, and (ii) a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 50.
- an immunoglobulin that specifically binds to human MERTK comprising:
- a first immunoglobulin comprising (i) a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 51, and (ii) a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 52;
- a second immunoglobulin comprising (i) a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 49, and (ii) a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 50.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 1, a VH CDR2 of SEQ ID NO: 6, and a VH CDR3 of SEQ ID NO: 11.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 2, a VH CDR2 of SEQ ID NO: 7, and a VH CDR3 of SEQ ID NO: 12.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 3, a VH CDR2 of SEQ ID NO: 8, and a VH CDR3 of SEQ ID NO: 11.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 4, a VH CDR2 of SEQ ID NO: 9, and a VH CDR3 of SEQ ID NO: 13.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 5, a VH CDR2 of SEQ ID NO: 10, and a VH CDR3 of SEQ ID NO: 14.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 3, a VH CDR2 of SEQ ID NO: 6, and a VH CDR3 of SEQ ID NO: 11.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 25, a VH CDR2 of SEQ ID NO: 30, and a VH CDR3 of SEQ ID NO: 35.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 26, a VH CDR2 of SEQ ID NO: 31, and a VH CDR3 of SEQ ID NO: 36.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 27, a VH CDR2 of SEQ ID NO: 32, and a VH CDR3 of SEQ ID NO: 35.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 28, a VH CDR2 of SEQ ID NO: 33, and a VH CDR3 of SEQ ID NO: 37.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 29, a VH CDR2 of SEQ ID NO: 34, and a VH CDR3 of SEQ ID NO: 38.
- an antibody heavy chain comprising: a VH CDRl of SEQ ID NO: 27, a VH CDR2 of SEQ ID NO: 30, and a VH CDR3 of SEQ ID NO: 35.
- an antibody heavy chain comprising: (A) a VH CDRl of SEQ ID NO: 1, a VH CDR2 of SEQ ID NO: 6, and a VH CDR3 of SEQ ID NO: 11;
- an antibody light chain comprising: a light chain variable region (VL) CDRl of SEQ ID NO: 15, a VL CDR2 of SEQ ID NO: 19, and a VL CDR3 of SEQ ID NO: 22.
- VL light chain variable region
- an antibody light chain comprising: a VL CDRl of SEQ ID NO: 16, a VL CDR2 of SEQ ID NO: 20, and a VL CDR3 of SEQ ID NO: 23.
- an antibody light chain comprising: a VL CDRl of SEQ ID NO: 17, a VL CDR2 of SEQ ID NO: 21, and a VL CDR3 of SEQ ID NO: 24.
- an antibody light chain comprising: a VL CDRl of SEQ ID NO: 18, a VL CDR2 of SEQ ID NO: 20, and a VL CDR3 of SEQ ID NO: 22.
- an antibody light chain comprising: a VL CDRl of SEQ ID NO: 39, a VL CDR2 of SEQ ID NO: 43, and a VL CDR3 of SEQ ID NO: 46.
- an antibody light chain comprising: a VL CDRl of SEQ ID NO: 40, a VL CDR2 of SEQ ID NO: 44, and a VL CDR3 of SEQ ID NO: 47.
- an antibody light chain comprising: a VL CDRl of SEQ ID NO: 41, a VL CDR2 of SEQ ID NO: 45, and a VL CDR3 of SEQ ID NO: 48.
- an antibody light chain comprising: a VL CDRl of SEQ ID NO: 42, a VL CDR2 of SEQ ID NO: 44, and a VL CDR3 of SEQ ID NO: 46.
- an antibody light chain comprising:
- VL light chain variable region
- nucleic acid comprising a polynucleotide encoding the antibody heavy chain described in any of the preceding aspects.
- nucleic acid comprising a polynucleotide encoding the antibody light chain described in any of the preceding aspects.
- an ex vivo cell containing one or more polynucleotides encoding the antibody or antigen-binding fragment described in any of the preceding aspects/embodiments, or the immunoglobulin described in any of the preceding aspects or an antibody which competes for binding to MERTK with a reference antibody selected from the group consisting of:
- a first immunoglobulin comprising (i) a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 51, and (ii) a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 52;
- a second immunoglobulin comprising (i) a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 49, and (ii) a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 50.
- an ex vivo cell containing a polynucleotide encoding the antibody heavy chain described in any of the preceding aspects.
- a method of producing an antibody or antigen -binding fragment comprising culturing an ex vivo cell containing one or more polynucleotides encoding the antibody or antigen-binding fragment described in any of the preceding aspects/embodiments, or the immunoglobulin described in any of the preceding aspects or an antibody which competes for binding to MERTK with a reference antibody selected from the group consisting of: (a) a first immunoglobulin comprising (i) a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 51, and (ii) a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 52; and
- a second immunoglobulin comprising (i) a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 49, and (ii) a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 50,
- the one or more polynucleotides are expressed by the cell to produce the antibody, antigen-binding fragment, or immunoglobulin encoded by the polynucleotides.
- a method of producing an antibody heavy chain comprising culturing an ex vivo cell containing a polynucleotide encoding the antibody heavy chain described in any of the preceding aspects under conditions such that the polynucleotide is expressed by the cell to produce the antibody, antigen-binding fragment, or immunoglobulin encoded by the polynucleotide.
- a method of producing an antibody light chain comprising culturing an ex vivo cell containing a polynucleotide encoding the antibody light chain described in any of the preceding aspects under conditions such that the polynucleotide is expressed by the cell to produce the antibody, antigen-binding fragment, or immunoglobulin encoded by the polynucleotide.
- composition comprising a therapeutically effective amount of the antibody or antigen-binding fragment described in any of the preceding aspects/embodiments, or the immunoglobulin described in any of the preceding aspects or an antibody which competes for binding to MERTK with a reference antibody selected from the group consisting of:
- a first immunoglobulin comprising (i) a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 51, and (ii) a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 52;
- a second immunoglobulin comprising (i) a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 49, and (ii) a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 50;
- a method of treating cancer in a subject in need thereof comprising administering to said subject the pharmaceutical composition described in the preceding aspect.
- the cancer is a cancer of the lung, breast, bone, ovary, stomach, pancreas, larynx, esophagus, testes, liver, parotid, biliary tract, colon, rectum, cervix, uterus, endometrium, kidney, bladder, prostate or thyroid.
- the cancer is breast cancer.
- the cancer is triple-negative breast cancer.
- the cancer is a sarcoma, squamous cell carcinoma, melanoma, glioma,
- glioblastoma glioblastoma, neuroblastoma or Kaposi's sarcomas.
- the method further comprises administering to the subject an additional therapeutic agent.
- the method further comprises administering to the subject an additional therapeutic agent, the additional therapeutic agent is for treating the cancer.
- the additional therapeutic agent is an agent used to treat breast cancer, an agent used to treat melanoma, an immunotherapy, or an angiogenesis inhibitor.
- the additional therapeutic agent is an agent used to treat breast cancer that is selected from the group consisting of Tamoxifen, Raloxifene, Paclitaxel, Cyclophosphamide, Docetaxel,
- Vinblastine Fluorouracil, Everolimus, Trastuzumab, Trastuzumab-Emtansine,
- the additional therapeutic agent is an agent used to treat melanoma that is selected from the group consisting of a BRAF inhibitor, a MEK inhibitor, and
- the additional therapeutic agent is an antibody that is a CTLA-4 inhibitor, a PD-1 inhibitor, or a PD-L1 inhibitor.
- the additional therapeutic agent is an angiogenesis inhibitor that is selected from the group consisting of a VEGF inhibitor, a VEGFR2 inhibitor, Sunitinib, and Sorafenib.
- the subject is a human. 5.
- Figures 1A and IB MERTK sequences.
- A) A schematic of the recombinant MERTK peptide used to immunize mice for the production of antibodies. The peptide consists of the extracellular domain of MERTK (See Figure IB), a short linker, and a portion of human IgGi.
- FIG. 2 MERTK monoclonal antibody screen. A diagram showing data from antibody capture ELISA assays used to characterize binding properties of MERTK- binding monoclonal antibodies recovered from single hybridoma clones. Antibody clones are arbitrarily designated Ml through M20 in the first column. Several of the MERTK binding monoclonal antibodies demonstrated high affinity binding to MERTK, as indicated by large (>3.5) O.D. values in the second column. Some of these antibodies also neutralized binding of MERTK to Gas-6, as indicated by a low ( ⁇ 2.5) blocking O.D. value in the third column.
- FIG. 3 MERTK binding antibodies Ml 9 and M6 inhibit endothelial recruitment.
- 2.5 x 10 4 MDA-MB-231 cells were seeded in quadruplicate.
- Monoclonal antibodies that significantly inhibit endothelial cell recruitment (M6 and Ml 9) are labeled in red and green respectively. Error bars represent standard error of the mean.
- FIG. 4A-C MERTK-binding antibody M19 activates MERTK on endothelial cells.
- A) HUVEC cells were treated with either no FBS + no Ml 9, 10% FBS + no Ml 9, 10% FBS + 25 ⁇ / ⁇ of M19, or no FBS + 25 ⁇ / ⁇ of M19 for 16 hours prior to western blot analysis of activated (phosphorylated) MERTK (P-MERTK) and total levels of MERTK and AKT. As shown, treatment with Ml 9 antibody increased levels of activated MERTK.
- FIGS 5 A and B MERTK binding antibody M6 activates MERTK on endothelial cells.
- HUVEC cells were treated with either no FBS + no M6, 10% FBS + no M6, 10% FBS + 25 ⁇ g/mL of M6, or no FBS + 25 ⁇ g/mL of M6 for 16 hours prior to western blot analysis of activated (phosphorylated) MERTK (P-MERTK) and total levels of MERTK. As shown, treatment with M6 antibody increased levels of activated MERTK.
- P-MERTK activated (phosphorylated) MERTK
- B Quantification of MERTK activation with M6 antibody treatment, calculated as a ratio of the protein expression levels of P-MERTK to MERTK, isolated from M6 treated and untreated HUVEC cells from the western blot data from Figure 5A.
- FIG. 6 MERTK binding antibody M19 does not activate MERTK on cancer cells.
- LM2 breast cancer cells were treated with either no FBS + no M19 antibody, 10% FBS + no M19 antibody, 10%FBS + 25 ⁇ g/mL M19 antibody or no FBS + 25 ⁇ g/mL M19 antibody for 16 hours prior to western blot analysis of activated MERTK (P-MERTK) and total levels of MERTK. As shown, no detectable levels of P-MERTK were induced in cancer cells treated with Ml 9 antibody.
- FIG. 7 M19 binds to human MERTK with high affinity.
- Purified Ml 9 was loaded on an AMQ sensor at a concentration of 1 microgram/mL to test binding against analytes in solution. All analytes were prepared at 5nM with a 2-fold dilution series for a total of 7 concentrations.
- Kinetic fits were calculated using a 1 : 1 model, with Local fits for each concentration as well as an overall global fit.
- the overall global fit calculated binding affinity (K D ) for Ml 9 binding to human MERTK was 326 picomolar.
- FIG. 8 Ml 9 binds to murine MERTKwith high affinity.
- Purified Ml 9 was loaded on an AMQ sensor at a concentration of 1 microgram/mL to test binding against analytes in solution. All analytes were prepared at 5nM with a 2-fold dilution series for a total of 7 concentrations.
- Kinetic fits were calculated using a 1 : 1 model, with Local fits for each concentration as well as an overall Global fit.
- the overall calculated global fit binding affinity (K D ) for Ml 9 binding to mouse MERTK was 305 picomolar.
- Figures 9A and B Treatment with Ml 9 inhibits primary tumor growth and metastasis of triple-negative breast cancer in vivo.
- B) Lmlal breast cancer cells were injected bilaterally in the mammary fat pad in mice treated biweekly with 250 ⁇ g of either control antibody (IgG) or Ml 9 antibody. After 98 days the lungs were removed, processed for H&E staining, and the number of metastatic nodules were counted. N 4. Error bars represent standard error of the mean. P-values were obtained using student's T- test (*p ⁇ 0.05)
- FIG. 10 Treatment with M 19 inhibits angiogenesis in vivo.
- FIG. 11 M6 binds to MERTK with high affinity. M6 binds to human MERTK with high affinity.
- Kinetic fits were calculated using a 1 : 1 model, with Local fits for each concentration as well as an overall Global fit. Overall calculated binding affinities (K D ) for M6 binding to human MERTK was 4.6 picomolar.
- anti -MERTK antibodies e.g., monoclonal antibodies
- antigen -binding fragments thereof that specifically bind to MERTK (e.g., human
- an anti-MERTK antibody or antigen-binding fragment thereof described herein specifically recognizes the extracellular domain of MERTK (e.g., human MERTK, or both human and mouse MERTK).
- an anti-MERTK antibody or antigen-binding fragment thereof described herein does not bind a 185 kilodalton (kD) MERTK glycoform expressed in Jurkat cells, a 205 kD MERTK glycoform in the monocytic cell line U937, 135-140 kD MERTK glycoforms expressed in human leukemia cells (e.g.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein does not decrease the expression level of MERTK on cancer cells.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein does not decrease the expression level of MERTK on the glioblastoma multiforme cell line A172.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein is isolated.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein specifically binds to human MERTK protein comprising the amino acid sequence of SEQ ID NO: 57.
- an anti- MERTK antibody or antigen-binding fragment thereof described herein specifically binds to the extracellular region of human MERTK, comprising the amino acid sequence of SEQ ID NO: 58.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein specifically binds to SEQ ID NO: 58.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein comprises two antigen-binding sites that bind to MERTK; in a particular embodiment, the two antigen-binding sites bind to the same epitope on MERTK; in a particular embodiment, the two-antigen binding sites comprise identical CDRs.
- Antibodies can include, for example, monoclonal antibodies, polyclonal antibodies, recombinantly produced antibodies, monospecific antibodies, multispecific antibodies (including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, immunoglobulins, synthetic antibodies, tetrameric antibodies comprising two heavy chain and two light chain molecules, an antibody light chain monomer, an antibody heavy chain monomer, an antibody light chain dimer, an antibody heavy chain dimer, an antibody light chain- antibody heavy chain pair, intrabodies, heteroconjugate antibodies, single domain antibodies, monovalent antibodies, single chain antibodies or single-chain Fvs (scFv), camelized antibodies, affybodies, disulfide-linked Fvs (sdFv), and anti -idiotypic (anti-Id) antibodies (including, e.g., anti-anti-Id antibodies).
- scFv single-chain Fvs
- sdFv camelized antibodies
- affybodies disulfide-linked Fvs
- antibodies described herein refer to polyclonal antibody populations. In certain embodiments, antibodies described herein refer to monoclonal antibody populations. Antibodies can be of any type (e.g., IgG, IgE, IgM, IgD, IgA or
- antibodies described herein are IgG antibodies, or a class or subclass thereof.
- the antibody is a humanized monoclonal antibody.
- the antibody is a human monoclonal antibody, preferably that is an immunoglobulin.
- antigen-binding fragment refers to a portion of an antibody molecule which comprises the amino acid residues that confer on the antibody molecule its specificity for the antigen (e.g., the complementarity determining regions (CDR)).
- the antigen-binding region can be derived from any animal species, such as rodents (e.g., mouse, rat or hamster) and humans.
- antigen-binding fragments include Fab fragments, F(ab') 2 fragments, and antigen binding fragments of any of the antibodies described above.
- variable region typically refers to a portion of an antibody, generally, a portion of a light or heavy chain, which differs extensively in sequence among antibodies and is used in the binding and specificity of a particular antibody for its particular antigen.
- the variability in sequence is concentrated in those regions called complementarity determining regions (CDRs) while the more highly conserved regions in the variable domain are called framework regions (FR).
- CDRs complementarity determining regions
- FR framework regions
- variable region comprises rodent or murine CDRs and human framework regions (FRs).
- variable region is a primate (e.g., non-human primate) variable region.
- variable region comprises rodent or murine CDRs and primate (e.g., non-human primate) framework regions (FRs).
- CDRs are defined in various ways in the art, including the Kabat, Chothia, AbM, contact, FMGT, and Exemplary definitions.
- the Kabat definition is based on sequence variability and is the most commonly used definition to predict CDR regions (Kabat, Elvin A. et al., Sequences of Proteins of Immunological Interest. Bethesda:
- the Chothia definition is based on the location of the structural loop regions (Chothia et al, (1987) J Mol Biol 196: 901-917).
- the AbM definition a compromise between the Kabat and Chothia definitions, is an integral suite of programs for antibody structure modeling produced by the Oxford Molecular Group (bioinf.org.uk/abs) (Martin ACR et al, (1989) PNAS 86: 9268-9272).
- the contact definition is based on an analysis of the available complex crystal structures
- FMGT the international ImMunoGeneTics information system® website imgt.org, founder and director: Marie-Paule Lefranc, adjoin, France.
- the Exemplary definition is a combination of AbM and Kabat (Presta et al, (1997) Cancer Res 57: 4593-4599).
- isolated nucleic acids such as
- compositions e.g., pharmaceutical compositions
- kits are also provided.
- an anti-MERTK antibody or antigen-binding fragment thereof provided herein comprises the VH CDR1 of the antibody in Table 1 or 3 as defined by Kabat, Chothia, AbM, Contact, EVIGT, or Exemplary. In some
- an anti-MERTK antibody or antigen-binding fragment thereof provided herein comprises the VH CDR2 of the antibody in Tables 1 or 3 as defined by Kabat, Chothia, AbM, Contact, EVIGT, or Exemplary.
- an anti-MERTK antibody or antigen-binding fragment thereof provided herein comprises the VH CDR3 of the antibody in Tables 1 or 3 as defined by Kabat, Chothia, AbM, Contact, EVIGT, or Exemplary.
- an anti-MERTK antibody or antigen-binding fragment thereof provided herein comprises one, two or all three of VH CDRs of an antibody in Table 1 or 3 (e.g., the VH CDRs in one row of Table 1, for example, all of the Kabat VH CDRs for antibody M6).
- an anti-MERTK antibody or antigen-binding fragment thereof provided herein comprises the VL CDR1 of the antibody in Table 2 or 4 as defined by Kabat, Chothia, AbM, Contact, EVIGT, or Exemplary. In some
- an anti-MERTK antibody or antigen-binding fragment thereof provided herein comprises the VL CDR2 of the antibody in Tables 2 or 4 as defined by Kabat, Chothia, AbM, Contact, EVIGT, or Exemplary.
- an anti-MERTK antibody or antigen-binding fragment thereof provided herein comprises the VL CDR3 of the antibody in Tables 2 or 4 as defined by Kabat, Chothia, AbM, Contact, EVIGT, or Exemplary.
- an anti-MERTK antibody or antigen-binding fragment thereof provided herein comprises one, two or all three of VL CDRs of an antibody in Table 2 or 4 (e.g., the VH CDRs in one row of Table 1, for example, all of the Kabat VH CDRs for antibody M6).
- Table 1 Antibody M6 VH CDR Amino Acid Sequences
- VQNS SRV EQPEKSP VLTVPGLTEMA VF S CEAHNDKGLT VSKG VQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKE ADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWS AVSPWILASTTEGAPSVAPLNVTVFL ESSDNVDIRWMKPPTKQQ DGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCT VRIAAVTRGGVGPF SDP VKIFIP AHGW VD YAP S STP APGNADP VLI IFGCFCGFILIGLILYISLAIRKRVQETKFGNAFTEEDSELVVNYIAK KSFCRRAIELTLHSLGVSEELQ KLEDVVIDRNLLILGKILGEGEFG S VMEG
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising: (a) a VH CDR1 of GYTFTNY (SEQ ID NO: 2); and/or
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a light chain variable region (VL) comprising:
- VL CDR2 comprising, of WAS (SEQ ID NO: 20);
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising: (a) a VH CDR1 of DYSMH (SEQ ID NO: 25); and/or
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region (VH) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a light chain variable region (VL) comprising:
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a light chain variable region (VL) comprising: (a) a VL CDRl of QDVTNV (SEQ ID NO: 42); and/or
- the antibody or antigen-binding fragment thereof comprises one, two, or all three of the VH CDRs above.
- the antibody or antigen-binding fragment thereof comprises a VH CDRl in Table 1 or Table 3.
- the antibody or antigen-binding fragment thereof comprises a VH CDR2 in Table 1 or Table 3.
- the antibody or antigen-binding fragment thereof comprises a VH CDR3 in Table 1 or Table 3.
- the antibody or antigen-binding fragment thereof comprises a VH CDRl, a VH CDR2, and a VH CDR3 of the antibody M6 (Table 1).
- the antibody or antigen-binding fragment thereof comprises a VH CDRl, a VH CDR2, and a VH CDR3 of the antibody M19 (Table 3).
- the antibody or antigen-binding fragment thereof comprises one, two, or all three of the VL CDRs above.
- the antibody or antigen-binding fragment thereof comprises a VL CDRl in Table 2 or Table 4.
- the antibody or antigen-binding fragment thereof comprises a VL CDR2 in Table 2 or Table 4.
- the antibody or antigen-binding fragment thereof comprises a VL CDR3 in Table 2 or Table 4.
- the antibody or antigen-binding fragment thereof comprises a VL CDRl, a VL CDR2, and a VL CDR3 of the antibody M6 (Table 2).
- the antibody or antigen- binding fragment thereof comprises a VL CDRl, a VL CDR2, and a VL CDR3 of the antibody Ml 9 (Table 4).
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- VL CDR2 comprising, of WAS (SEQ ID NO: 20);
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises: (a) a VH CDR1 of NYTFTDY (SEQ ID NO: 26); and/or
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises:
- the antibody or antigen-binding fragment thereof comprises one, two, three, four, five or all six of the CDRs above.
- the antibody or antigen-binding fragment thereof comprises a VH CDR1 in Table 1 or Table 3.
- the antibody or antigen-binding fragment thereof comprises a VH CDR2 in Table 1 or Table 3.
- the antibody or antigen-binding fragment thereof comprises a VH CDR3 in Table 1 or Table 3.
- the antibody or antigen-binding fragment thereof comprises a VL CDR1 in Table 2 or Table 4.
- the antibody or antigen-binding fragment thereof comprises a VL CDR2 in Table 2 or Table 4.
- the antibody or antigen-binding fragment thereof comprises a VL CDR3 in Table 2 or Table 4. In some embodiments, the antibody or antigen-binding fragment thereof comprises a VH CDR1, a VH CDR2, and a VH CDR3 of the antibody M6 (Table 1). In certain embodiments, the antibody or antigen-binding fragment thereof comprises a VH CDR1, a VH CDR2, and a VH CDR3 of the antibody Ml 9 (Table 3). In certain embodiments, the antibody or antigen-binding fragment thereof comprises a VL CDR1, a VL CDR2, and a VL CDR3 of the antibody M6 (Table 2).
- the antibody or antigen-binding fragment thereof comprises a VL CDR1, a VL CDR2, and a VL CDR3 of the antibody Ml 9 (Table 4). In certain embodiments, the antibody or antigen-binding fragment thereof comprises a VL CDRl, a VL CDR2, a VL CDR3, a VH CDRl, a VH CDR2, and a VH CDR3 of the antibody M6 (Tables 1 and 2).
- the antibody or antigen-binding fragment thereof comprises a VL CDRl, a VL CDR2, a VL CDR3, a VH CDRl, a VH CDR2, and a VH CDR3 of the antibody M19 (Tables 3 and 4).
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- VL CDR2 comprising, of WAS (SEQ ID NO: 20);
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- an anti-MERTK antibody or antigen-binding fragment thereof which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein
- the VH comprises:
- the VL comprises:
- the VH comprises two or all three of the VH CDRs above and/or the VL comprises two or all three of the VL CDRs above.
- the VH comprises a VH CDRl of one of the antibodies in Table 1 or Table 3.
- the VH comprises a VH CDR2 of one of the antibodies in Table 1 or Table 3.
- the VH comprises a VH CDR3 of one of the antibodies in Table 1 or Table 3.
- the VL comprises a VL CDRl of one of the antibodies in Table 2 or Table 4.
- the VL comprises a VL CDR2 of one of the antibodies in Table 2 or Table 4.
- the VL comprises a VL CDR3 of one of the antibodies in Table 2 or Table 4.
- the VH comprises a VH CDRl, a VH CDR2, and a VH CDR3 of the antibody M6 (Table 1). In certain embodiments, the VH comprises a VH CDRl, a VH CDR2, and a VH CDR3 of the antibody Ml 9 (Table 3). In certain embodiments, the VL comprises a VL CDRl, a VL CDR2, and a VL CDR3 of the antibody M6 (Table 2). In certain embodiments, the VL comprises a VL CDRl, a VL CDR2, and a VL CDR3 of the VL CDRs of the antibody M19 (Table 4).
- an anti-MERTK antibody or antigen-binding fragment thereof comprises a VH and a VL, wherein the VH comprises a VH CDRl, a VH CDR2, and a VH CDR3 of the antibody M19 (Table 3) and VL comprise a VL CDRl, a VL CDR2, and a VL CDR3 of the VL CDRs of the antibody Ml 9 (Table 4).
- an anti-MERTK antibody or antigen-binding fragment thereof comprises a VH and a VL, wherein the VH comprises a VH CDRl, a VH CDR2, and a VH CDR3 of the antibody M6 (Table 1) and VL comprise a VL CDRl, a VL CDR2, and a VL CDR3 of the VL CDRs of the antibody M6 (Table 2).
- an anti-MERTK antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region sequence comprising the amino acid sequence of SEQ ID NO: 49 (Table 5) (e.g., the VH of antibody M6).
- an antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a heavy chain variable region sequence comprising the amino acid sequence of SEQ ID NO: 51 (Table 6) (e.g., the VH of antibody Ml 9).
- an antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a light chain variable region sequence comprising the amino acid sequence of SEQ ID NO: 50 (Table 5) (e.g., the VL of antibody M6).
- an antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises a light chain variable region sequence comprising the amino acid sequence of SEQ ID NO: 52 (Table 6) (e.g., the VL of antibody M19).
- an antibody described herein, or an antigen- binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 50 (e.g., the VH and VL of antibody M6).
- an antibody described herein, or an antigen-binding fragment thereof, which specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprises (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 50; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 52 (e.g., the VH and VL of antibody Ml 9).
- an antibody described herein may be described by its VH domain alone, or its VL domain alone, or by its three VH CDRs alone, or its three VL CDRs alone. See, for example, Rader C et al, (1998) PNAS 95: 8910-8915, which is incorporated herein by reference in its entirety, describing the humanization of the mouse anti-avP3 antibody by identifying a complementing light chain or heavy chain, respectively, from a human light chain or heavy chain library, resulting in humanized antibody variants having affinities as high or higher than the affinity of the original antibody.
- the position of one or more CDRs along the VH (e.g., CDR1, CDR2, or CDR3) and/or VL (e.g., CDR1, CDR2, or CDR3) region of an antibody described herein may vary by one, two, three, four, five, or six amino acid positions so long as immunospecific binding to MERTK (e.g., human MERTK, or both human and mouse MERTK) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- MERTK e.g., human MERTK, or both human and mouse MERTK
- the length of one or more CDRs along the VH (e.g., CDRl, CDR2, or CDR3) and/or VL (e.g., CDRl, CDR2, or CDR3) region of an antibody described herein may vary (e.g., be shorter or longer) by one, two, three, four, five, six or more amino acids, so long as immunospecific binding to MERTK (e.g., human MERTK, or both human and mouse MERTK) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- MERTK e.g., human MERTK, or both human and mouse MERTK
- the amino terminus and/or the carboxy terminus of a VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 described herein may be extended or shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein so long as immunospecific binding to MERTK (e.g., human MERTK, or both human and mouse MERTK) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- MERTK e.g., human MERTK, or both human and mouse MERTK
- immunospecifically recognizes are analogous terms in the context of antibodies and refer to antibodies and antigen-binding fragments thereof that bind to an antigen (e.g., epitope or immune complex) via the antigen-binding sites as understood by one skilled in the art, and does not exclude cross- reactivity of the antibody or antigen-binding fragment with other antigens.
- Any method known in the art can be used to ascertain whether immunospecific binding to MERTK (e.g., human MERTK, or both human and mouse MERTK) is maintained, for example, the binding assays and conditions described in Example 4 and Example 7 (Section 6) provided herein, infra.
- an anti-MERTK antibody or antigen- binding fragment thereof comprising an antibody heavy chain and/or light chain, e.g., a heavy chain alone, a light chain alone, or both a heavy chain and a light chain.
- the light chain of an anti-MERTK antibody or an antigen-binding fragment thereof described herein is a kappa light chain.
- the light chain of an anti-MERTK antibody or an antigen- binding fragment thereof described herein is a lambda light chain.
- the light chain of an anti-MERTK antibody or an antigen-binding fragment thereof described herein is a human kappa light chain or a human lambda light chain.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein, which immunospecifically binds to MERTK comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprises a VL CDR1, VL CDR2, and VL CDR3 having the amino acid sequences of antibody M6 or antibody Ml 9 VL CDRs (i.e., those listed in Table 2 and Table 4), and wherein the constant region of the light chain comprises the amino acid sequence of a kappa light chain constant region.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein, which immunospecifically binds to MERTK comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprises the amino acid sequence of SEQ ID NO: 50 or SEQ ID NO: 52, and wherein the constant region of the light chain comprises the amino acid sequence of a kappa light chain constant region.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- the amino acid sequence of the variable region of the light chain comprises the amino acid sequence of SEQ ID NO: 50 or SEQ ID NO: 52
- the constant region of the light chain comprises the amino acid sequence of a kappa light chain constant region.
- the term “constant region” or “constant domain” are interchangeable and have its meaning common in the art.
- the constant region is an antibody portion, e.g., a carboxyl terminal portion of a light and/or heavy chain which is not directly involved in binding of an antibody to antigen but which can exhibit various effector functions, such as interaction with the Fc receptor.
- the constant region of an immunoglobulin molecule generally has a more conserved amino acid sequence relative to an immunoglobulin variable domain.
- the antibody or antigen-binding fragment thereof agonizes MERTK signaling.
- an anti-MERTK antibody or an antigen- binding fragment thereof described herein, which immunospecifically binds to MERTK comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprises a VL CDR1, VL CDR2, and VL CDR3 having the amino acid sequences of antibody M6 or antibody Ml 9 VL CDRs (i.e., those listed in Table 2 and Table 4), and wherein the constant region of the light chain comprises the amino acid sequence of a lambda light chain constant region.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein, which immunospecifically binds to MERTK comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprise the amino acid sequence of SEQ ID NO: 50 or SEQ ID NO: 52, and wherein the constant region of the light chain comprises the amino acid sequence of a lambda light chain constant region.
- the antibody or antigen-binding fragment thereof agonizes MERTK signaling.
- an anti-MERTK antibody or an antigen- binding fragment thereof described herein, which immunospecifically binds to MERTK comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprises a VL CDRl, VL CDR2, and VL CDR3 having the amino acid sequences of antibody M6 or antibody Ml 9 VL CDRs (i.e., those listed in Table 2 and Table 4), and wherein the constant region of the light chain comprises the amino acid sequence of a human kappa or lambda light chain constant region.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein, which immunospecifically binds to MERTK comprises a light chain wherein the amino acid of the variable region of the light chain comprises the amino acid sequence of SEQ ID NO: 50 or SEQ ID NO: 52, and wherein the constant region of the light chain comprises the amino acid sequence of a human kappa or lambda light chain constant region.
- the antibody or antigen-binding fragment thereof agonizes MERTK signaling.
- human constant region sequences have been described in the art, e.g., see Kabat EA et al, (1991).
- the heavy chain of an anti-MERTK antibody or an antigen-binding fragment thereof described herein can be an alpha (a), delta ( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ) or mu ( ⁇ ) heavy chain.
- the heavy chain of an antibody described can comprise a human alpha (a), delta ( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ) or mu ( ⁇ ) heavy chain.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein, which immunospecifically binds to MERTK comprises a heavy chain wherein the amino acid sequence of the variable region of the heavy chain comprises a VH CDRl, VH CDR2, and VH CDR3 having the amino acid sequences of antibody M6 or antibody Ml 9 VH CDRs (i.e., those listed in Table 1 and Table 3), and wherein the constant region of the heavy chain comprises the amino acid sequence of a human gamma ( ⁇ ) heavy chain constant region.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein, which immunospecifically binds to 5 MERTK comprises a heavy chain wherein the amino acid sequence of the variable region of the heavy chain comprises the amino acid sequence of SEQ ID NO: 49 or SEQ ID NO: 51, and wherein the constant region of the heavy chain comprises the amino acid sequence of a human gamma ( ⁇ ) heavy chain constant region.
- the antibody or antigeni c) binding fragment thereof agonizes MERTK signaling.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein, which immunospecifically binds to MERTK comprises a heavy chain wherein the amino acid sequence of the variable region of the heavy chain comprises a VH CDRl, 15 VH CDR2, and VH CDR3 having the amino acid sequences of antibody M6 or antibody Ml 9 VH CDRs (i.e., those listed in Table 1 and Table 3), and wherein the constant region of the heavy chain comprises the amino acid of a human heavy chain described herein or known in the art.
- an anti-MERTK antibody or an antigen- binding fragment thereof described herein, which specifically binds to MERTK comprises a heavy chain wherein the amino acid sequence of the variable region of the heavy chain comprises the amino acid sequence of SEQ ID NO: 49 or SEQ ID NO: 51, and wherein the constant region of the heavy chain comprises the amino acid of a human heavy chain described herein or known in the art.
- the antibody or antigen-binding fragment 5 thereof agonizes MERTK signaling.
- human constant region sequences have been described in the art, e.g., see Kabat EA et al, (1991) supra.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein, which immunospecifically binds to MERTK comprises a heavy chain variable 30 region (VH) and a light chain variable region (VL) comprising any amino acid sequences described herein, and wherein the constant regions comprise the amino acid sequences of the constant regions of an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, or a human IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein, which immunospecifically binds to MERTK comprises a VH and a VL comprising any amino acid sequences described herein, and wherein the constant regions comprise the amino acid sequences of the constant regions of an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class (e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi and IgA 2 ), or any subclass (e.g., IgG 2a and IgG 2 ) of immunoglobulin molecule.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- the constant regions comprise the amino acid sequences of the constant regions of a human IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class (e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi and IgA 2 ), or any subclass (e.g., IgG 2a and IgG 3 ⁇ 4 ) of immunoglobulin molecule.
- any class e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi and IgA 2
- subclass e.g., IgG 2a and IgG 3 ⁇ 4
- one, two or more mutations are introduced into the Fc region of an anti-MERTK antibody or an antigen- binding fragment thereof described herein to alter one or more functional properties of the antibody.
- one, two or more mutations are introduced into the Fc region of an anti-MERTK antibody or an antigen- binding fragment thereof described herein (e.g., CH2 domain (residues 231-340 of human IgGi) and/or CH3 domain (residues 341-447 of human IgGi) and/or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to increase or decrease the affinity of the antibody or an antigen-binding fragment thereof for an Fc receptor (e.g., an activated Fc receptor) on the surface of an effector cell.
- an Fc receptor e.g., an activated Fc receptor
- Mutations in the Fc region of an anti-MERTK antibody or antigen-binding fragment thereof that decrease or increase the affinity of an antibody for an Fc receptor and techniques for introducing such mutations into the Fc receptor or fragment thereof are known to one of skill in the art. Examples of mutations in the Fc receptor of an anti-MERTK antibody or antigen-binding fragment thereof that can be made to alter the affinity of the antibody or an antigen-binding fragment thereof for an Fc receptor are described in, e.g., Smith P et al, (2012) PNAS 109: 6181-6186, U.S. Patent No. 6,737,056, and International
- the antibody or antigen-binding fragment thereof comprises a glycosylated constant region. In some embodiments, the antibody or antigen- binding fragment thereof comprises a non-glycosylated constant region.
- Antibodies with reduced fucose content have been reported to have an increased affinity for Fc receptors, such as, e.g., FcyRIIIa. Accordingly, in certain embodiments, the antibodies or antigen- binding fragments thereof described herein have reduced fucose content or no fucose content.
- antibodies or antigen-binding fragments thereof can be produced using techniques known to one skilled in the art.
- the antibodies or antigen-binding fragments thereof can be expressed in cells deficient or lacking the ability of fucosylation.
- cell lines with a knockout of both alleles of al,6-fucosyltransferase can be used to produce antibodies with reduced fucose content.
- the Potelligent ® system (Lonza) is an example of such a system that can be used to produce antibodies or antigen- binding fragments thereof with reduced fucose content.
- antibodies or antigen-binding fragments with reduced fucose content or no fucose content can be produced by, e.g. : (i) culturing cells under conditions which prevent or reduce
- fucosylation (ii) posttranslational removal of fucose (e.g., with a fucosidase enzyme); (iii) post-translational addition of the desired carbohydrate, e.g., after recombinant expression of a non-glycosylated glycoprotein; or (iv) purification of the glycoprotein so as to select for antibodies or antigen-binding fragments thereof which are not fucsoylated.
- fucose e.g., with a fucosidase enzyme
- post-translational addition of the desired carbohydrate e.g., after recombinant expression of a non-glycosylated glycoprotein
- purification of the glycoprotein so as to select for antibodies or antigen-binding fragments thereof which are not fucsoylated.
- an anti-MERTK antibody or an antigen- binding fragment thereof described herein which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain and/or a light chain, wherein (i) the heavy chain comprises (a) a variable region comprising a VH CDR1, VH CDR2, and VH CDR3 having the amino acid sequences of antibody M6 or antibody Ml 9 VH CDRs (i.e., those listed in Table 1 and Table 3) and (b) comprises a constant heavy chain domain comprising the amino acid sequence of the constant domain of a human IgG heavy chain; and/or (ii) the light chain comprises (a) a variable region comprising a VL CDR1, VL CDR2, and VL CDR3 having the amino acid sequences of antibody M6 or antibody Ml 9 VL CDRs (i.e.
- an anti-MERTK antibody or an antigen- binding fragment thereof described herein which immunospecifically binds to MERTK (e-g-, human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a heavy chain and/or a light chain, wherein (i) the heavy chain comprises (a) a variable region comprising the amino acid sequence of SEQ ID NO: 49 or SEQ ID NO: 51 and (b) a constant heavy chain domain comprising the amino acid sequence of the constant domain of a human IgG; and/or (ii) the light chain comprises a variable region comprising the amino acid sequence of SEQ ID NO: 50 or SEQ ID NO: 52 (b) a constant light chain domain comprising the amino acid sequence of the constant domain of a human kappa light chain.
- the heavy chain comprises (a) a variable region comprising the amino acid sequence of SEQ ID NO: 49 or SEQ ID NO: 51 and (b) a constant heavy chain domain comprising the
- the determination of percent identity between two sequences can also be accomplished using a mathematical algorithm.
- a specific, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin S & Altschul SF (1990) PNAS 87: 2264-2268, modified as in Karlin S & Altschul SF (1993) PNAS 90: 5873-5877.
- Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul SF et al, (1990) J Mol Biol 215: 403.
- Gapped BLAST can be utilized as described in Altschul SF et al, (1997) Nuc Acids Res 25: 3389 3402.
- PSI BLAST can be used to perform an iterated search which detects distant relationships between molecules (Id.).
- BLAST Gapped BLAST
- PSI Blast programs the default parameters of the respective programs (e.g., of XBLAST and NBLAST) can be used (see, e.g., National Center for Biotechnology Information (NCBI) on the worldwide web, ncbi.nlm.nih.gov).
- NCBI National Center for Biotechnology Information
- Another specific, non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, 1988, CABIOS 4: 11 17. Such an algorithm is incorporated in the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package.
- ALIGN program version 2.0
- the percent identity between two sequences can be determined using techniques similar to those described above, with or without allowing gaps. In calculating percent identity, typically only exact matches are counted.
- an anti-MERTK antibody or antigen-binding fragment thereof which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a VH having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%) sequence identity to the amino acid sequence of the VH of SEQ ID NO: 49 or SEQ ID NO: 51.
- an anti-MERTK antibody or antigen-binding fragment thereof which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a VH domain having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%) sequence identity to the amino acid sequence of the VH of SEQ ID NO: 49 or SEQ ID NO: 51, wherein the antibody or antigen-binding fragment comprises CDRs (e.g., VH CDRs and/or VL CDRs) that are identical to the CDRs (e.g., VH CDRs and/or VL CDRs) set forth in Tables 1 to 4.
- CDRs e.g., VH CDRs and/or VL CDRs
- an anti-MERTK antibody or antigen-binding fragment thereof which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a VL having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%) sequence identity to the amino acid sequence of the VL of SEQ ID NO: 50 or SEQ ID NO: 52.
- an anti-MERTK antibody or antigen-binding fragment thereof which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises a VL having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%) sequence identity to the amino acid sequence of the VL of SEQ ID NO: 50 or SEQ ID NO: 52, wherein the antibody or antigen-binding fragment comprises CDRs (e.g., VH CDRs and/or VL CDRs) that are identical to the CDRs (e.g., VH CDRs and/or VL CDRs) set forth in Tables 1 to 4.
- CDRs e.g., VH CDRs and/or VL CDRs
- an anti-MERTK antibody or antigen-binding fragment thereof which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, comprises: (i) a VH domain having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of the VH domain of SEQ ID NO: 49 or SEQ ID NO: 51; and (ii) a VL domain having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of the VL domain of SEQ ID NO: 50 or SEQ ID NO: 52.
- an anti- MERTK antibody or antigen-binding fragment thereof which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes
- MERTK signaling on endothelial cells comprises: (i) a VH domain having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of the VH domain of SEQ ID NO: 49 or SEQ ID NO: 51; and (ii) a VL domain having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of the VL domain of SEQ ID NO: 50 or SEQ ID NO: 52, wherein the antibody or antigen-binding fragment comprises CDRs (e.g., VH CDRs and/or VL CDRs) that are identical to the CDRs (e.g., VH CDRs and/or VL CDRs) set forth in Tables 1 to 4.
- CDRs e.g., VH CDRs and/or VL CDRs
- antibodies that bind the same or an overlapping epitope of MERTK (e.g., an epitope of human MERTK, or both human and mouse MERTK) as an antibody described herein (e.g., antibody M6 or Ml 9).
- an "epitope” is a term in the art and refers to a localized region of an antigen to which an antibody can specifically bind.
- An epitope can be, for example, contiguous amino acids of a polypeptide (linear or contiguous epitope) or an epitope can, for example, come together from two or more non-contiguous regions of a polypeptide or polypeptides (conformational, non-linear, discontinuous, or non-contiguous epitope).
- the epitope of an antibody can be determined by, e.g., NMR spectroscopy, X-ray diffraction crystallography studies, ELISA assays, hydrogen/deuterium exchange coupled with mass spectrometry (e.g., MALDI mass spectrometry), array-based oligo- peptide scanning assays, and/or mutagenesis mapping (e.g., site-directed mutagenesis mapping).
- crystallization may be accomplished using any of the known methods in the art (e.g., Giege R et al, (1994) Acta Crystallogr D Biol Crystallogr 50(Pt 4): 339-350; McPherson A (1990) Eur J Biochem 189: 1-23; Chayen E (1997) Structure 5: 1269-1274; McPherson A (1976) J Biol Chem 251 : 6300-6303).
- Antibody antigen crystals may be studied using well known X-ray diffraction techniques and may be refined using computer software such as X-PLOR (Yale University, 1992, distributed by Molecular Simulations, Inc.; see e.g. Meth Enzymol (1985) volumes 114 & 115, eds Wyckoff HW et al, ; U.S. Patent Application No.
- antibodies that recognize and bind to the same or overlapping epitopes of MERTK can be identified using routine techniques such as an immunoassay, for example, by showing the ability of one antibody to block the binding of another antibody to a target antigen, i.e., a competitive binding assay.
- Competition binding assays also can be used to determine whether two antibodies have similar binding specificity for an epitope.
- Competitive binding can be determined in an assay in which the immunoglobulin under test inhibits specific binding of a reference antibody to a common antigen, such as MERTK.
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay see Stahli C et al, (1983) Methods Enzymol 9: 242-253
- solid phase direct biotin-avidin EIA see Kirkland TN et al, (1986) J Immunol 137: 3614-9
- solid phase direct labeled assay solid phase direct labeled sandwich assay
- a competition binding assay can be configured in a large number of different formats using either labeled antigen or labeled antibody. In a common version of this assay, the antigen is immobilized on a 96-well plate. The ability of unlabeled antibodies to block the binding of labeled antibodies to the antigen is then measured using radioactive or enzyme labels.
- competition binding assays can be used to determine whether an antibody is competitively blocked, e.g., in a dose dependent manner, by another antibody for example, an antibody binds essentially the same epitope, or overlapping epitopes, as a reference antibody, when the two antibodies recognize identical or sterically overlapping epitopes in competition binding assays such as competition ELISA assays, which can be configured in all number of different formats, using either labeled antigen or labeled antibody.
- competition binding assays such as competition ELISA assays, which can be configured in all number of different formats, using either labeled antigen or labeled antibody.
- an antibody can be tested in competition binding assays with an antibody described herein ⁇ e.g., antibody M6 or M19).
- antibodies that compete ⁇ e.g., in a dose dependent manner) for binding to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) with an antibody described herein ⁇ e.g., M6 or Ml 9), and agonizes
- MERTK signaling on endothelial cells as determined using assays known to one of skill in the art or described herein ⁇ e.g., ELISA competitive assays or surface plasmon resonance).
- an antibody that competes with an antibody described herein for binding to MERTK (e.g., human MERTK, or both human and mouse MERTK) to the same extent that the antibody described herein self-competes for binding to MERTK (e.g., human MERTK, or both human and mouse MERTK).
- a first antibody that competes with an antibody described herein for binding to MERTK (e.g., human MERTK, or both human and mouse MERTK), wherein the competition is exhibited as reduced binding of the first antibody to MERTK by more than 80% (e.g., 85%, 90%, 95%, or 98%, or between 80% to 85%, 80% to 90%, 85% to 90%, or 85% to 95%).
- MERTK e.g., human MERTK, or both human and mouse MERTK
- an antibody which competes (e.g., in a dose dependent manner) for specific binding to MERTK (e.g., human MERTK, or both human and mouse MERTK), with an antibody comprising a VH domain having the amino acid sequence of SEQ ID NO: 49 or SEQ ID NO: 51, and a VL domain having the amino acid sequence of SEQ ID NO: 50 or SEQ ID NO: 52.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- an antibody which competes (e.g., in a dose dependent manner) for specific binding to MERTK (e.g., human MERTK, or both human and mouse MERTK), with an antibody comprising (i) a VH domain comprising a VH CDRl, VH CDR2, and VH CDR3 having the amino acid sequences of the CDRs of an antibody listed in Table 1 or Table 3; and (ii) a VL domain comprising a VL CDRl, VL CDR2, and VL CDR3 having the amino acid sequences of the VL CDRs of an antibody listed in Table 2 or Table 4.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- an antibody that competes (e.g., in a dose-dependent manner), for specific binding to MERTK (e.g., human MERTK, or both human and mouse MERTK), with an antibody comprising the VH and VL CDRs of antibody M6 (Table 1 and Table 2).
- an antibody that competes (e.g., in a dose-dependent manner), for specific binding to MERTK (e.g., human MERTK, or both human and mouse MERTK), with an antibody comprising the VH and VL CDRs of antibody Ml 9 (Table 3 and Table 4).
- an anti -MERTK antibody or an antigen- binding fragment thereof described herein immunospecifically binds to the same or an overlapping epitope of antibody comprising (i) a VH domain comprising a VH CDRl, VH CDR2, and VH CDR3 having the amino acid sequences of the CDRs of antibody listed in Table 1 or Table 3, and (ii) a VL domain comprising a VL CDR1, VL CDR2, and VL CDR3 having the amino acid sequences of the CDRs of antibody listed in Table 2 or Table 4.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein immunospecifically binds to the same or an overlapping epitope of antibody M6, comprising a VH domain having an amino acid sequence of SEQ ID NO: 49, and a VL domain having an amino acid sequence of SEQ ID NO: 50.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein immunospecifically binds to the same or an overlapping epitope of antibody Ml 9, comprising a VH domain having an amino acid sequence of SEQ ID NO: 51, and a VL domain having an amino acid sequence of SEQ ID NO: 52.
- Assays known to one of skill in the art or described herein e.g., X-ray crystallography, ELISA assays, etc. can be used to determine if two antibodies bind to the same epitope.
- Affinity can be measured and/or expressed in a number of ways known in the art, including, but not limited to, equilibrium dissociation constant (K D ), and equilibrium association constant (K A ).
- K D can be determined by techniques known to one of ordinary skill in the art, such as biolayer interferometry. In a specific embodiment, the K D is determined as set forth in Example 4 or Example 7 in Section 6, infra.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein, an anti-MERTK antibody or antigen-binding fragment thereof that competes with an antibody described herein for binding to MERTK, or an anti-MERTK antibody or antigen-binding fragment thereof that binds to the same or an overlapping epitope of an antibody described herein binds to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) with a K D of less than 7 nM, 6 nM, 5 nM, 4.5 nM, 4 nM, 3.5 nM, 3 nM, 2.5 nM, 2 nM, 1.5 nM, 1 nM, 0.75 nM, 0.5 nM, 0.25 nM, 0.1 nM, 0.05 nM, 0.025 nM, 0.01 nM, or 0.005 nM.
- an anti- MERTK antibody or an antigen-binding fragment thereof described herein, an anti- MERTK antibody or antigen-binding fragment thereof that competes with an antibody described herein for binding to MERTK, or an anti-MERTK antibody or antigen-binding fragment thereof that binds to the same or an overlapping epitope of an antibody described herein binds to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) with a K D of about 7 nM, 6 nM, 5 nM, 4.5 nM, 4 nM, 3.5 nM, 3 nM, 2.5 nM, 2 nM, 1.5 nM, 1 nM, 0.75 nM, 0.5 nM, 0.25 nM, 0.1 nM, 0.05 nM, 0.025 nM, 0.01 nM, or 0.005 nM.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) with a K D of about 3 pM to 400 pM.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) with a K D of about 0.3 nM.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- K D K D of about 0.3 nM.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein binds to MERTK (e.g., human
- MERTK or both human and mouse MERTK
- K D K D of about 4.6 pM.
- the terms "about” when used to modify a numeric value or numeric range indicate that deviations of 5% to 10% above and 5% to 10% below the value or range remain within the intended meaning of the recited value or range.
- the epitope of an antibody described herein is used as an immunogen to produce antibodies. See, e.g., Section 5.2 infra for methods for producing antibodies.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, increases MERTK (e.g., human MERTK, or both human and mouse MERTK) activity on endothelial cells at least about 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 15 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, or 100 fold.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- the MERTK activity can be assessed by methods described herein or known to one of skill in the art, e.g. , by measuring the amount of MERTK phosphorylation.
- the increase in MERTK activity as measured by an increase in phosphorylation of MERTK is at least 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 15 fold, 20 fold, or 30 fold, relative to MERTK activity (e.g., human MERTK, or both human and mouse MERTK activity) on endothelial cells without any antibody or with an unrelated antibody (e.g., an antibody that does not immunospecifically bind to MERTK).
- the increase in MERTK activity is at least 50%, 60%, 70%, 80%, 90%, or 100%.
- an increase in MERTK activity is assessed as described in Example 3, infra.
- an anti-MERTK antibody or antigen-binding fragment thereof described herein which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells competes with Gas-6 (e.g., human Gas-6) for binding to MERTK.
- the antibody or antigen-binding fragment thereof described herein inhibits (e.g., completely inhibits or only partially inhibits) Gas-6 from binding to MERTK (e.g., human MERTK, or both human and mouse MERTK).
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells inhibits the binding of Gas- 6 (e.g., human or mouse Gas-6) to MERTK (e.g., human MERTK, or both human and mouse MERTK) on endothelial cells by more than 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20% or 10% as assessed by an assay known to one of skill in the art or described herein.
- Gas- 6 e.g., human or mouse Gas-6
- MERTK e.g., human MERTK, or both human and mouse MERTK
- the assay that is used to assess inhibition of binding of Gas-6 (e.g., human Gas-6) to MERTK (e.g., human MERTK, or both human and mouse MERTK) in the presence of an anti-MERTK antibody or antigen-binding fragment thereof described herein is antibody capture ELISA as described in Example 1, infra.
- the level of MERTK phosphorylation in endothelial cells is measured by phospho-MERTK-specific Western blotting as described in Example 3, infra.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which promotes (i.e., increases) the level of MERTK phosphorylation on endothelial cells, does not promote (i.e., increase) MERTK
- the level of MERTK phosphorylation in cancer cells is measured by phospho-MERTK-specific Western blotting as described in Example 3, infra.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which immunospecifically binds to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, inhibits the migration of MERTK-expressing endothelial cells in vitro in the presence of cancer cells ⁇ e.g., breast cancer cells).
- the migration of the endothelial cells is inhibited by at least 10%, 20%, 30%, 35%, 40%, 50%, or 60%) as assessed by methods described herein and/or known to one of skill in the art.
- the migration of the endothelial cells is inhibited by at least 40%), 45%), 50%), 55%), or 60% as assessed by methods described herein and/or known to one of skill in the art.
- the extent of migration can be assessed by methods described herein and/or known to one of skill in the art.
- the inhibition can be relative to the extent of migration of the MERTK-expressing endothelial cells without any antibody or with an unrelated antibody ⁇ e.g., an antibody that does not immunospecifically bind to MERTK).
- the assay that is used to assess endothelial cell migration is a transwell migration assay as described in Example 2, infra.
- the antibody or antigen-binding fragment thereof described herein which immunospecifically binds to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, does not inhibit the migration of glioblastoma multiforme cell line A 172 in an in vitro trans-well migration assay in the absence of endothelial cells.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which immunospecifically binds to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, inhibits angiogenesis within tumors.
- the inhibition of angiogenesis is by at least 10%, 20%, 30%, 40%, 50%, 55, 60%, 65%, 70%, or 75%).
- the inhibition of angiogenesis is at least 50%, 55%, 60%), 65%), or 70%). Inhibition of angiogenesis can be assessed by methods described herein and/or known to one of skill in the art.
- the inhibition can be relative to the level of angiogenesis without any antibody or with an unrelated antibody ⁇ e.g., an antibody that does not immunospecifically bind to MERTK).
- an unrelated antibody e.g., an antibody that does not immunospecifically bind to MERTK.
- the assay that is used to assess angiogenesis in vivo is as described in Example 6, infra.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein which immunospecifically binds to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells, inhibits tumor ⁇ e.g., human breast cancer tumor) progression.
- the inhibition of tumor progression by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, or 80%).
- Tumor progression can be assessed by methods described herein and/or known to one of skill in the art.
- the tumor progression can be relative to the cancer status without any antibody or with an unrelated antibody ⁇ e.g., an antibody that does not
- the assay that is used to assess tumor progression is a murine tumor transplantation model as described in
- MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK
- methods of producing antibodies or antigen -binding fragments thereof that specifically bind to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) and agonize MERTK signaling on endothelial cells e.g., human MERTK, or both human and mouse MERTK
- the antibodies or antigen-binding fragments thereof described herein can be produced by any method known in the art for the synthesis of antibodies, for example, by chemical synthesis or by recombinant expression techniques.
- the methods described herein employs, unless otherwise indicated, conventional techniques in molecular biology, microbiology, genetic analysis, recombinant DNA, organic chemistry, biochemistry, PCR, oligonucleotide synthesis and modification, nucleic acid hybridization, and related fields within the skill of the art. These techniques are described, for example, in the references cited herein and are fully explained in the literature. See, e.g., Maniatis T et al, (1982) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press;
- an antibody described herein is an antibody ⁇ e.g., recombinant antibody) prepared, expressed, created or isolated by any means that involves creation, e.g., via synthesis, genetic engineering of DNA sequences.
- an antibody ⁇ e.g., recombinant antibody prepared, expressed, created or isolated by any means that involves creation, e.g., via synthesis, genetic engineering of DNA sequences.
- such antibody comprises sequences that are encoded by DNA sequences that do not naturally exist within the antibody germline repertoire of an animal or mammal ⁇ e.g., human) in vivo.
- an antibody described herein is made by a method comprising using human MERTK (SEQ ID NO: 57) or the extracellular domain thereof (SEQ ID NO: 58) as an immunogen.
- an anti -MERTK antibody or antigen-binding fragment thereof which immunospecifically binds to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprising culturing a cell or host cell described herein.
- an anti-MERTK antibody or antigen-binding fragment thereof which immunospecifically binds to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells comprising expressing ⁇ e.g., recombinantly expressing) the antibody or antigen-binding fragment thereof using a cell or host cell described herein ⁇ e.g., a cell or a host cell comprising polynucleotides encoding an antibody described herein).
- the cell is an isolated cell.
- the exogenous polynucleotides have been introduced into the cell.
- the method further comprises the step of purifying the antibody or antigen-binding fragment thereof obtained from the cell or host cell.
- monoclonal antibodies can be produced recombinantly from host cells exogenously expressing an antibody described herein or a fragment thereof, for example, a light chain and/or heavy chain of such antibody.
- Methods for the preparation of clonal cell lines and of monoclonal antibodies expressed thereby are well known in the art (see, for example, Chapter 11 in: Short Protocols in Molecular Biology, (2002) 5th Ed., Ausubel FM et al, supra).
- monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow E & Lane D, Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed.
- mice or other animals, such as rats, monkeys, donkeys, pigs, sheep, hamster, or dogs
- an antigen e.g., MERTK (e.g., human MERTK, or both human and mouse MERTK)
- an immune response e.g., antibodies specific for the antigen are detected in the mouse serum
- the mouse spleen is harvested and splenocytes isolated.
- the splenocytes are then fused by well known techniques to any suitable myeloma cells, for example cells from cell line SP20 available from the American Type Culture Collection (ATCC ® ) (Manassas, VA), to form hybridomas.
- ATCC ® American Type Culture Collection
- the hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
- Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against MERTK (e.g., human MERTK, or both human and mouse MERTK).
- MERTK e.g., human MERTK, or both human and mouse MERTK
- the clones may be subcloned, grown, and separated from the culture medium by standard methods (Goding JW (Ed), Monoclonal Antibodies: Principles and Practice, supra).
- the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by methods known in the art, for example, immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
- RIA radioimmunoassay
- ELISA enzyme-linked immunoabsorbent assay
- a monoclonal antibody that are produced by a single cell ⁇ e.g., hybridoma or host cell producing a recombinant antibody), wherein the antibody immunospecifically binds to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) as determined, e.g., by ELISA or other antigen-binding or competitive binding assay known in the art or as described in Example 1 provided herein.
- a monoclonal antibody can be a chimeric antibody or a humanized antibody.
- a monoclonal antibody is a monovalent antibody or multivalent ⁇ e.g., bivalent) antibody.
- a monoclonal antibody is a monospecific or multispecific antibody ⁇ e.g., bispecific antibody).
- Antibodies described herein include antibody fragments which recognize MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) and can be generated by any technique known to those of skill in the art.
- Fab and F(ab') 2 fragments described herein can be produced by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab') 2 fragments).
- a Fab fragment corresponds to one of the two identical arms of an antibody molecule and contains the complete light chain paired with the VH and CHI domains of the heavy chain.
- a F(ab') 2 fragment contains the two antigen-binding arms of an antibody molecule linked by disulfide bonds in the hinge region.
- the antibodies described herein or antigen-binding fragments thereof can also be generated using various phage display methods known in the art.
- phage display methods functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them.
- DNA sequences encoding VH and VL domains are amplified from animal cDNA libraries ⁇ e.g., human or murine cDNA libraries of affected tissues).
- the DNA encoding the VH and VL domains are recombined together with a scFv linker by PCR and cloned into a phagemid vector.
- the vector is electroporated in E. coli and the E.
- Phage used in these methods are typically filamentous phage including fd and Ml 3, and the VH and VL domains are usually recombinantly fused to either the phage gene III or gene VIII.
- Phage expressing an antigen binding domain that binds to a particular antigen can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead.
- phage display methods that can be used to make the antibodies described herein include those disclosed in Brinkman U et al, (1995) J Immunol Methods 182: 41-50; Ames RS et al, (1995) J Immunol Methods 184: 177- 186; Kettleborough CA et al, (1994) Eur J Immunol 24: 952-958; Persic L et al, (1997) Gene 187: 9-18; Burton DR & Barbas CF (1994) Advan Immunol 57: 191-280; PCT Application No. PCT/GB91/001134; International Publication Nos.
- the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen-binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described below.
- Techniques to recombinantly produce antibody fragments such as Fab, Fab' and F(ab') 2 fragments can also be employed using methods known in the art such as those disclosed in PCT publication No. WO 92/22324; Mullinax RL et al, (1992)
- PCR primers including VH or VL nucleotide sequences, a restriction site, and a flanking sequence to protect the restriction site can be used to amplify the VH or VL sequences from a template, e.g., scFv clones.
- a template e.g., scFv clones.
- the PCR amplified VH domains can be cloned into vectors expressing a VH constant region
- the PCR amplified VL domains can be cloned into vectors expressing a VL constant region, e.g., human kappa or lambda constant regions.
- a chimeric antibody is a molecule in which different portions of the antibody are derived from different immunoglobulin molecules.
- a chimeric antibody can contain a variable region of a mouse or rat monoclonal antibody fused to a constant region of a human antibody. Methods for producing chimeric antibodies are known in the art.
- a humanized antibody is capable of binding to a predetermined antigen and which comprises a framework region having substantially the amino acid sequence of a human immunoglobulin and CDRs having substantially the amino acid sequence of a non- human immunoglobulin ⁇ e.g., a murine immunoglobulin).
- a humanized antibody also comprises at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- the antibody also can include the CHI, hinge, CH2, CH3, and CH4 regions of the heavy chain.
- a humanized antibody can be selected from any class of immunoglobulins, including IgM, IgG, IgD, IgA and IgE, and any isotype, including IgGi, IgG 2 , IgG 3 and IgG 4 .
- Humanized antibodies can be produced using a variety of techniques known in the art, including but not limited to, CDR-grafting (European Patent No. EP 239400; International Publication No. WO 91/09967; and U.S. Patent Nos. 5,225,539, 5,530,101, and 5,585,089), veneering or resurfacing (European Patent Nos.
- Single domain antibodies for example, antibodies lacking the light chains, can be produced by methods well known in the art. See Riechmann L & Muyldermans S
- antibodies that immunospecifically bind to a MERTK antigen can, in turn, be utilized to generate anti-idiotype antibodies that "mimic" an antigen using techniques well known to those skilled in the art. (See, e.g., Greenspan NS & Bona CA (1989) FASEB J 7(5): 437-444; and Nissinoff A (1991) J Immunol 147(8): 2429-2438).
- an antibody described herein which binds to the same or an overlapping epitope of MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) as a MERTK agonistic antibody described herein, is a human anti- MERTK antibody or antigen-binding fragment thereof.
- an antibody described herein which competitively blocks ⁇ e.g., in a dose-dependent manner) any one of the antibodies described herein, ⁇ e.g., M6 or Ml 9) from binding to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK), is a human anti -MERTK antibody or antigen-binding fragment thereof.
- Human antibodies can be produced using any method known in the art.
- transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes, can be used.
- the human heavy and light chain immunoglobulin gene complexes can be introduced randomly or by homologous recombination into mouse embryonic stem cells.
- the human variable region, constant region, and diversity region can be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes.
- the mouse heavy and light chain immunoglobulin genes can be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination.
- homozygous deletion of the J H region prevents endogenous antibody production.
- the modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice.
- the chimeric mice are then bred to produce homozygous offspring which express human antibodies.
- the transgenic mice are immunized in the normal fashion with a selected antigen, e.g., all or a portion of an antigen (e.g., MERTK).
- Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology.
- the human immunoglobulin transgenes harbored by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation.
- mice capable of producing human antibodies include the following:
- XenomouseTM (Abgenix, Inc.; U.S. Patent Nos. 6,075,181 and 6,150, 184), the HuAb- MouseTM (Mederex, Inc./Gen Pharm; U.S. Patent Nos. 5,545,806 and 5,569, 825), the Trans Chromo MouseTM (Kirin) and the KM MouseTM (Medarex/Kirin).
- Human antibodies which specifically bind to MERTK can be made by a variety of methods known in the art including phage display methods described above using antibody libraries derived from human immunoglobulin sequences. See also U.S. Patent Nos. 4,444,887, 4,716,111, and 5,885,793; and International Publication Nos. WO 98/46645, WO 98/50433, WO
- human antibodies can be produced using mouse-human hybridomas.
- human peripheral blood lymphocytes transformed with Epstein- Barr virus (EBV) can be fused with mouse myeloma cells to produce mouse-human hybridomas secreting human monoclonal antibodies, and these mouse-human hybridomas can be screened to determine ones which secrete human monoclonal antibodies that immunospecifically bind to a target antigen (e.g., MERTK (e.g., human MERTK, or both human and mouse MERTK)).
- a target antigen e.g., MERTK (e.g., human MERTK, or both human and mouse MERTK)
- MERTK e.g., human MERTK, or both human and mouse MERTK
- agonize MERTK signaling on endothelial cells are as described in Example 1, infra.
- the methods of screening and selecting antibodies or antigen -binding fragments thereof that specifically bind to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) and agonize MERTK signaling on endothelial cells are as described in Example 1, infra.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein can be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography ⁇ e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
- the antibodies described herein can be fused to heterologous polypeptide sequences described herein or otherwise known in the art to facilitate purification.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein is isolated or purified.
- an isolated antibody is one that is substantially free of other antibodies with different antigenic specificities than the isolated antibody.
- a preparation of an antibody described herein is substantially free of cellular material and/or chemical precursors.
- substantially free of cellular material includes preparations of an antibody in which the antibody is separated from cellular components of the cells from which it is isolated or recombinantly produced.
- an antibody that is substantially free of cellular material includes preparations of antibody having less than about 30%, 20%,
- heterologous protein also referred to herein as a "contaminating protein”
- variants of an antibody for example, different post-translational modified forms of an antibody or other different versions of an antibody ⁇ e.g., antibody fragments.
- culture medium represents less than about 20%, 10%, 2%, 1%, 0.5%, or 0.1% of the volume of the protein preparation.
- the antibody When the antibody is produced by chemical synthesis, it is generally substantially free of chemical precursors or other chemicals, i.e., it is separated from chemical precursors or other chemicals which are involved in the synthesis of the protein. Accordingly, such preparations of the antibody have less than about 30%, 20%, 10%, or 5% (by dry weight) of chemical precursors or compounds other than the antibody of interest.
- antibodies described herein are isolated or purified.
- polynucleotides comprising a nucleotide sequence encoding an antibody described herein or an antigen-binding fragment thereof (e-g, a variable light chain region and/or variable heavy chain region) that
- MERTK e.g., human MERTK, or both human and mouse MERTK
- vectors e.g., vectors comprising such polynucleotides for their efficient expression in host cells (e.g., E. coli and mammalian cells).
- host cells e.g., E. coli and mammalian cells.
- a polynucleotide is isolated or purified.
- an "isolated" polynucleotide or nucleic acid molecule is one which is separated from other nucleic acid molecules which are present in the natural source (e.g., in a mouse or a human) of the nucleic acid molecule.
- an "isolated" polynucleotide or nucleic acid molecule is one which is separated from other nucleic acid molecules which are present in the natural source (e.g., in a mouse or a human) of the nucleic acid molecule.
- isolated nucleic acid molecule such as a cDNA molecule
- substantially free includes preparations of polynucleotide or nucleic acid molecule having less than about 15%, 10%, 5%, 2%, 1%, 0.5%, or 0.1% of other material, e.g., cellular material, culture medium, other nucleic acid molecules, chemical precursors and/or other chemicals.
- polynucleotides comprising nucleotide sequences encoding antibodies or antigen-binding fragments thereof, which immunospecifically bind to a MERTK polypeptide (e.g., human MERTK) and comprises an amino acid sequence as described herein, as well as antibodies which compete with such antibodies for binding to a MERTK polypeptide (e.g., in a dose-dependent manner), or which binds to the same or an overlapping epitope as that of such antibodies.
- a MERTK polypeptide e.g., human MERTK
- antibodies which compete with such antibodies for binding to a MERTK polypeptide (e.g., in a dose-dependent manner), or which binds to the same or an overlapping epitope as that of such antibodies.
- polynucleotides comprising a nucleotide sequence encoding the light chain or heavy chain of an antibody described herein.
- the polynucleotides can comprise nucleotide sequences encoding a heavy chain comprising the VH CDRs described herein (see, e.g., Tables 1 and 3).
- the polynucleotides can comprise nucleotide sequences encoding a light chain comprising the VL CDRs described herein (see, e.g., Tables 2 and 4).
- polynucleotides comprising a nucleotide sequence encoding a MERTK agonistic antibody comprising three VH chain CDRs, e.g., containing VH CDRl, VH CDR2, and VH CDR3 as described in Table 1 or Table 3.
- polynucleotides comprising a nucleotide sequence encoding a MERTK agonistic antibody comprising three VL chain CDRs, e.g., containing VL CDRl, VL CDR2, and VL CDR3 as described in Table 2 or Table 4.
- polynucleotides comprising a nucleotide sequence encoding a MERTK agonistic antibody comprising three VH chain CDRs, e.g., containing VH CDRl, VH CDR2, and VH CDR3 as described in Table 1 or Table 3, and three VL chain CDRs, e.g., containing VL CDRl, VL CDR2, and VL CDR3 as described in Table 2 or Table 4.
- a polynucleotide described herein encodes a VH CDRl, a VH CDR2, and a VH CDR3 of M6 (i.e., SEQ ID NOs: 1, 6, and 11; SEQ ID NOs: 2, 7, and 12; SEQ ID NOs: 3, 8, and 11; SEQ ID NOs: 4, 9, and 13; SEQ ID NOs: 5, 10, and 14; or SEQ ID NOs: 3, 6, and 11).
- a polynucleotide described herein encodes a VL CDRl, a VL CDR2, and a VL CDR3 of M6 (i.e., SEQ ID NOs: 15, 19, and 22; SEQ ID NOs: 16, 20, and 23; SEQ ID NOs: 17, 21, and 24; or SEQ ID NOs: 18, 20, and 22).
- a polynucleotide described herein encodes the a VH CDRl, a VH CDR2, and a VH CDR3 of M6 (i.e., SEQ ID NOs: 1, 6, and 11; SEQ ID NOs: 2, 7, and 12; SEQ ID NOs: 3, 8, and 11; SEQ ID NOs: 4, 9, and 13; SEQ ID NOs: 5, 10, or 14; or SEQ ID NOs: 3, 6, and 11), and the three VL CDRs of M6 (i.e., SEQ ID NOs: 15, 19, and 22; SEQ ID NOs: 16, 20, and 23; SEQ ID NOs: 17, 21, and 24; or SEQ ID NOs: 18, 20, and 22).
- M6 i.e., SEQ ID NOs: 1, 6, and 11; SEQ ID NOs: 2, 7, and 12; SEQ ID NOs: 3, 8, and 11; SEQ ID NOs: 4, 9, and 13; SEQ ID NOs: 5, 10, or 14; or SEQ ID NOs: 3, 6, and 11
- a polynucleotide described herein encodes a VH CDRl, a VH CDR2, and a VH CDR3 of M19 (i.e., SEQ ID NOs: 25, 30, and 35; SEQ ID NOs: 26, 31, and 36; SEQ ID NOs: 27, 32, and 35; SEQ ID NOs: 28, 33, and 37; SEQ ID NOs: 29, 34, and 38; or SEQ ID NOs: 27, 30, and 35).
- a polynucleotide described herein encodes a VL CDRl, a VL CDR2, and a VL CDR3 of M19 (e.g., SEQ ID NOs: 39, 43, and 46; SEQ ID NOs: 40, 44, and 47; SEQ ID NOs: 41, 45, and 48; or SEQ ID NOs: 42, 44, and 46).
- a polynucleotide described herein encodes the three VH CDRs of M19 (i.e., SEQ ID NOs: 25, 30, and 35; SEQ ID NOs: 26, 31, and 36; SEQ ID NOs: 27, 32, and 35; SEQ ID NOs: 28, 33, or 37; SEQ ID NOs: 29, 34, and 38; or SEQ ID NOs: 27, 30, and 35), and the three VL CDRs of M19 (i.e., SEQ ID NOs: 39, 43, and 46; SEQ ID NOs: 40, 44, and 47; SEQ ID NOs: 41, 45, and 48; or SEQ ID NOs: 42, 44, and 46).
- a polynucleotide described herein comprises a nucleotide sequence encoding an anti-MERTK antibody described herein comprising a heavy chain variable region that comprises an amino acid sequence described herein (SEQ ID NO: 49 or 51), wherein the antibody immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK).
- MERTK e.g., human MERTK, or both human and mouse MERTK
- a polynucleotide described herein comprises a nucleotide sequence encoding an anti- MERTK antibody described herein comprising a light chain variable region that comprises an amino acid sequence described herein (SEQ ID NOs: 50 or 52), wherein the antibody immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK).
- MERTK e.g., human MERTK, or both human and mouse MERTK
- a polynucleotide described herein comprises a nucleotide sequence encoding an anti-MERTK antibody described herein comprising a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 49, and a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 50, wherein the antibody immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK).
- MERTK e.g., human MERTK, or both human and mouse MERTK.
- a polynucleotide described herein comprises a nucleotide sequence encoding an anti-MERTK antibody described herein comprising a heavy chain variable region that comprises the amino acid sequence of SEQ ID NO: 51, and a light chain variable region that comprises the amino acid sequence of SEQ ID NO: 52, wherein the antibody immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK).
- MERTK e.g., human MERTK, or both human and mouse MERTK.
- a polynucleotide described herein encodes a VH comprising a nucleic acid sequence of SEQ ID NO: 53 or SEQ ID NO: 55. In certain embodiment, a polynucleotide described herein encodes a VL comprising a nucleic acid sequence of SEQ ID NO: 54 or SEQ ID NO: 56. In a specific embodiment, a
- polynucleotide described herein encodes a VH comprising a nucleic acid sequence of SEQ ID NO: 53, and a VL comprising the nucleic acid sequence of SEQ ID NO: 54 (e.g., M6).
- a polynucleotide described herein encodes a VH comprising a nucleic acid sequence of SEQ ID NO: 55, and a VL comprising the nucleic acid sequence of SEQ ID NO: 56 (e.g., M19).
- a polynucleotide comprising a nucleotide sequence encoding an antibody comprising a light chain and a heavy chain, e.g. , a separate light chain and heavy chain.
- a polynucleotide provided herein comprises a nucleotide sequence encoding a kappa light chain.
- a polynucleotide provided herein comprises a nucleotide sequence encoding a lambda light chain.
- a polynucleotide provided herein comprises a nucleotide sequence encoding an antibody described herein comprising a human kappa light chain or a human lambda light chain.
- a polynucleotide provided herein comprises a nucleotide sequence encoding an antibody described herein, which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells wherein the antibody comprises a light chain, and wherein the amino acid sequence of the variable region of the light chain can comprise any amino acid sequence of SEQ ID NO: 50 or SEQ ID NO: 52, and wherein the constant region of the light chain comprises the amino acid sequence of a human kappa light chain constant region.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- a polynucleotide provided herein comprises a nucleotide sequence encoding an antibody described herein, which immunospecifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells and comprise a light chain, wherein the amino acid sequence of the variable region of the light chain can comprise any amino acid sequence of SEQ ID NO: 50 or SEQ ID NO: 52, and wherein the constant region of the light chain comprises the amino acid sequence of a human lambda light chain constant region.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- an optimized polynucleotide sequence encoding an MERTK agonistic antibody described herein or an antigen-binding fragment thereof can hybridize to an antisense (e.g., complementary) polynucleotide of an unoptimized polynucleotide sequence encoding an MERTK agonistic antibody described herein or an antigen-binding fragment thereof (e.g., VH domain and/or VL domain).
- an antisense e.g., complementary polynucleotide of an unoptimized polynucleotide sequence encoding an MERTK agonistic antibody described herein or an antigen-binding fragment thereof (e.g., VH domain and/or VL domain).
- an optimized nucleotide sequence encoding an MERTK agonistic antibody described herein or an antigen-binding fragment hybridizes under high stringency conditions to antisense polynucleotide of an unoptimized polynucleotide sequence encoding an MERTK agonistic antibody described herein or an antigen-binding fragment thereof.
- an optimized nucleotide sequence encoding a MERTK agonistic antibody described herein or an antigen-binding fragment thereof hybridizes under high stringency, intermediate or lower stringency hybridization conditions to an antisense polynucleotide of an unoptimized nucleotide sequence encoding an MERTK agonistic antibody described herein or an antigen-binding fragment thereof.
- a polynucleotide described herein is codon optimized. Information regarding hybridization conditions has been described, see, e.g., U.S. Patent Application Publication No. US 2005/0048549 (e.g., paragraphs 72-73), which is incorporated herein by reference.
- the polynucleotides can be obtained, and the nucleotide sequence of the polynucleotides determined, by any method known in the art. Nucleotide sequences encoding antibodies described herein, and modified versions of these antibodies can be determined using methods well known in the art, i.e., nucleotide codons known to encode particular amino acids are assembled in such a way to generate a nucleic acid that encodes the antibody.
- Such a polynucleotide encoding the antibody can be assembled from chemically synthesized oligonucleotides (e.g., as described in Kutmeier G et al, (1994), BioTechniques 17: 242-6), which, briefly, involves the synthesis of overlapping oligonucleotides containing portions of the sequence encoding the antibody, annealing and ligating of those oligonucleotides, and then amplification of the ligated oligonucleotides by PCR.
- chemically synthesized oligonucleotides e.g., as described in Kutmeier G et al, (1994), BioTechniques 17: 242-6), which, briefly, involves the synthesis of overlapping oligonucleotides containing portions of the sequence encoding the antibody, annealing and ligating of those oligonucleotides, and then amplification of the ligated oligonucleotides by PCR
- a polynucleotide encoding an antibody described herein can be generated from nucleic acid from a suitable source (e.g., a hybridoma) using methods well known in the art (e.g., PCR and other molecular cloning methods). For example, PCR amplification using synthetic primers hybridizable to the 3' and 5' ends of a known sequence can be performed using genomic DNA obtained from hybridoma cells producing the antibody of interest. Such PCR amplification methods can be used to obtain nucleic acids comprising the sequence encoding the light chain and/or heavy chain of an antibody.
- a suitable source e.g., a hybridoma
- methods well known in the art e.g., PCR and other molecular cloning methods.
- PCR amplification using synthetic primers hybridizable to the 3' and 5' ends of a known sequence can be performed using genomic DNA obtained from hybridoma cells producing the antibody of interest.
- Such PCR amplification methods can
- Such PCR amplification methods can be used to obtain nucleic acids comprising the sequence encoding the variable light chain region and/or the variable heavy chain region of an antibody.
- the amplified nucleic acids can be cloned into vectors for expression in host cells and for further cloning, for example, to generate chimeric and humanized antibodies.
- a nucleic acid encoding the immunoglobulin can be chemically synthesized or obtained from a suitable source (e.g., an antibody cDNA library or a cDNA library generated from, or nucleic acid, preferably poly A+ RNA, isolated from, any tissue or cells expressing the antibody, such as hybridoma cells selected to express an antibody described herein) by PCR amplification using synthetic primers hybridizable to the 3' and 5' ends of the sequence or by cloning using an oligonucleotide probe specific for the particular gene sequence to identify, e.g., a cDNA clone from a cDNA library that encodes the antibody. Amplified nucleic acids generated by PCR can then be cloned into replicable cloning vectors using any method well known in the art.
- a suitable source e.g., an antibody cDNA library or a cDNA library generated from, or nucleic acid, preferably poly A+ RNA, isolated from,
- DNA encoding MERTK agonistic antibodies described herein can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the MERTK agonistic antibodies).
- Hybridoma cells can serve as a source of such DNA. Once isolated, the DNA can be placed into expression vectors, which are then transfected into host cells such as E.
- coli cells simian COS cells, Chinese hamster ovary (CHO) cells (e.g., CHO cells from the CHO GS SystemTM (Lonza)), or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of MERTK agonistic antibodies in the recombinant host cells.
- CHO Chinese hamster ovary
- PCR primers including VH or VL nucleotide sequences, a restriction site, and a flanking sequence to protect the restriction site can be used to amplify the VH or VL sequences in scFv clones.
- the PCR amplified VH domains can be cloned into vectors expressing a heavy chain constant region, e.g., the human gamma 4 constant region, and the PCR amplified VL domains can be cloned into vectors expressing a light chain constant region, e.g., human kappa or lambda constant regions.
- the vectors for expressing the VH or VL domains comprise a promoter, a secretion signal, a cloning site for the variable domain, constant domains, and a selection marker.
- the VH and VL domains can also be cloned into one vector expressing the necessary constant regions.
- the heavy chain conversion vectors and light chain conversion vectors are then co-transfected into cell lines to generate stable or transient cell lines that express full-length antibodies, e.g., IgG, using techniques known to those of skill in the art.
- the DNA also can be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the murine sequences, or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
- polynucleotides that hybridize under high stringency, intermediate or lower stringency hybridization conditions to polynucleotides that encode an antibody described herein hybridize under high stringency, intermediate or lower stringency hybridization conditions to polynucleotides encoding a VH (SEQ ID NO: 49 or 51) and/or VL (SEQ ID NO: 50 or 52) provided herein.
- hybridization under stringent conditions can involve hybridization to filter-bound DNA in 6x sodium chloride/sodium citrate (SSC) at about 45° C followed by one or more washes in 0.2xSSC/0.1% SDS at about 50-65° C;
- SSC sodium chloride/sodium citrate
- hybridization under highly stringent conditions can involve hybridization to filter-bound nucleic acid in 6xSSC at about 45° C followed by one or more washes in 0. lxSSC/0.2% SDS at about 68° C.
- Hybridization under other stringent hybridization conditions are known to those of skill in the art and have been described, see, for example, Ausubel FM et al, eds., (1989) Current Protocols in Molecular Biology, Vol. I, Green Publishing Associates, Inc. and John Wiley & Sons, Inc., New York at pages 6.3.1-6.3.6 and 2.10.3.
- vectors ⁇ e.g., expression vectors
- polynucleotides comprising nucleotide sequences encoding MERTK agonistic antibodies or an antigen-binding fragment thereof for recombinant expression in host cells, preferably in mammalian cells.
- host cells comprising such vectors for recombinantly expressing MERTK agonistic antibodies or antigen-binding fragments thereof described herein ⁇ e.g., human or humanized antibody).
- Recombinant expression of an antibody described herein e.g., a full-length antibody, heavy and/or light chain of an antibody, or a single chain antibody described herein
- MERTK e.g., human MERTK, or both human and mouse MERTK
- polynucleotide that encodes the antibody Once a polynucleotide encoding an antibody molecule, heavy and/or light chain of an antibody, or an antigen-binding fragment thereof (e.g., heavy and/or light chain variable regions) described herein has been obtained, the vector for the production of the antibody molecule can be produced by recombinant DNA technology using techniques well known in the art. Thus, methods for preparing a protein by expressing a polynucleotide containing an antibody or antibody fragment (e.g., light chain or heavy chain) encoding nucleotide sequence are described herein.
- antibody or antibody fragment e.g., light chain or heavy chain
- methods include, for example, in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination.
- replicable vectors comprising a nucleotide sequence encoding an antibody molecule described herein, a heavy or light chain of an antibody, a heavy or light chain variable domain of an anti-MERTK antibody or antigen- binding fragment thereof, or a heavy or light chain CDR, operably linked to a promoter.
- Such vectors can, for example, include the nucleotide sequence encoding the constant region of the antibody molecule (see, e.g., International Publication Nos. WO 86/05807 and WO 89/01036; and U.S. Patent No. 5, 122,464) and variable domains of the antibody can be cloned into such a vector for expression of the entire heavy, the entire light chain, or both the entire heavy and light chains.
- An expression vector can be transferred to a cell (e.g., host cell) by
- host cells containing a polynucleotide encoding an antibody described herein or an antigen-binding fragment thereof, or a heavy or light chain thereof, or a fragment thereof, or a single chain antibody described herein, operably linked to a promoter for expression of such sequences in the host cell.
- the term "host cell” can be any type of cell, e.g., a primary cell, a cell in culture, or a cell from a cell line.
- the term "host cell” refers to a cell transfected with a nucleic acid molecule and the progeny or potential progeny of such a cell. Progeny of such a cell may not be identical to the parent cell transfected with the nucleic acid molecule, e.g., due to mutations or environmental influences that may occur in succeeding generations or integration of the nucleic acid molecule into the host cell genome.
- host-expression vector systems can be utilized to express antibody molecules described herein.
- Such host-expression systems represent vehicles by which the coding sequences of interest can be produced and subsequently purified, but also represent cells which can, when transformed or transfected with the appropriate nucleotide coding sequences, express an antibody molecule described herein in situ.
- These include but are not limited to microorganisms such as bacteria ⁇ e.g., E. coli and B.
- subtilis transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing antibody coding sequences; yeast ⁇ e.g., Saccharomyces Pichia) transformed with recombinant yeast expression vectors containing antibody coding sequences; insect cell systems infected with recombinant virus expression vectors ⁇ e.g., baculovirus) containing antibody coding sequences; plant cell systems ⁇ e.g., green algae such as Chlamydomonas reinhardtii) infected with recombinant virus expression vectors ⁇ e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors ⁇ e.g., Ti plasmid) containing antibody coding sequences; or mammalian cell systems ⁇ e.g., COS ⁇ e.g., COS1 or COS), CHO, BHK, MDCK, HEK 293, NS0
- cells for expressing antibodies described herein or an antigen-binding fragment thereof are CHO cells, for example CHO cells from the CHO GS SystemTM (Lonza).
- cells for expressing antibodies described herein are human cells, e.g., human cell lines.
- a mammalian expression vector is pOptiVECTM or pcDNA3.3.
- bacterial cells such as Escherichia coli, or eukaryotic cells ⁇ e.g., mammalian cells), especially for the expression of whole recombinant antibody molecule, are used for the expression of a recombinant antibody molecule.
- mammalian cells such as Chinese hamster ovary (CHO) cells
- CHO Chinese hamster ovary
- a vector such as the major intermediate early gene promoter element from human cytomegalovirus
- antibodies described herein are produced by CHO cells or NSO cells.
- nucleotide sequences encoding antibodies described herein which immunospecifically bind MERTK e.g., human MERTK, or both human and mouse MERTK
- agonizes MERTK signaling on endothelial cells is regulated by a constitutive promoter, inducible promoter or tissue specific promoter.
- a number of expression vectors can be advantageously selected depending upon the use intended for the antibody molecule being expressed. For example, when a large quantity of such an antibody is to be produced, for the generation of pharmaceutical compositions of an antibody molecule, vectors which direct the expression of high levels of fusion protein products that are readily purified can be desirable. Such vectors include, but are not limited to, the E.
- coli expression vector pUR278 (Ruether U & Mueller-Hill B (1983) EMBO J 2: 1791-1794), in which the antibody coding sequence can be ligated individually into the vector in frame with the lac Z coding region so that a fusion protein is produced; pF vectors (Inouye S & Inouye M (1985) Nuc Acids Res 13 : 3101-3109; Van Heeke G & Schuster SM (1989) J Biol Chem 24: 5503-5509); and the like.
- pGEX vectors can also be used to express foreign polypeptides as fusion proteins with glutathione 5-transferase (GST).
- fusion proteins are soluble and can easily be purified from lysed cells by adsorption and binding to matrix glutathione agarose beads followed by elution in the presence of free glutathione.
- the pGEX vectors are designed to include thrombin or factor Xa protease cleavage sites so that the cloned target gene product can be released from the GST moiety.
- Autographa californica nuclear polyhedrosis virus (AcNPV), for example, can be used as a vector to express foreign genes.
- the virus grows in Spodoptera frugiperda cells.
- the antibody coding sequence can be cloned individually into non-essential regions (for example the polyhedrin gene) of the virus and placed under control of an AcNPV promoter (for example the polyhedrin promoter).
- AcNPV Autographa californica nuclear polyhedrosis virus
- mammalian host cells a number of viral -based expression systems can be utilized.
- the antibody coding sequence of interest can be ligated to an adenovirus transcription/translation control complex, e.g., the late promoter and tripartite leader sequence.
- This chimeric gene can then be inserted in the adenovirus genome by in vitro or in vivo recombination. Insertion in a non-essential region of the viral genome (e.g., region El or E3) will result in a recombinant virus that is viable and capable of expressing the antibody molecule in infected hosts (e.g., see Logan J & Shenk T (1984) PNAS 81(12): 3655-9).
- Specific initiation signals can also be required for efficient translation of inserted antibody coding sequences. These signals include the ATG initiation codon and adjacent sequences.
- initiation codon must be in phase with the reading frame of the desired coding sequence to ensure translation of the entire insert.
- exogenous translational control signals and initiation codons can be of a variety of origins, both natural and synthetic.
- the efficiency of expression can be enhanced by the inclusion of appropriate transcription enhancer elements, transcription terminators, etc. (see, e.g., Bitter G et al, (1987) Methods Enzymol. 153 : 516-544).
- a host cell strain which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired can be chosen.
- modifications e.g., glycosylation
- processing e.g., cleavage
- Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed.
- eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product can be used.
- Such mammalian host cells include but are not limited to CHO, VERO, BHK, Hela, MDCK, HEK 293, NIH 3T3, W138, BT483, Hs578T, HTB2, BT20 and T47D, NS0 (a murine myeloma cell line that does not endogenously produce any immunoglobulin chains), CRL7030, COS (e.g., COS1 or COS), PER.C6, VERO, HsS78Bst, HEK-293T, HepG2, SP210, Rl . l, B-W, L-M, BSCl, BSC40, YB/20, BMT10 and HsS78Bst cells.
- COS e.g., COS1 or COS
- PER.C6 VERO
- HsS78Bst HEK-293T
- HepG2 SP210
- MERTK agonistic antibodies described herein are produced in mammalian cells, such as CHO cells.
- the antibodies described herein or antigen-binding fragments thereof have reduced fucose content or no fucose content.
- Such antibodies can be produced using techniques known one skilled in the art.
- the antibodies can be expressed in cells deficient or lacking the ability of to fucosylate.
- cell lines with a knockout of both alleles of al,6-fucosyltransferase can be used to produce antibodies or antigen-binding fragments thereof with reduced fucose content.
- the Potelligent ® system (Lonza) is an example of such a system that can be used to produce antibodies or antigen-binding fragments thereof with reduced fucose content.
- stable expression cells For long-term, high-yield production of recombinant proteins, stable expression cells can be generated. For example, cell lines which stably express an
- MERTK agonistic antibody described herein or an antigen-binding fragment thereof can be engineered.
- a cell provided herein stably expresses a light chain/light chain variable domain and a heavy chain/heavy chain variable domain which associate to form an antibody described herein or an antigen-binding fragment thereof.
- host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker.
- appropriate expression control elements e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.
- engineered cells can be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media.
- the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines.
- This method can advantageously be used to engineer cell lines which express an MERTK agonistic antibody described herein or an antigen-binding fragment thereof.
- Such engineered cell lines can be particularly useful in screening and evaluation of compositions that interact directly or indirectly with the antibody molecule.
- a number of selection systems can be used, including but not limited to, the herpes simplex virus thymidine kinase (Wigler M et al, (1977) Cell 11(1): 223-32), hypoxanthineguanine phosphoribosyltransferase (Szybalska EH & Szybalski W (1962) PNAS 48(12): 2026-2034) and adenine phosphoribosyltransferase (Lowy I et al, (1980) Cell 22(3): 817-23) genes can be employed in tk-, hgprt- or aprt-cells, respectively.
- antimetabolite resistance can be used as the basis of selection for the following genes: dhfr, which confers resistance to methotrexate (Wigler M et al, (1980) PNAS 77(6): 3567-70; O'Hare K et al, (1981) PNAS 78: 1527-31); gpt, which confers resistance to mycophenolic acid (Mulligan RC & Berg P (1981) PNAS 78(4): 2072-6); neo, which confers resistance to the aminoglycoside G-418 (Wu GY & Wu CH (1991) Biotherapy 3 : 87-95; Tolstoshev P (1993) Ann Rev Pharmacol Toxicol 32: 573-596; Mulligan RC (1993) Science 260: 926-932; and Morgan RA & Anderson WF (1993) Ann Rev Biochem 62: 191-217; Nabel GJ & Feigner PL (1993) Trends Biotechnol 11(5): 211-5);
- the expression levels of an antibody molecule can be increased by vector amplification (for a review, see Bebbington CR & Hentschel CCG, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol. 3 (Academic Press, New York, 1987)).
- vector amplification for a review, see Bebbington CR & Hentschel CCG, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol. 3 (Academic Press, New York, 1987)).
- a marker in the vector system expressing antibody is amplifiable
- increase in the level of inhibitor present in culture of host cell will increase the number of copies of the marker gene. Since the amplified region is associated with the antibody gene, production of the antibody will also increase (Crouse GF et al, (1983) Mol Cell Biol 3 : 257-66).
- the host cell can be co-transfected with two or more expression vectors described herein, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide.
- the two vectors can contain identical selectable markers which enable equal expression of heavy and light chain polypeptides.
- the host cells can be co-transfected with different amounts of the two or more expression vectors.
- host cells can be transfected with any one of the following ratios of a first expression vector and a second expression vector: 1 : 1, 1 :2, 1 :3, 1 :4, 1 :5, 1 :6, 1 :7, 1 :8, 1 :9, 1 : 10, 1 : 12, 1 : 15, 1 :20, 1 :25, 1 :30, 1 :35, 1 :40, 1 :45, or 1 :50.
- a single vector can be used which encodes, and is capable of expressing, both heavy and light chain polypeptides.
- the transcription of both genes can be driven by a common promoter, whereas the translation of the mRNA from the first gene can be by a cap-dependent scanning mechanism and the translation of the mRNA from the second gene can be by a cap-independent mechanism, e.g., by an IRES.
- compositions comprising an anti -MERTK antibody or an antigen-binding fragment thereof described herein and a pharmaceutically acceptable carrier.
- the antibody or antigen-binding fragment thereof is purified.
- the antibody or antigen-binding fragment thereof is present in the pharmaceutical composition in a therapeutically effective amount.
- Acceptable carriers which can be excipients or stabilizers, are nontoxic to recipients at the dosages and concentrations employed, and include but are not limited to buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride;
- hexamethonium chloride benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e
- compositions comprise an anti- MERTK antibody or an antigen-binding fragment thereof described herein, and optionally one or more additional prophylactic or therapeutic agents, in a pharmaceutically acceptable carrier.
- pharmaceutical compositions comprise an effective amount of an anti-MERTK antibody or an antigen-binding fragment thereof described herein, and optionally one or more additional prophylactic or therapeutic agents, in a pharmaceutically acceptable carrier.
- the pharmaceutical compositions and/or antibodies or antigen-binding fragments thereof described herein can be combined with a therapeutically effective amount of any of the additional therapeutic agents described herein (See Section 5.4.2, infra).
- the antibody is the only active ingredient included in the pharmaceutical composition.
- compositions described herein can be used to treat cancer.
- Pharmaceutically acceptable carriers used in parenteral preparations include aqueous vehicles, nonaqueous vehicles, antimicrobial agents, isotonic agents, buffers, antioxidants, local anesthetics, suspending and dispersing agents, emulsifying agents, sequestering or chelating agents and other pharmaceutically acceptable substances.
- aqueous vehicles examples include Sodium Chloride Injection, Ringers Injection, Isotonic Dextrose Injection, Sterile Water Injection, Dextrose and Lactated Ringers Injection.
- Nonaqueous parenteral vehicles include fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil and peanut oil.
- Antimicrobial agents in bacteriostatic or fungistatic concentrations can be added to parenteral preparations packaged in multiple- dose containers which include phenols or cresols, mercurials, benzyl alcohol,
- chlorobutanol methyl and propyl p-hydroxybenzoic acid esters, thimerosal, benzalkonium chloride and benzethonium chloride.
- Isotonic agents include sodium chloride and dextrose. Buffers include phosphate and citrate. Antioxidants include sodium bisulfate. Local anesthetics include procaine hydrochloride. Suspending and dispersing agents include sodium carboxymethylcelluose, hydroxypropyl methylcellulose and
- Emulsifying agents include Polysorbate 80 (TWEEN ® 80).
- a sequestering or chelating agent of metal ions includes EDTA.
- Pharmaceutical carriers also include ethyl alcohol, polyethylene glycol and propylene glycol for water miscible vehicles; and sodium hydroxide, hydrochloric acid, citric acid or lactic acid for pH adjustment.
- a pharmaceutical composition may be formulated for any route of
- injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspension in liquid prior to injection, or as emulsions.
- the injectables, solutions and emulsions also contain one or more excipients. Suitable excipients are, for example, water, saline, dextrose, glycerol or ethanol.
- compositions to be administered can also contain minor amounts of non-toxic auxiliary substances such as wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancers, and other such agents, such as for example, sodium acetate, sorbitan monolaurate,
- Preparations for parenteral administration of an antibody include sterile solutions ready for injection, sterile dry soluble products, such as lyophilized powders, ready to be combined with a solvent just prior to use, including hypodermic tablets, sterile suspensions ready for injection, sterile dry insoluble products ready to be combined with a vehicle just prior to use and sterile emulsions.
- the solutions may be either aqueous or nonaqueous.
- suitable carriers include physiological saline or phosphate buffered saline (PBS), and solutions containing thickening and solubilizing agents, such as glucose, polyethylene glycol, and polypropylene glycol and mixtures thereof.
- PBS physiological saline or phosphate buffered saline
- Topical mixtures comprising an antibody are prepared as described for the local and systemic administration.
- the resulting mixture can be a solution, suspension, emulsions or the like and can be formulated as creams, gels, ointments, emulsions, solutions, elixirs, lotions, suspensions, tinctures, pastes, foams, aerosols, irrigations, sprays, suppositories, bandages, dermal patches or any other formulations suitable for topical administration.
- An anti-MERTK antibody or an antigen-binding fragment thereof described herein can be formulated as an aerosol for topical application, such as by inhalation (see, e.g., U.S. Patent Nos. 4,044,126, 4,414,209 and 4,364,923, which describe aerosols for delivery of a steroid useful for treatment of inflammatory diseases, particularly asthma).
- These formulations for administration to the respiratory tract can be in the form of an aerosol or solution for a nebulizer, or as a microfine powder for insufflations, alone or in combination with an inert carrier such as lactose.
- the particles of the formulation will, in one embodiment, have diameters of less than 50 microns, in one embodiment less than 10 microns.
- An anti-MERTK antibody or an antigen-binding fragment thereof described herein can be formulated for local or topical application, such as for topical application to the skin and mucous membranes, such as in the eye, in the form of gels, creams, and lotions and for application to the eye or for intraci sternal or intraspinal application.
- Topical administration is contemplated for transdermal delivery and also for
- Nasal solutions of the antibody alone or in combination with other pharmaceutically acceptable excipients can also be administered.
- Transdermal patches including iontophoretic and electrophoretic devices, are well known to those of skill in the art, and can be used to administer an antibody.
- such patches are disclosed in U.S. Patent Nos. 6,267,983, 6,261,595, 6,256,533, 6,167,301, 6,024,975, 6,010715, 5,985,317, 5,983,134, 5,948,433, and 5,860,957.
- a pharmaceutical composition comprising an anti- MERTK antibody or an antigen-binding fragment thereof described herein is a lyophilized powder, which can be reconstituted for administration as solutions, emulsions and other mixtures. It may also be reconstituted and formulated as solids or gels.
- the lyophilized powder is prepared by dissolving an anti-MERTK antibody or an antigen-binding fragment thereof described herein, or a pharmaceutically acceptable derivative thereof, in a suitable solvent.
- the lyophilized powder is sterile.
- the solvent may contain an excipient which improves the stability or other pharmacological component of the powder or reconstituted solution, prepared from the powder.
- Excipients that may be used include, but are not limited to, dextrose, sorbitol, fructose, corn syrup, xylitol, glycerin, glucose, sucrose or other suitable agent.
- the solvent may also contain a buffer, such as citrate, sodium or potassium phosphate or other such buffer known to those of skill in the art at, in one embodiment, about neutral pH.
- sterile filtration of the solution followed by lyophilization under standard conditions known to those of skill in the art provides the desired formulation.
- the resulting solution will be apportioned into vials for lyophilization. Each vial will contain a single dosage or multiple dosages of the compound.
- the lyophilized powder can be stored under appropriate conditions, such as at about 4°C to room temperature.
- Reconstitution of this lyophilized powder with water for injection provides a formulation for use in parenteral administration.
- the lyophilized powder is added to sterile water or other suitable carrier. The precise amount depends upon the selected compound. Such amount can be empirically determined.
- the antibodies or antigen-binding fragments thereof described herein and other compositions provided herein can also be formulated to be targeted to a particular tissue, receptor, or other area of the body of the subject to be treated. Many such targeting methods are well known to those of skill in the art. All such targeting methods are contemplated herein for use in the instant compositions. For non-limiting examples of targeting methods, see, e.g., U.S. Patent Nos.
- an anti-MERTK antibody or an antigen-binding fragment thereof described herein is targeted to a tumor.
- compositions to be used for in vivo administration can be sterile. This is readily accomplished by filtration through, e.g., sterile filtration membranes.
- presented herein are methods for treating cancer in a subj ect, comprising administering to a subject in need thereof an anti-MERTK antibody or antigen-binding fragment thereof described herein, or a pharmaceutical composition comprising an anti-MERTK antibody or an antigen-binding fragment thereof described herein.
- methods for treating cancer in a subject comprising administering to a subject in need thereof a pharmaceutical composition comprising an anti-MERTK antibody or an antigen-binding fragment thereof described herein that specifically binds to MERTK ⁇ e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells.
- presented herein are methods for treating cancer in which it is desirable to agonize MERTK signaling on endothelial cells, for example to inhibit angiogenesis, comprising administering to a subject in need thereof a pharmaceutical composition comprising an anti-MERTK antibody or antigen-binding fragment thereof that specifically binds to MERTK (e.g., human MERTK, or both human and mouse MERTK) and agonizes MERTK signaling on endothelial cells.
- MERTK e.g., human MERTK, or both human and mouse MERTK
- the administration of an antibody or antigen-binding fragment described herein, or a pharmaceutical composition described herein to a subject with cancer achieves at least one, two, three, four or more of the following effects: (i) the reduction or amelioration of the severity of one or more symptoms of cancer; (ii) the reduction in the duration of one or more symptoms associated with cancer; (iii) the prevention in the recurrence of a symptom associated with cancer; (iv) the reduction in hospitalization of a subject; (v) a reduction in hospitalization length; (vi) the increase in the survival of a subject; (vii) the enhancement or improvement of the therapeutic effect of another therapy; (viii) the inhibition of the development or onset of one or more symptoms associated with cancer; (ix) the reduction in the number of symptoms associated with cancer; (x) improvement in quality of life as assessed by methods well known in the art; (x) inhibition of the recurrence of a tumor; (xi) the regression of tumors and/or one or more of the following effects: (i) the
- the cancer treated in accordance with the methods described herein is a cancer of the lung, breast, bone, ovary, stomach, pancreas, larynx, esophagus, testes, liver, parotid, biliary tract, colon, rectum, cervix, uterus, endometrium, kidney, bladder, prostate or thyroid.
- the cancer is a sarcoma, squamous cell carcinoma, melanoma, glioma, glioblastoma, neuroblastoma or Kaposi's sarcomas.
- the cancer treated in accordance with the methods is metastatic.
- the cancer treated in accordance with the methods described herein is breast cancer.
- the cancer treated in accordance with the methods described herein is triple-negative breast cancer.
- Triple- negative breast cancer refers to any tumor or cell derived from or growing in breast tissue that does not express the genes Her2 (also known as Neu), Estrogen Receptor (also known as ER) or Progesterone Receptor (also known as PR).
- the terms "subject” and “patient” are used interchangeably.
- the subject is a mammal such as a primate (e.g., monkey or human), most preferably a human.
- an anti-MERTK antibody or antigen-binding fragment thereof that specifically binds to MERTK e.g., human MERTK, or both human and mouse MERTK
- MERTK e.g., human MERTK, or both human and mouse MERTK
- two or more different antibodies or antigen-binding fragments thereof that specifically binds to MERTK e.g., human MERTK, or both human and mouse MERTK
- agonize MERTK signaling on endothelial cells described herein are administered to a subject.
- an anti-MERTK antibody or an antigen- binding fragment thereof described herein is administered to a subject in combination with one or more other therapies (See Section 5.4.2, Infra.).
- An anti-MERTK antibody or antigen-binding fragment thereof, or composition described herein may be delivered to a subj ect by a variety of routes. These include, but are not limited to, parenteral, intranasal, intratracheal, oral, intradermal, topical, intramuscular, intraperitoneal, transdermal, intravenous, intratumoral, conjunctival and subcutaneous routes. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent for use as a spray.
- an anti-MERTK antibody or antigen-binding fragment thereof, or a composition described herein is administered parenterally to a subject. In a specific embodiment, said parenteral administration is intravenous, intramuscular, or subcutaneous.
- an anti-MERTK antibody or antigen-binding fragment thereof, or composition which will be effective in the treatment and/or prevention of a condition will depend on the nature of the disease, and can be determined by standard clinical techniques.
- the precise dose to be employed in a composition will also depend on the route of administration, and the type of cancer, and should be decided according to the judgment of the practitioner and each subject's circumstances.
- effective doses may also vary depending upon means of administration, target site, physiological state of the patient (including age, body weight and health), whether the patient is human or animal, other medications administered, or whether treatment is prophylactic or therapeutic. Treatment dosages are optimally titrated to optimize safety and efficacy.
- an in vitro assay is employed to help identify optimal dosage ranges.
- Effective doses may be extrapolated from dose response curves derived from in vitro or animal model test systems.
- the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 15 mg/kg, of the patient body weight.
- dosages can be 1 mg/kg body weight, 10 mg/kg body weight, or within the range of 1-10 mg/kg or in other words, 70 mg or 700 mg or within the range of 70-700 mg, respectively, for a 70 kg patient.
- the dosage can be 1 mg/kg body weight, 10 mg/kg body weight, or within the range of 1-10 mg/kg or in other words, 70 mg or 700 mg or within the range of 70-700 mg, respectively, for a 70 kg patient.
- the dosages can be 1 mg/kg body weight, 10 mg/kg body weight, or within the range of 1-10 mg/kg or in other words, 70 mg or 700 mg or within the range of 70-700 mg, respectively, for a 70 kg patient.
- the dosage can be 1 mg/kg body weight, 10 mg/kg body weight, or within the range of 1-10 mg/kg or in other words, 70 mg or 700 mg or within the range
- human antibodies have a longer half-life within the human body than antibodies from other species due to the immune response to the foreign polypeptides. Thus, lower dosages of human antibodies and less frequent administration is often possible.
- An exemplary treatment regime entails administration once per every two weeks or once a month or once every 3 to 6 months for a period of one year or over several years, or over several year-intervals.
- two or more antibodies or antigen-binding fragments thereof with different binding specificities are administered simultaneously to a subject.
- An anti-MERTK antibody or antigen-binding fragment thereof is usually administered on multiple occasions. Intervals between single dosages can be weekly, monthly, every 3 months, every 6 months or yearly.
- the methods provided herein for treating cancer in a subject comprising administering to a subject in need thereof a pharmaceutical composition comprising an anti-MERTK antibody or an antigen-binding fragment thereof described herein, further comprise administering to the subject one or more additional therapeutic agents.
- the additional therapeutic agent is for treating the cancer.
- the additional therapeutic agent is for treating any side effects of treatment with a MERTK antibody or antigen binding fragment thereof described herein.
- the additional agent is an agent used to treat breast cancer, an agent used to treat melanoma, an immunotherapy, or an angiogenesis inhibitor.
- the additional therapeutic agent is an agent used to treat breast cancer that is selected from the group consisting of Tamoxifen, Raloxifene, Paclitaxel (TAXOL ® ), Cyclophosphamide, Docetaxel, Vinblastine, Fluorouracil,
- the additional therapeutic agent is an agent used to treat melanoma that is selected from the group consisting of a BRAF inhibitor, a MEK inhibitor, and dacarbazine.
- the additional therapeutic agent is an antibody that is a CTLA-4 inhibitor, a PD-1 inhibitor, or a PD-L1 inhibitor.
- the additional therapeutic agent is an angiogenesis inhibitor that is selected from the group consisting of a VEGF inhibitor, a VEGFR2 inhibitor, Sunitinib, and Sorafenib.
- the additional therapeutic agent is an agent listed in Table 10.
- Table 10 Additional Therapeutic Agents for Use in Combination Therapy with MERTK Antibodies or Antigen-Binding Fragments Thereof Alkylating agents Busulfan Chlorambucil
- vinblastine PG-TXL Cell Therapeutics
- vindesine IDN 5109 Bayer
- dolastatin 10 NCI
- a 105972 Abbott
- rhizoxin Fujisawa
- a 204197 Abbott
- mivobulin Warner-Lambert
- LU 223651 BASF
- TXD 258 (Aventis) combretastatin A4 (BMS) epothilone B (Novartis) isohomohalichondrin-B (PharmaMar)
- Fabre vinflunine
- AVLB Prescient NeuroPharma
- auristatin PE Teikoku Hormone
- azaepothilone B BMS
- BMS 188797 BMS (BMS) dolastatin-10 (NIH) taxoprexin (Protarga) CA-4 (OXiGENE)
- Thymidylate pemetrexed (Eli Lilly) nolatrexed (Eximias) synthase inhibitors ZD-9331 (BTG) CoFactorTM (BioKeys)
- TNF alpha virulizin (Lorus Therapeutics) revimid (Celgene) agonists/antagonists CDC-394 (Celgene)
- Immuno-modulators interferon dexosome therapy (Anosys) oncophage (Antigenics) pentrix (Australian Cancer Technology)
- GMK Progenies
- ISF-154 Tragen
- CTL melanoma vaccine
- GSK MAGE-A3 (GSK) CM-10 (cCam Biotherapeutics) nivolumab (BMS) MPDL3280A (Genentech) abatacept (BMS) pidilizumab (CureTech) lambrolizumab (Merck) AMP-224 (GSK)
- Photodynamic talaporfin (Light Sciences) Pd-bacteriopheophorbide (Yeda) agents Theralux (Theratechnologies) lutetium texaphyrin (Pharmacyclics) motexafin gadolinium
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Endocrinology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES15874253T ES2862701T3 (es) | 2014-12-22 | 2015-12-21 | Anticuerpos agonistas anti-MERTK y usos de los mismos |
| EP20201416.3A EP3789039A1 (en) | 2014-12-22 | 2015-12-21 | Anti-mertk agonistic antibodies and uses thereof |
| JP2017533597A JP7211703B2 (ja) | 2014-12-22 | 2015-12-21 | 抗mertkアゴニスト抗体及びその使用 |
| CA2972048A CA2972048C (en) | 2014-12-22 | 2015-12-21 | Anti-mertk agonistic antibodies and uses thereof |
| HK18105107.9A HK1245807B (en) | 2014-12-22 | 2015-12-21 | Anti-mertk agonistic antibodies and uses thereof |
| US15/538,510 US10221248B2 (en) | 2014-12-22 | 2015-12-21 | Anti-MERTK agonistic antibodies and uses thereof |
| EP15874253.6A EP3237450B1 (en) | 2014-12-22 | 2015-12-21 | Anti-mertk agonistic antibodies and uses thereof |
| US16/256,737 US11225524B2 (en) | 2014-12-22 | 2019-01-24 | Anti-MERTK agonistic antibodies and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462095325P | 2014-12-22 | 2014-12-22 | |
| US62/095,325 | 2014-12-22 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/538,510 A-371-Of-International US10221248B2 (en) | 2014-12-22 | 2015-12-21 | Anti-MERTK agonistic antibodies and uses thereof |
| US16/256,737 Continuation US11225524B2 (en) | 2014-12-22 | 2019-01-24 | Anti-MERTK agonistic antibodies and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016106221A1 true WO2016106221A1 (en) | 2016-06-30 |
Family
ID=56151490
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/067118 Ceased WO2016106221A1 (en) | 2014-12-22 | 2015-12-21 | Anti-mertk agonistic antibodies and uses thereof |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US10221248B2 (enExample) |
| EP (2) | EP3237450B1 (enExample) |
| JP (1) | JP7211703B2 (enExample) |
| CA (1) | CA2972048C (enExample) |
| ES (1) | ES2862701T3 (enExample) |
| WO (1) | WO2016106221A1 (enExample) |
Cited By (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3197495A4 (en) * | 2014-09-28 | 2018-08-29 | The Regents of The University of California | Modulation of stimulatory and non-stimulatory myeloid cells |
| WO2019005756A1 (en) * | 2017-06-28 | 2019-01-03 | The Rockefeller University | CONJUGATES AGONIST ANTIBODY ANTI-MERTK-MEDICINE |
| WO2019084307A1 (en) * | 2017-10-26 | 2019-05-02 | Celldex Therapeutics, Inc. | ANTI-MERTK ANTIBODIES AND METHODS OF USE |
| WO2019134927A1 (en) * | 2018-01-03 | 2019-07-11 | Agomab Therapeutics Bvba | Hgf-met agonist for use in the treatment of cancer and colorectal fibrosis |
| WO2019201970A1 (en) | 2018-04-19 | 2019-10-24 | University Of Copenhagen | A mertk ligand for adoptive t cell cancer therapy |
| WO2020047299A1 (en) | 2018-08-30 | 2020-03-05 | HCW Biologics, Inc. | Multi-chain chimeric polypeptides and uses thereof |
| WO2020047473A1 (en) | 2018-08-30 | 2020-03-05 | HCW Biologics, Inc. | Single-chain and multi-chain chimeric polypeptides and uses thereof |
| WO2020047333A1 (en) | 2018-08-30 | 2020-03-05 | HCW Biologics, Inc. | Single-chain chimeric polypeptides and uses thereof |
| WO2020076799A1 (en) | 2018-10-09 | 2020-04-16 | Bristol-Myers Squibb Company | Anti-mertk antibodies for treating cancer |
| WO2020176497A1 (en) | 2019-02-26 | 2020-09-03 | Rgenix, Inc. | High-affinity anti-mertk antibodies and uses thereof |
| WO2020214995A1 (en) * | 2019-04-19 | 2020-10-22 | Genentech, Inc. | Anti-mertk antibodies and their methods of use |
| WO2021119508A1 (en) | 2019-12-13 | 2021-06-17 | Alector Llc | Anti-mertk antibodies and methods of use thereof |
| WO2021142086A1 (en) | 2020-01-08 | 2021-07-15 | Synthis Therapeutics, Inc. | Alk5 inhibitor conjugates and uses thereof |
| WO2021163369A2 (en) | 2020-02-11 | 2021-08-19 | HCW Biologics, Inc. | Methods of treating age-related and inflammatory diseases |
| WO2021163298A1 (en) | 2020-02-11 | 2021-08-19 | HCW Biologics, Inc. | Methods of activating regulatory t cells |
| WO2021163299A1 (en) | 2020-02-11 | 2021-08-19 | HCW Biologics, Inc. | Chromatography resin and uses thereof |
| US11098126B2 (en) | 2016-06-27 | 2021-08-24 | Agomab Therapeutics Bvba | Anti-MET antibodies and uses thereof |
| WO2021202590A1 (en) | 2020-03-31 | 2021-10-07 | Alector Llc | Anti-mertk antibodies and methods of use thereof |
| WO2021222587A1 (en) | 2020-04-29 | 2021-11-04 | HCW Biologics, Inc. | Anti-cd26 proteins and uses thereof |
| WO2021247604A1 (en) | 2020-06-01 | 2021-12-09 | HCW Biologics, Inc. | Methods of treating aging-related disorders |
| WO2021247003A1 (en) | 2020-06-01 | 2021-12-09 | HCW Biologics, Inc. | Methods of treating aging-related disorders |
| US11225524B2 (en) | 2014-12-22 | 2022-01-18 | The Rockefeller University | Anti-MERTK agonistic antibodies and uses thereof |
| US11505602B2 (en) | 2017-12-12 | 2022-11-22 | Pionyr Immunotherapeutics, Inc. | Anti-TREM2 antibodies and related methods |
| WO2022266223A1 (en) | 2021-06-16 | 2022-12-22 | Alector Llc | Bispecific anti-mertk and anti-pdl1 antibodies and methods of use thereof |
| WO2022266221A1 (en) | 2021-06-16 | 2022-12-22 | Alector Llc | Monovalent anti-mertk antibodies and methods of use thereof |
| WO2022241212A3 (en) * | 2021-05-14 | 2023-04-06 | Inspirna, Inc. | Mertk peptides and uses thereof |
| US11738052B2 (en) | 2019-06-21 | 2023-08-29 | HCW Biologics, Inc. | Multi-chain chimeric polypeptides and uses thereof |
| WO2023168363A1 (en) | 2022-03-02 | 2023-09-07 | HCW Biologics, Inc. | Method of treating pancreatic cancer |
| US12024545B2 (en) | 2020-06-01 | 2024-07-02 | HCW Biologics, Inc. | Methods of treating aging-related disorders |
| US12384822B2 (en) | 2021-01-29 | 2025-08-12 | Illimis Therapeutics, Inc. | TAM receptor-binding fusion molecule having non-inflammatory phagocytosis inducing activity |
| US12509494B2 (en) | 2022-10-19 | 2025-12-30 | Immunitybio, Inc. | Multi-chain chimeric polypeptides and uses thereof |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12497464B1 (en) | 2018-08-03 | 2025-12-16 | Berkeley Therapeutics, Inc. | Antibody, antibody fragments or peptide for treating cancer and methods of formation and administration |
| WO2020106461A2 (en) * | 2018-11-08 | 2020-05-28 | Celldex Therapeutics, Inc. | Anti-mertk antibodies and methods of use thereof |
| CN119654342B (zh) * | 2022-07-28 | 2025-07-18 | 乐普创一生物科技(上海)有限公司 | 抗MerTK抗体及其用途 |
| WO2025070337A1 (ja) * | 2023-09-25 | 2025-04-03 | アステラス製薬株式会社 | 抗MerTKアゴニスト抗体、抗MerTK二重特異性抗体、及びその使用 |
Citations (103)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4044126A (en) | 1972-04-20 | 1977-08-23 | Allen & Hanburys Limited | Steroidal aerosol compositions and process for the preparation thereof |
| US4364923A (en) | 1972-04-20 | 1982-12-21 | Allen & Hanburs Limited | Chemical compounds |
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| WO1986005807A1 (en) | 1985-04-01 | 1986-10-09 | Celltech Limited | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| EP0239400A2 (en) | 1986-03-27 | 1987-09-30 | Medical Research Council | Recombinant antibodies and methods for their production |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4816397A (en) | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5122464A (en) | 1986-01-23 | 1992-06-16 | Celltech Limited, A British Company | Method for dominant selection in eucaryotic cells |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1993017105A1 (en) | 1992-02-19 | 1993-09-02 | Scotgen Limited | Altered antibodies, products and processes relating thereto |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| EP0592106A1 (en) | 1992-09-09 | 1994-04-13 | Immunogen Inc | Resurfacing of rodent antibodies |
| WO1994025591A1 (en) | 1993-04-29 | 1994-11-10 | Unilever N.V. | PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE) |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1997013844A1 (en) | 1995-10-06 | 1997-04-17 | Cambridge Antibody Technology Limited | Specific binding members for human transforming growth factor beta; materials and methods |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5709874A (en) | 1993-04-14 | 1998-01-20 | Emory University | Device for local drug delivery and methods for using the same |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US5759542A (en) | 1994-08-05 | 1998-06-02 | New England Deaconess Hospital Corporation | Compositions and methods for the delivery of drugs by platelets for the treatment of cardiovascular and other diseases |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US5837242A (en) | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5840674A (en) | 1990-11-01 | 1998-11-24 | Oregon Health Sciences University | Covalent microparticle-drug conjugates for biological targeting |
| US5860957A (en) | 1997-02-07 | 1999-01-19 | Sarcos, Inc. | Multipathway electronically-controlled drug delivery system |
| US5869620A (en) | 1986-09-02 | 1999-02-09 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US5900252A (en) | 1990-04-17 | 1999-05-04 | Eurand International S.P.A. | Method for targeted and controlled release of drugs in the intestinal tract and more particularly in the colon |
| US5948433A (en) | 1997-08-21 | 1999-09-07 | Bertek, Inc. | Transdermal patch |
| US5972366A (en) | 1994-11-28 | 1999-10-26 | The Unites States Of America As Represented By The Secretary Of The Army | Drug releasing surgical implant or dressing material |
| US5983134A (en) | 1995-04-23 | 1999-11-09 | Electromagnetic Bracing Systems Inc. | Electrophoretic cuff apparatus drug delivery system |
| US5985307A (en) | 1993-04-14 | 1999-11-16 | Emory University | Device and method for non-occlusive localized drug delivery |
| US5985317A (en) | 1996-09-06 | 1999-11-16 | Theratech, Inc. | Pressure sensitive adhesive matrix patches for transdermal delivery of salts of pharmaceutical agents |
| US5989830A (en) | 1995-10-16 | 1999-11-23 | Unilever Patent Holdings Bv | Bifunctional or bivalent antibody fragment analogue |
| US6004534A (en) | 1993-07-23 | 1999-12-21 | Massachusetts Institute Of Technology | Targeted polymerized liposomes for improved drug delivery |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| US6010715A (en) | 1992-04-01 | 2000-01-04 | Bertek, Inc. | Transdermal patch incorporating a polymer film incorporated with an active agent |
| US6024975A (en) | 1992-04-08 | 2000-02-15 | Americare International Diagnostics, Inc. | Method of transdermally administering high molecular weight drugs with a polymer skin enhancer |
| US6039975A (en) | 1995-10-17 | 2000-03-21 | Hoffman-La Roche Inc. | Colon targeted delivery system |
| US6048736A (en) | 1998-04-29 | 2000-04-11 | Kosak; Kenneth M. | Cyclodextrin polymers for carrying and releasing drugs |
| US6060082A (en) | 1997-04-18 | 2000-05-09 | Massachusetts Institute Of Technology | Polymerized liposomes targeted to M cells and useful for oral or mucosal drug delivery |
| US6071495A (en) | 1989-12-22 | 2000-06-06 | Imarx Pharmaceutical Corp. | Targeted gas and gaseous precursor-filled liposomes |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6120751A (en) | 1997-03-21 | 2000-09-19 | Imarx Pharmaceutical Corp. | Charged lipids and uses for the same |
| US6131570A (en) | 1998-06-30 | 2000-10-17 | Aradigm Corporation | Temperature controlling device for aerosol drug delivery |
| US6132992A (en) | 1993-02-01 | 2000-10-17 | Bristol-Myers Squibb Co. | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| US6139865A (en) | 1996-10-01 | 2000-10-31 | Eurand America, Inc. | Taste-masked microcapsule compositions and methods of manufacture |
| US6150184A (en) | 1996-08-20 | 2000-11-21 | Ramtron International Corporation | Method of fabricating partially or completely encapsulated top electrode of a ferroelectric capacitor |
| US6167301A (en) | 1995-08-29 | 2000-12-26 | Flower; Ronald J. | Iontophoretic drug delivery device having high-efficiency DC-to-DC energy conversion circuit |
| WO2001044301A1 (en) | 1999-11-29 | 2001-06-21 | Unilever Plc | Immobilized single domain antigen-binding molecules |
| US6256533B1 (en) | 1999-06-09 | 2001-07-03 | The Procter & Gamble Company | Apparatus and method for using an intracutaneous microneedle array |
| US6253872B1 (en) | 1996-05-29 | 2001-07-03 | Gmundner Fertigteile Gesellschaft M.B.H & Co., Kg | Track soundproofing arrangement |
| US6261595B1 (en) | 2000-02-29 | 2001-07-17 | Zars, Inc. | Transdermal drug patch with attached pocket for controlled heating device |
| US6267983B1 (en) | 1997-10-28 | 2001-07-31 | Bando Chemical Industries, Ltd. | Dermatological patch and process for producing thereof |
| US6271359B1 (en) | 1999-04-14 | 2001-08-07 | Musc Foundation For Research Development | Tissue-specific and pathogen-specific toxic agents and ribozymes |
| US6274552B1 (en) | 1993-03-18 | 2001-08-14 | Cytimmune Sciences, Inc. | Composition and method for delivery of biologically-active factors |
| US6316652B1 (en) | 1995-06-06 | 2001-11-13 | Kosta Steliou | Drug mitochondrial targeting agents |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| WO2002060919A2 (en) | 2000-12-12 | 2002-08-08 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| US20040014194A1 (en) | 2002-03-27 | 2004-01-22 | Schering Corporation | Beta-secretase crystals and methods for preparing and using the same |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US20050042664A1 (en) | 2003-08-22 | 2005-02-24 | Medimmune, Inc. | Humanization of antibodies |
| US20050048549A1 (en) | 2003-01-21 | 2005-03-03 | Liangxian Cao | Methods and agents for screening for compounds capable of modulating gene expression |
| US7183076B2 (en) | 1997-05-02 | 2007-02-27 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US20100266604A1 (en) * | 2007-11-09 | 2010-10-21 | The Salk Institute For Biological Studies | Use of tam receptor inhibitors as immunoenhancers and tam activators as immunosuppressors |
| US7951917B1 (en) | 1997-05-02 | 2011-05-31 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US20120135424A1 (en) * | 2004-11-24 | 2012-05-31 | The Regents Of The University Of Colorado, A Body Corporate | Mer diagnostic and therapeutic agents |
| US8227577B2 (en) | 2007-12-21 | 2012-07-24 | Hoffman-La Roche Inc. | Bivalent, bispecific antibodies |
| US8586713B2 (en) | 2009-06-26 | 2013-11-19 | Regeneron Pharmaceuticals, Inc. | Readily isolated bispecific antibodies with native immunoglobulin format |
| US20130309243A1 (en) * | 2010-08-19 | 2013-11-21 | Howard Florey Institute | Tam receptors and tam receptor ligands in detection and modulation of neuropathological disease |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5569A (en) | 1848-05-16 | Corn-sheller | ||
| US825A (en) | 1838-07-09 | Bail way cooking-stove | ||
| US985317A (en) | 1910-07-11 | 1911-02-28 | Julius R W Anderson | Clam-shell bucket. |
| JP4108760B2 (ja) * | 1997-02-21 | 2008-06-25 | ジェネンテック,インコーポレーテッド | 抗体フラグメント−ポリマー複合体およびヒト化抗il−8モノクローナル抗体 |
| US7541440B2 (en) * | 2002-09-30 | 2009-06-02 | Immunomedics, Inc. | Chimeric, human and humanized anti-granulocyte antibodies and methods of use |
| JP2006315964A (ja) * | 2005-05-10 | 2006-11-24 | Chugai Pharmaceut Co Ltd | 抗体安定化方法 |
| US20150315552A1 (en) | 2012-12-14 | 2015-11-05 | The Board Of Trustees Of The Leland Stanford Junior University | Inhibition of AXL Signaling in Primary Tumor Therapy |
| LT3116909T (lt) * | 2014-03-14 | 2020-02-10 | Novartis Ag | Antikūno molekulės prieš lag-3 ir jų panaudojimas |
| CA2972048C (en) | 2014-12-22 | 2023-03-07 | The Rockefeller University | Anti-mertk agonistic antibodies and uses thereof |
-
2015
- 2015-12-21 CA CA2972048A patent/CA2972048C/en active Active
- 2015-12-21 JP JP2017533597A patent/JP7211703B2/ja active Active
- 2015-12-21 WO PCT/US2015/067118 patent/WO2016106221A1/en not_active Ceased
- 2015-12-21 EP EP15874253.6A patent/EP3237450B1/en active Active
- 2015-12-21 US US15/538,510 patent/US10221248B2/en active Active
- 2015-12-21 EP EP20201416.3A patent/EP3789039A1/en not_active Withdrawn
- 2015-12-21 ES ES15874253T patent/ES2862701T3/es active Active
-
2019
- 2019-01-24 US US16/256,737 patent/US11225524B2/en active Active
Patent Citations (113)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4364923A (en) | 1972-04-20 | 1982-12-21 | Allen & Hanburs Limited | Chemical compounds |
| US4414209A (en) | 1972-04-20 | 1983-11-08 | Allen & Hanburys Limited | Micronized aerosol steroids |
| US4044126A (en) | 1972-04-20 | 1977-08-23 | Allen & Hanburys Limited | Steroidal aerosol compositions and process for the preparation thereof |
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4816397A (en) | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
| US6331415B1 (en) | 1983-04-08 | 2001-12-18 | Genentech, Inc. | Methods of producing immunoglobulins, vectors and transformed host cells for use therein |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| WO1986005807A1 (en) | 1985-04-01 | 1986-10-09 | Celltech Limited | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| US5122464A (en) | 1986-01-23 | 1992-06-16 | Celltech Limited, A British Company | Method for dominant selection in eucaryotic cells |
| EP0239400A2 (en) | 1986-03-27 | 1987-09-30 | Medical Research Council | Recombinant antibodies and methods for their production |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5869620A (en) | 1986-09-02 | 1999-02-09 | Enzon, Inc. | Multivalent antigen-binding proteins |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| US6071495A (en) | 1989-12-22 | 2000-06-06 | Imarx Pharmaceutical Corp. | Targeted gas and gaseous precursor-filled liposomes |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| US5900252A (en) | 1990-04-17 | 1999-05-04 | Eurand International S.P.A. | Method for targeted and controlled release of drugs in the intestinal tract and more particularly in the colon |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5840674A (en) | 1990-11-01 | 1998-11-24 | Oregon Health Sciences University | Covalent microparticle-drug conjugates for biological targeting |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| US5658727A (en) | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| WO1993017105A1 (en) | 1992-02-19 | 1993-09-02 | Scotgen Limited | Altered antibodies, products and processes relating thereto |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US6010715A (en) | 1992-04-01 | 2000-01-04 | Bertek, Inc. | Transdermal patch incorporating a polymer film incorporated with an active agent |
| US6024975A (en) | 1992-04-08 | 2000-02-15 | Americare International Diagnostics, Inc. | Method of transdermally administering high molecular weight drugs with a polymer skin enhancer |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| EP0592106A1 (en) | 1992-09-09 | 1994-04-13 | Immunogen Inc | Resurfacing of rodent antibodies |
| US5837242A (en) | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US6132992A (en) | 1993-02-01 | 2000-10-17 | Bristol-Myers Squibb Co. | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| US6274552B1 (en) | 1993-03-18 | 2001-08-14 | Cytimmune Sciences, Inc. | Composition and method for delivery of biologically-active factors |
| US5709874A (en) | 1993-04-14 | 1998-01-20 | Emory University | Device for local drug delivery and methods for using the same |
| US5985307A (en) | 1993-04-14 | 1999-11-16 | Emory University | Device and method for non-occlusive localized drug delivery |
| WO1994025591A1 (en) | 1993-04-29 | 1994-11-10 | Unilever N.V. | PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE) |
| US6004534A (en) | 1993-07-23 | 1999-12-21 | Massachusetts Institute Of Technology | Targeted polymerized liposomes for improved drug delivery |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| US5759542A (en) | 1994-08-05 | 1998-06-02 | New England Deaconess Hospital Corporation | Compositions and methods for the delivery of drugs by platelets for the treatment of cardiovascular and other diseases |
| US5972366A (en) | 1994-11-28 | 1999-10-26 | The Unites States Of America As Represented By The Secretary Of The Army | Drug releasing surgical implant or dressing material |
| US5983134A (en) | 1995-04-23 | 1999-11-09 | Electromagnetic Bracing Systems Inc. | Electrophoretic cuff apparatus drug delivery system |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6316652B1 (en) | 1995-06-06 | 2001-11-13 | Kosta Steliou | Drug mitochondrial targeting agents |
| US6167301A (en) | 1995-08-29 | 2000-12-26 | Flower; Ronald J. | Iontophoretic drug delivery device having high-efficiency DC-to-DC energy conversion circuit |
| WO1997013844A1 (en) | 1995-10-06 | 1997-04-17 | Cambridge Antibody Technology Limited | Specific binding members for human transforming growth factor beta; materials and methods |
| US5989830A (en) | 1995-10-16 | 1999-11-23 | Unilever Patent Holdings Bv | Bifunctional or bivalent antibody fragment analogue |
| US6039975A (en) | 1995-10-17 | 2000-03-21 | Hoffman-La Roche Inc. | Colon targeted delivery system |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US6253872B1 (en) | 1996-05-29 | 2001-07-03 | Gmundner Fertigteile Gesellschaft M.B.H & Co., Kg | Track soundproofing arrangement |
| US6150184A (en) | 1996-08-20 | 2000-11-21 | Ramtron International Corporation | Method of fabricating partially or completely encapsulated top electrode of a ferroelectric capacitor |
| US5985317A (en) | 1996-09-06 | 1999-11-16 | Theratech, Inc. | Pressure sensitive adhesive matrix patches for transdermal delivery of salts of pharmaceutical agents |
| US6139865A (en) | 1996-10-01 | 2000-10-31 | Eurand America, Inc. | Taste-masked microcapsule compositions and methods of manufacture |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US5860957A (en) | 1997-02-07 | 1999-01-19 | Sarcos, Inc. | Multipathway electronically-controlled drug delivery system |
| US6120751A (en) | 1997-03-21 | 2000-09-19 | Imarx Pharmaceutical Corp. | Charged lipids and uses for the same |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| US6060082A (en) | 1997-04-18 | 2000-05-09 | Massachusetts Institute Of Technology | Polymerized liposomes targeted to M cells and useful for oral or mucosal drug delivery |
| US7951917B1 (en) | 1997-05-02 | 2011-05-31 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US7183076B2 (en) | 1997-05-02 | 2007-02-27 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US5948433A (en) | 1997-08-21 | 1999-09-07 | Bertek, Inc. | Transdermal patch |
| US6267983B1 (en) | 1997-10-28 | 2001-07-31 | Bando Chemical Industries, Ltd. | Dermatological patch and process for producing thereof |
| US6048736A (en) | 1998-04-29 | 2000-04-11 | Kosak; Kenneth M. | Cyclodextrin polymers for carrying and releasing drugs |
| US6131570A (en) | 1998-06-30 | 2000-10-17 | Aradigm Corporation | Temperature controlling device for aerosol drug delivery |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6271359B1 (en) | 1999-04-14 | 2001-08-07 | Musc Foundation For Research Development | Tissue-specific and pathogen-specific toxic agents and ribozymes |
| US6256533B1 (en) | 1999-06-09 | 2001-07-03 | The Procter & Gamble Company | Apparatus and method for using an intracutaneous microneedle array |
| WO2001044301A1 (en) | 1999-11-29 | 2001-06-21 | Unilever Plc | Immobilized single domain antigen-binding molecules |
| US6261595B1 (en) | 2000-02-29 | 2001-07-17 | Zars, Inc. | Transdermal drug patch with attached pocket for controlled heating device |
| WO2002060919A2 (en) | 2000-12-12 | 2002-08-08 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| US20040014194A1 (en) | 2002-03-27 | 2004-01-22 | Schering Corporation | Beta-secretase crystals and methods for preparing and using the same |
| US20050048549A1 (en) | 2003-01-21 | 2005-03-03 | Liangxian Cao | Methods and agents for screening for compounds capable of modulating gene expression |
| US20050042664A1 (en) | 2003-08-22 | 2005-02-24 | Medimmune, Inc. | Humanization of antibodies |
| US20120135424A1 (en) * | 2004-11-24 | 2012-05-31 | The Regents Of The University Of Colorado, A Body Corporate | Mer diagnostic and therapeutic agents |
| US20100266604A1 (en) * | 2007-11-09 | 2010-10-21 | The Salk Institute For Biological Studies | Use of tam receptor inhibitors as immunoenhancers and tam activators as immunosuppressors |
| US8227577B2 (en) | 2007-12-21 | 2012-07-24 | Hoffman-La Roche Inc. | Bivalent, bispecific antibodies |
| US8586713B2 (en) | 2009-06-26 | 2013-11-19 | Regeneron Pharmaceuticals, Inc. | Readily isolated bispecific antibodies with native immunoglobulin format |
| US20130309243A1 (en) * | 2010-08-19 | 2013-11-21 | Howard Florey Institute | Tam receptors and tam receptor ligands in detection and modulation of neuropathological disease |
Non-Patent Citations (97)
| Title |
|---|
| "Current Protocols in Human Genetics", 1994, JOHN WILEY & SONS |
| "Current Protocols in Molecular Biology", 1993, JOHN WILEY & SONS |
| "DNA cloning", vol. 3, 1987, ACADEMIC PRESS |
| ALTSCHUL SF ET AL., J MOL BIOL, vol. 215, 1990, pages 403 |
| ALTSCHUL SF ET AL., NUC ACIDS RES, vol. 25, 1997, pages 3389 3402 |
| BACA M ET AL., J BIOL CHEM, vol. 272, no. 16, 1997, pages 10678 - 84 |
| BETTER M ET AL., SCIENCE, vol. 240, 1988, pages 1041 - 1043 |
| BITTER G ET AL., METHODS ENZYMOL., vol. 153, 1987, pages 516 - 544 |
| BRICOGNE G, ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 49, no. 1, 1993, pages 37 - 60 |
| BRINKMAN U ET AL., J IMMUNOL METHODS, vol. 184, 1995, pages 177 - 186 |
| BURTON DRBARBAS CF, ADVAN IMMUNOL, vol. 57, 1994, pages 191 - 280 |
| CALDAS C ET AL., PROTEIN ENG., vol. 13, no. 5, 2000, pages 353 - 60 |
| CHAYEN NE, STRUCTURE, vol. 5, 1997, pages 1269 - 1274 |
| CHEUNG RC ET AL., VIROLOGY, vol. 176, 1990, pages 546 - 52 |
| CHOTHIA ET AL., J MOL BIOL, vol. 196, 1987, pages 901 - 917 |
| CLACKSON T ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| COCKETT MI ET AL., BIOTECHNOLOGY, vol. 8, no. 7, 1990, pages 662 - 7 |
| COLBERE-GARAPIN F ET AL., J MOL BIOL, vol. 150, 1981, pages 1 - 14 |
| COUTO JR ET AL., CANCER RES, vol. 55, no. 8, 1995, pages 1717 - 22 |
| COUTO JR ET AL., CANCER RES., vol. 55, no. 23, 1995, pages 5973s - 5977s |
| CROUSE GF ET AL., MOL CELL BIOL, vol. 3, 1983, pages 257 - 66 |
| CUMMINGS CT ET AL., CLIN CANCER RES, vol. 19, 2013, pages 5275 - 5280 |
| FOECKING MKHOFSTETTER H, GENE, vol. 45, 1986, pages 101 - 5 |
| GIEGE R ET AL., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 50, no. 4, 1994, pages 339 - 350 |
| GILLIES SD ET AL., J IMMUNOL METHODS, vol. 125, 1989, pages 191 - 202 |
| GREENSPAN NSBONA CA, FASEB J, vol. 7, no. 5, 1989, pages 437 - 444 |
| IMAI-NISHIYA H ET AL., BMC BIOTECHNOL., vol. 7, 2007, pages 84 |
| INOUYE SINOUYE M, NUC ACIDS RES, vol. 13, 1985, pages 3101 - 3109 |
| KARLIN SALTSCHUL SF, PNAS, vol. 87, 1990, pages 2264 - 2268 |
| KARLIN SALTSCHUL SF, PNAS, vol. 90, 1993, pages 5873 - 5877 |
| KETTLEBOROUGH CA ET AL., EUR J IMMUNOL, vol. 24, 1994, pages 952 - 958 |
| KIM SJHONG HJ, J MICROBIOL, vol. 45, 2007, pages 572 - 577 |
| KIRKLAND TN ET AL., J IMMUNOL, vol. 137, 1986, pages 3614 - 9 |
| KOHLER GMILSTEIN C: "Nature", vol. 256, 1975, pages: 495 |
| KRIEGLER M: "Gene Transfer and Expression, A Laboratory Manual", 1990, STOCKTON PRESS |
| KUROKI M ET AL., CANCER RES, vol. 50, 1990, pages 4872 - 4879 |
| KUROKI M ET AL., HYBRIDOMA, vol. 11, 1992, pages 391 - 407 |
| KUROKI M ET AL., IMMUNOL INVEST, vol. 21, 1992, pages 523 - 538 |
| KUTMEIER G ET AL., BIOTECHNIQUES, vol. 17, 1994, pages 242 - 6 |
| LIU J ET AL., EUR J MED CHEM, vol. 65, 2013, pages 83 - 93 |
| LOGAN JSHENK T, PNAS, vol. 81, no. 12, 1984, pages 3655 - 9 |
| LONBERG NHUSZAR D, INT REV IMMUNOL, vol. 13, 1995, pages 65 - 93 |
| LONGMORE GDSCHACHTER H, CARBOHYDR RES, vol. 100, 1982, pages 365 - 92 |
| LOWY I ET AL., CELL, vol. 22, no. 3, 1980, pages 817 - 23 |
| MACCALLUM RM ET AL., J MOL BIOL, vol. 5, 1996, pages 732 - 745 |
| MARTIN ACR ET AL., PNAS, vol. 86, 1989, pages 9268 - 9272 |
| MCPHERSON A, EUR J BIOCHEM, vol. 189, 1990, pages 1 - 23 |
| MCPHERSON A, J BIOL CHEM, vol. 251, 1976, pages 6300 - 6303 |
| MOLDENHAUER G ET AL., SCAND J IMMUNOL, vol. 32, 1990, pages 77 - 82 |
| MOREA V ET AL., METHODS, vol. 20, no. 3, 2000, pages 267 - 79 |
| MOREL GA ET AL., MOL IMMUNOL, vol. 25, no. 1, 1988, pages 7 - 15 |
| MORGAN RAANDERSON WF, ANN REV BIOCHEM, vol. 62, 1993, pages 191 - 217 |
| MORRISON SL, SCIENCE, vol. 229, 1985, pages 1202 - 7 |
| MULLIGAN RC, SCIENCE, vol. 260, 1993, pages 926 - 932 |
| MULLIGAN RCBERG P, PNAS, vol. 78, no. 4, 1981, pages 563 681 - 31 |
| MULLINAX RL ET AL., BIOTECHNIQUES, vol. 12, no. 6, 1992, pages 864 - 9 |
| MUYLDERMANS S, J BIOTECHNOL, vol. 74, no. 4, 2001, pages 277 - 302 |
| MYERSMILLER, CABIOS, vol. 4, 1988, pages 11 17 |
| NABEL GJFELGNER PL, TRENDS BIOTECHNOL, vol. 11, no. 5, 1993, pages 211 - 5 |
| NAGANAWA Y ET AL., HUMAN ANTIBODIES, vol. 14, 2005, pages 27 - 31 |
| NISSINOFF A, J IMMUNOL, vol. 147, no. 8, 1991, pages 2429 - 2438 |
| NUTTALL SD ET AL., CURR PHARM BIOTECHNOL, vol. 1, no. 3, 2000, pages 253 - 263 |
| OI VTMORRISON SL, BIOTECHNIQUES, vol. 4, 1986, pages 214 - 221 |
| PADLAN EA, MOL IMMUNOL, vol. 28, no. 4/5, 1991, pages 489 - 498 |
| PEDERSEN JT ET AL., J MOL BIOL, vol. 235, no. 3, 1994, pages 959 - 73 |
| PERSIC L ET AL., GENE, vol. 114 & 115, 1997, pages 361 - 423 |
| PNG KJ ET AL., NATURE, vol. 481, 2012, pages 190 - 194 |
| PRESTA ET AL., CANCER RES, vol. 57, 1997, pages 4593 - 4599 |
| RADER C ET AL., PNAS, vol. 95, 1998, pages 8910 - 8915 |
| RIECHMANN LMUYLDERMANS S, J IMMUNOL, vol. 231, 1999, pages 25 - 38 |
| ROGUSKA MA ET AL., PNAS, vol. 91, 1994, pages 969 - 973 |
| ROGUSKA MA ET AL., PROTEIN ENG, vol. 9, no. 10, 1996, pages 895 904 |
| ROVERSI P ET AL., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 56, no. 10, 2000, pages 1316 - 1323 |
| RUETHER UMUELLER-HILL B, EMBO J, vol. 2, 1983, pages 1791 - 1794 |
| SANDHU JS, GENE, vol. 150, no. 2, 1994, pages 409 - 10 |
| SANTERRE RF ET AL., GENE, vol. 30, no. 1-3, 1984, pages 147 - 56 |
| SATHER S ET AL., BLOOD, vol. 109, 2007, pages 1026 - 1033 |
| SATHER, S ET AL.: "A Soluble Form of the Mer Receptor Tyrosine Kinase Inhibits Macrophage Clearance of Apoptotic Cells and Platelet Aggregation.", BLOOD., vol. 109, no. 3, 1 February 2007 (2007-02-01), pages 1026 - 1033, XP002607364 * |
| SAWAI H ET AL., AM J REPROD IMMUNOL, vol. 34, 1995, pages 26 - 34 |
| See also references of EP3237450A4 |
| SHINMOTO H ET AL., CYTOTECHNOLOGY, vol. 46, 2004, pages 19 - 23 |
| SMITH P ET AL., PNAS, vol. 109, 2012, pages 6181 - 6186 |
| STAHLI C ET AL., METHODS ENZYMOL, vol. 9, 1983, pages 242 - 253 |
| STUDNICKA GM ET AL., PROT ENGINEERING, vol. 7, no. 6, 1994, pages 805 - 814 |
| SZYBALSKA EHSZYBALSKI W, PNAS, vol. 48, no. 12, 1962, pages 2026 - 2034 |
| TAN P ET AL., J IMMUNOL, vol. 169, 2002, pages 1119 - 25 |
| TOLSTOSHEV P, ANN REV PHARMACOL TOXICOL, vol. 32, 1993, pages 573 - 596 |
| VAN HEEKE GSCHUSTER SM, J BIOL CHEM, vol. 24, 1989, pages 5503 - 5509 |
| VERMA A ET AL., MOL CANCER THER, vol. 10, 2011, pages 1763 - 1773 |
| VERMA, A ET AL.: "Targeting Axl and Mer Kinases in Cancer.", MOLECULAR CANCER THERAPEUTICS., vol. 10, no. 10, October 2011 (2011-10-01), pages 1763 - 1773, XP055029657, DOI: doi:10.1158/1535-7163.MCT-11-0116 * |
| WAGENER C ET AL., J IMMUNOL METHODS, vol. 68, 1984, pages 269 - 274 |
| WAGENER C ET AL., J IMMUNOL, vol. 130, 1983, pages 2308 - 2315 |
| WIGLER M ET AL., CELL, vol. 11, no. 1, 1977, pages 223 - 32 |
| WIGLER M ET AL., PNAS, vol. 77, no. 6, 1980, pages 3567 - 70 |
| WU GYWU CH, BIOTHERAPY, vol. 3, 1991, pages 87 - 95 |
| ZAGORSKA ET AL., NATURE IMMUNOLOGY, vol. 15, 2014, pages 920 - 928 |
| ZAGORSKA, A ET AL.: "Diversification of TAM Receptor Function.", NATURE IMMUNOLOGY., vol. 15, no. 10, October 2014 (2014-10-01), pages 920 - 928, XP055460368 * |
Cited By (65)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3197495A4 (en) * | 2014-09-28 | 2018-08-29 | The Regents of The University of California | Modulation of stimulatory and non-stimulatory myeloid cells |
| US11325973B2 (en) | 2014-09-28 | 2022-05-10 | The Regents Of The University Of California | Modulation of stimulatory and non-stimulatory myeloid cells |
| US11225524B2 (en) | 2014-12-22 | 2022-01-18 | The Rockefeller University | Anti-MERTK agonistic antibodies and uses thereof |
| US12084504B2 (en) | 2016-06-27 | 2024-09-10 | Agomab Therapeutics | Anti-MET antibodies and uses thereof |
| US11098126B2 (en) | 2016-06-27 | 2021-08-24 | Agomab Therapeutics Bvba | Anti-MET antibodies and uses thereof |
| JP2020526584A (ja) * | 2017-06-28 | 2020-08-31 | ザ ロックフェラー ユニバーシティー | 抗mertkアゴニスト抗体−薬物コンジュゲートおよびその使用 |
| US11613588B2 (en) | 2017-06-28 | 2023-03-28 | The Rockefeller University | Anti-mertk agonistic antibodies and uses thereof |
| WO2019005756A1 (en) * | 2017-06-28 | 2019-01-03 | The Rockefeller University | CONJUGATES AGONIST ANTIBODY ANTI-MERTK-MEDICINE |
| US12162942B2 (en) | 2017-06-28 | 2024-12-10 | The Rockefeller University | Anti-MERTK agonistic antibodies and uses thereof |
| JP2023116554A (ja) * | 2017-06-28 | 2023-08-22 | ザ ロックフェラー ユニバーシティー | 抗mertkアゴニスト抗体-薬物コンジュゲートおよびその使用 |
| WO2019084307A1 (en) * | 2017-10-26 | 2019-05-02 | Celldex Therapeutics, Inc. | ANTI-MERTK ANTIBODIES AND METHODS OF USE |
| US12428481B2 (en) | 2017-12-12 | 2025-09-30 | Portsmouth Merger Sub Ii, Llc | Anti-TREM2 antibodies and related methods |
| US11505602B2 (en) | 2017-12-12 | 2022-11-22 | Pionyr Immunotherapeutics, Inc. | Anti-TREM2 antibodies and related methods |
| WO2019134927A1 (en) * | 2018-01-03 | 2019-07-11 | Agomab Therapeutics Bvba | Hgf-met agonist for use in the treatment of cancer and colorectal fibrosis |
| US11834507B2 (en) | 2018-01-03 | 2023-12-05 | Agomab Therapeutics | Anti-MET agonist antibody for use in the treatment of colorectal cancer |
| WO2019201970A1 (en) | 2018-04-19 | 2019-10-24 | University Of Copenhagen | A mertk ligand for adoptive t cell cancer therapy |
| US11730762B2 (en) | 2018-08-30 | 2023-08-22 | HCW Biologics, Inc. | Methods for stimulating proliferation or differentiation of an immune cell with a multi-chain chimeric polypeptide |
| US11672826B2 (en) | 2018-08-30 | 2023-06-13 | HCW Biologics, Inc. | Methods of treating aging-related disorders |
| US11884712B2 (en) | 2018-08-30 | 2024-01-30 | HCW Biologics, Inc. | Multi-chain chimeric polypeptides and uses thereof |
| US11987619B2 (en) | 2018-08-30 | 2024-05-21 | HCW Biologics, Inc. | Single-chain chimeric polypeptides and uses thereof |
| US12398186B2 (en) | 2018-08-30 | 2025-08-26 | Immunitybio, Inc. | Multi-chain chimeric polypeptides and uses thereof |
| EP4592314A2 (en) | 2018-08-30 | 2025-07-30 | ImmunityBio, Inc. | Single-chain and multi-chain chimeric polypeptides and uses thereof |
| WO2020047473A1 (en) | 2018-08-30 | 2020-03-05 | HCW Biologics, Inc. | Single-chain and multi-chain chimeric polypeptides and uses thereof |
| WO2020047299A1 (en) | 2018-08-30 | 2020-03-05 | HCW Biologics, Inc. | Multi-chain chimeric polypeptides and uses thereof |
| EP4659757A2 (en) | 2018-08-30 | 2025-12-10 | ImmunityBio, Inc. | Multi-chain chimeric polypeptides and uses thereof |
| US12018071B2 (en) | 2018-08-30 | 2024-06-25 | HCW Biologics, Inc. | Single-chain chimeric polypeptides and uses thereof |
| WO2020047333A1 (en) | 2018-08-30 | 2020-03-05 | HCW Biologics, Inc. | Single-chain chimeric polypeptides and uses thereof |
| WO2020047462A2 (en) | 2018-08-30 | 2020-03-05 | HCW Biologics, Inc. | Methods of treating aging-related disorders |
| US11401324B2 (en) | 2018-08-30 | 2022-08-02 | HCW Biologics, Inc. | Single-chain chimeric polypeptides and uses thereof |
| US12269854B2 (en) | 2018-08-30 | 2025-04-08 | Immunitybio, Inc. | Multi-chain chimeric polypeptides and uses thereof |
| US11518792B2 (en) | 2018-08-30 | 2022-12-06 | HCW Biologics, Inc. | Multi-chain chimeric polypeptides and uses thereof |
| WO2020076799A1 (en) | 2018-10-09 | 2020-04-16 | Bristol-Myers Squibb Company | Anti-mertk antibodies for treating cancer |
| WO2020176497A1 (en) | 2019-02-26 | 2020-09-03 | Rgenix, Inc. | High-affinity anti-mertk antibodies and uses thereof |
| JP2022522344A (ja) * | 2019-02-26 | 2022-04-18 | インスピアーナ, インコーポレイテッド | 高親和性抗mertk抗体およびその使用 |
| US11242407B2 (en) | 2019-02-26 | 2022-02-08 | Inspirna, Inc. | High-affinity anti-MERTK antibodies and uses thereof |
| CN113874081A (zh) * | 2019-02-26 | 2021-12-31 | 茵思博纳公司 | 高-亲和力抗-mertk抗体及其用途 |
| JP7668534B2 (ja) | 2019-02-26 | 2025-04-25 | インスピアーナ, インコーポレイテッド | 高親和性抗mertk抗体およびその使用 |
| EP4378958A3 (en) * | 2019-02-26 | 2024-09-04 | Inspirna, Inc. | High-affinity anti-mertk antibodies and uses thereof |
| US12281174B2 (en) | 2019-02-26 | 2025-04-22 | Inspirna, Inc. | High-affinity anti-MERTK antibodies and uses thereof |
| EP4378958A2 (en) | 2019-02-26 | 2024-06-05 | Inspirna, Inc. | High-affinity anti-mertk antibodies and uses thereof |
| WO2020214995A1 (en) * | 2019-04-19 | 2020-10-22 | Genentech, Inc. | Anti-mertk antibodies and their methods of use |
| US12479899B2 (en) | 2019-06-21 | 2025-11-25 | Immunitybio, Inc. | Multi-chain chimeric polypeptides and uses thereof |
| US11738052B2 (en) | 2019-06-21 | 2023-08-29 | HCW Biologics, Inc. | Multi-chain chimeric polypeptides and uses thereof |
| US11897968B2 (en) | 2019-12-13 | 2024-02-13 | Alector Llc | Anti-MerTK antibodies and methods of use thereof |
| WO2021119508A1 (en) | 2019-12-13 | 2021-06-17 | Alector Llc | Anti-mertk antibodies and methods of use thereof |
| WO2021142086A1 (en) | 2020-01-08 | 2021-07-15 | Synthis Therapeutics, Inc. | Alk5 inhibitor conjugates and uses thereof |
| WO2021163298A1 (en) | 2020-02-11 | 2021-08-19 | HCW Biologics, Inc. | Methods of activating regulatory t cells |
| US12398189B2 (en) | 2020-02-11 | 2025-08-26 | HCW Biologics, Inc. | Methods of activating regulatory T cells |
| WO2021163369A2 (en) | 2020-02-11 | 2021-08-19 | HCW Biologics, Inc. | Methods of treating age-related and inflammatory diseases |
| US12115191B2 (en) | 2020-02-11 | 2024-10-15 | Immunitybio, Inc. | Methods of treating age-related and inflammatory diseases |
| WO2021163299A1 (en) | 2020-02-11 | 2021-08-19 | HCW Biologics, Inc. | Chromatography resin and uses thereof |
| US12187763B2 (en) | 2020-02-11 | 2025-01-07 | Immunitybio, Inc. | Chromatography resin and uses thereof |
| WO2021202590A1 (en) | 2020-03-31 | 2021-10-07 | Alector Llc | Anti-mertk antibodies and methods of use thereof |
| WO2021222587A1 (en) | 2020-04-29 | 2021-11-04 | HCW Biologics, Inc. | Anti-cd26 proteins and uses thereof |
| US12497462B2 (en) | 2020-04-29 | 2025-12-16 | Immunitybio, Inc. | Anti-CD26 proteins and uses thereof |
| WO2021247003A1 (en) | 2020-06-01 | 2021-12-09 | HCW Biologics, Inc. | Methods of treating aging-related disorders |
| WO2021247604A1 (en) | 2020-06-01 | 2021-12-09 | HCW Biologics, Inc. | Methods of treating aging-related disorders |
| US12024545B2 (en) | 2020-06-01 | 2024-07-02 | HCW Biologics, Inc. | Methods of treating aging-related disorders |
| US12384822B2 (en) | 2021-01-29 | 2025-08-12 | Illimis Therapeutics, Inc. | TAM receptor-binding fusion molecule having non-inflammatory phagocytosis inducing activity |
| EP4337679A4 (en) * | 2021-05-14 | 2025-03-26 | Inspirna, Inc. | MERTK PEPTIDES AND THEIR USES |
| WO2022241212A3 (en) * | 2021-05-14 | 2023-04-06 | Inspirna, Inc. | Mertk peptides and uses thereof |
| WO2022266223A1 (en) | 2021-06-16 | 2022-12-22 | Alector Llc | Bispecific anti-mertk and anti-pdl1 antibodies and methods of use thereof |
| WO2022266221A1 (en) | 2021-06-16 | 2022-12-22 | Alector Llc | Monovalent anti-mertk antibodies and methods of use thereof |
| WO2023168363A1 (en) | 2022-03-02 | 2023-09-07 | HCW Biologics, Inc. | Method of treating pancreatic cancer |
| US12509494B2 (en) | 2022-10-19 | 2025-12-30 | Immunitybio, Inc. | Multi-chain chimeric polypeptides and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP7211703B2 (ja) | 2023-01-24 |
| ES2862701T3 (es) | 2021-10-07 |
| EP3237450B1 (en) | 2021-03-03 |
| HK1245807A1 (en) | 2018-08-31 |
| JP2018504105A (ja) | 2018-02-15 |
| US11225524B2 (en) | 2022-01-18 |
| EP3789039A1 (en) | 2021-03-10 |
| CA2972048C (en) | 2023-03-07 |
| US20180002444A1 (en) | 2018-01-04 |
| EP3237450A1 (en) | 2017-11-01 |
| US20190241676A1 (en) | 2019-08-08 |
| EP3237450A4 (en) | 2018-09-12 |
| US10221248B2 (en) | 2019-03-05 |
| CA2972048A1 (en) | 2016-06-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11225524B2 (en) | Anti-MERTK agonistic antibodies and uses thereof | |
| US12162942B2 (en) | Anti-MERTK agonistic antibodies and uses thereof | |
| US12281174B2 (en) | High-affinity anti-MERTK antibodies and uses thereof | |
| US11446401B2 (en) | Actinium-225 and checkpoint inhibitor combination therapy | |
| AU2018261888B2 (en) | Pharmacokinetic enhancements of bifunctional chelates and uses thereof | |
| EP4351582B1 (en) | Combination of a particular braf inhibitor (paradox breaker) and a pd-1 axis binding antagonist for use in the treatment of cancer | |
| US20240285818A1 (en) | Radioimmunoconjugates and checkpoint inhibitor combination therapy | |
| HK40047348A (en) | Anti-mertk agonistic antibodies and uses thereof | |
| HK40110948A (en) | High-affinity anti-mertk antibodies and uses thereof | |
| HK1245807B (en) | Anti-mertk agonistic antibodies and uses thereof | |
| HK40063647A (en) | High-affinity anti-mertk antibodies and uses thereof | |
| HK40063647B (en) | High-affinity anti-mertk antibodies and uses thereof | |
| JP2022545687A (ja) | ポジオチニブとvegfr2阻害剤との組み合わせおよびその使用方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15874253 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2017533597 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2972048 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015874253 Country of ref document: EP |