WO2016090188A1 - Methods for treating myelodysplastic syndromes and sideroblastic anemias - Google Patents

Methods for treating myelodysplastic syndromes and sideroblastic anemias Download PDF

Info

Publication number
WO2016090188A1
WO2016090188A1 PCT/US2015/063835 US2015063835W WO2016090188A1 WO 2016090188 A1 WO2016090188 A1 WO 2016090188A1 US 2015063835 W US2015063835 W US 2015063835W WO 2016090188 A1 WO2016090188 A1 WO 2016090188A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
acid sequence
polypeptide
seq
subject
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/063835
Other languages
English (en)
French (fr)
Inventor
Kenneth M. Attie
Christopher Robert ROVALDI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Acceleron Pharma Inc
Original Assignee
Acceleron Pharma Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=56092498&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2016090188(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to JP2017529349A priority Critical patent/JP6737786B2/ja
Priority to KR1020177017082A priority patent/KR102603899B1/ko
Priority to EP15865103.4A priority patent/EP3226887B1/en
Priority to HK18106801.6A priority patent/HK1247115A1/zh
Priority to CA2969413A priority patent/CA2969413C/en
Application filed by Acceleron Pharma Inc filed Critical Acceleron Pharma Inc
Priority to CN201580075439.3A priority patent/CN107405383A/zh
Priority to AU2015358398A priority patent/AU2015358398B2/en
Publication of WO2016090188A1 publication Critical patent/WO2016090188A1/en
Anticipated expiration legal-status Critical
Priority to AU2021290319A priority patent/AU2021290319A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/18Erythrocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/179Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • A61K38/1816Erythropoietin [EPO]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • C07K14/495Transforming growth factor [TGF]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/106Pharmacogenomics, i.e. genetic variability in individual responses to drugs and drug metabolism
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/156Polymorphic or mutational markers

Definitions

  • the present disclosure relates to treatments for dysregulated production of blood cellular components, including red blood cells, neutrophils, and platelets.
  • Hematopoiesis is the formation of cellular components of the blood from self-renewing hematopoietic stem cells located mainly in the bone marrow, spleen, or lymph nodes during postnatal life. Blood cells can be classified as belonging to the lymphocytic lineage, myelocytic lineage, or erythroid lineage. By a process known as lymphopoiesis, common lymphoid progenitor cells give rise to T-cells, B-cells, natural killer cells, and dendritic cells.
  • myelopoiesis By a process termed myelopoiesis, common myeloid progenitor cells give rise to macrophages, granulocytes (basophils, neutrophils, eosinophils, and mast cells), and thrombocytes (platelets). Finally, by a process known as erythropoiesis, erythroid progenitor cells give rise to red blood cells (RBC, erythrocytes).
  • RBC red blood cells
  • Postnatal erythropoiesis occurs primarily in the bone marrow and in the red pulp of the spleen.
  • the coordinated action of various signaling pathways controls the balance of cell proliferation, differentiation, survival, and death.
  • red blood cells are produced at a rate that maintains a constant red cell mass in the body, and production may increase or decrease in response to various stimuli, including increased or decreased oxygen tension or tissue demand.
  • the process of erythropoiesis begins with the formation of lineage- committed precursor cells and proceeds through a series of distinct precursor cell types. The final stages of erythropoiesis occur as reticulocytes are released into the bloodstream and lose their mitochondria and ribosomes while assuming the morphology of mature red blood cell.
  • red blood cell production rates An elevated level of reticulocytes, or an elevated reticulocyte: erythrocyte ratio, in the blood is indicative of increased red blood cell production rates.
  • the mature red blood cell (RBC) is responsible for oxygen transport in the circulatory systems of vertebrates. Red blood cells contain high concentrations of hemoglobin, a protein that binds to oxygen in the lungs at relatively high partial pressure of oxygen (p0 2 ) and delivers oxygen to areas of the body with relatively low p0 2 .
  • EPO Erythropoietin
  • Erythropoietin is widely recognized as a significant positive regulator of postnatal erythropoiesis in vertebrates. EPO regulates the compensatory erythropoietic response to reduced tissue oxygen tension (hypoxia) and low red blood cell levels or low hemoglobin levels. In humans, elevated EPO levels promote red blood cell formation by stimulating the generation of erythroid progenitors in the bone marrow and spleen. In the mouse, EPO enhances erythropoiesis primarily in the spleen. Effects of EPO are mediated by a cell-surface receptor belonging to the cytokine receptor superfamily. The human EPO receptor gene encodes a 483 amino acid
  • EPO receptor the active EPO receptor is thought to exist as a multimeric complex even in the absence of ligand (see, e.g., U.S. Pat. No. 6,319,499).
  • the cloned full- length EPO receptor expressed in mammalian cells binds EPO with an affinity similar to that of the native receptor on erythroid progenitor cells. Binding of EPO to its receptor causes a conformational change resulting in receptor activation and biological effects including increased proliferation of immature erythroblasts, increased differentiation of immature erythroblasts, and decreased apoptosis in erythroid progenitor cells [see, e.g., Liboi et al.
  • EPO Errorless blood cell
  • Anemia is a broadly-defined condition characterized by lower than normal levels of hemoglobin or red blood cells in the blood.
  • anemia is caused by a primary disorder in the production or survival of red blood cells ⁇ e.g., myelodysplasia syndromes). More commonly, anemia is secondary to diseases of other systems [see, e.g. , Weatherall & Provan (2000)
  • Anemia may result from a reduced rate of production or increased rate of destruction of red blood cells or by loss of red blood cells due to bleeding.
  • Anemia may result from a variety of disorders that include, for example, acute or chronic renal failure or end stage renal disease, chemotherapy treatment, a myelodysplastic syndrome, rheumatoid arthritis, and bone marrow transplantation.
  • EPO Errorless blood cell
  • Treatment with EPO typically causes a rise in hemoglobin by about 1-3 g/dL in healthy humans over a period of weeks. When administered to anemic individuals, this treatment regimen often provides substantial increases in hemoglobin and red blood cell levels and leads to improvements in quality of life and prolonged survival.
  • EPO is not uniformly effective, and many individuals are refractory to even high doses [see, e.g. , Horl et al. (2000) Nephrol Dial Transplant 15, 43-50]. For example, over 50% of patients with cancer have an inadequate response to EPO, and approximately 10% with end- stage renal disease are hyporesponsive to EPO [see, e.g., Glaspy et al. (1997) J Clin Oncol 15, 1218-1234; Demetri et al.
  • EPO-based therapeutic compounds e.g., erythropoietin-stimulating agents, ESAs
  • ESAs erythropoietin-stimulating agents
  • erythroblasts can be identified by the presence of perinuclear siderotic granules, which are revealed by histologic staining with Prussian blue and are indicative of pathologic iron deposits in mitochondria [see, e.g., Mufti et al. (2008)
  • MDS myelodysplasia syndromes
  • hematopoietic stem-cell disorders estimated to affect between 30,000 and 40,000 patients per year in the United States [Bejar et al. (2014) Blood 124:2793-2803]. These disorders are characterized by ineffective hematopoiesis, abnormal "dysplastic" cell morphology, and the potential for clonal evolution to acute myeloid leukemia. As discussed below, recent advances in the genetic basis of MDS have the potential to greatly improve its diagnosis and treatment. There is high unmet need for effective therapies for MDS, sideroblastic anemia and complications of those disorders.
  • EPO levels are commonly elevated in subsets of patients with MDS, thus suggesting that EPO has diminished effectiveness in these patients. It has been estimated that fewer than 10% of patients with MDS respond favorably to EPO [Estey (2003) Curr Opin Hematol 10, 60-67], while a more recent meta-analysis found that EPO response rates range from 30% to 60% depending on the study [Moyo et al (2008) Ann Hematol 87:527-536].
  • the disclosure provides methods of treating MDS and sideroblastic anemias, particularly treating or preventing one or more complications or subtypes of MDS, including MDS patients characterized by the presence of sideroblasts in the bone marrow, with one or more ActRII antagonists.
  • the disclosure provides methods for treating or preventing disorders or complications of a disorder that is associated with germ line or somatic mutations in SF3B1, such as myelodysplasia syndrome (MDS), chronic lymphocytic leukemia (CLL), and acute myeloid leukemia (AML) as well as in breast cancer, pancreatic cancer, gastric cancer, prostate cancer, and uveal melanoma with one or more ActRII antagonists.
  • MDS myelodysplasia syndrome
  • CLL chronic lymphocytic leukemia
  • AML acute myeloid leukemia
  • the disorder may be in a subject that has bone marrow cells that test positive for an SF3B1 mutation, particularly myelodysplasia syndrome, CLL and AML.
  • a mutation in the SF3B1 gene is in an exon, intron or 5' and/or 3' untranslated region.
  • a mutation in the SF3B1 gene is in exon 14, 15, and/or 16 of SF31B.
  • a mutation in SF3B1 causes a change in the amino acid sequence or does not cause a change in the amino acid sequence of the protein encoded by the gene.
  • a mutation in the SF3B1 gene causes a change in the amino acid of the protein encoded by the gene selected from the following changes: K182E, E491G, R590K, E592K, R625C, R625G, N626D, N626S, H662Y, T663A, K666M, K666Q, K666R, Q670E, G676D, V701I, I704N, I704V, G740R, A744P, D781G, Al 188V, N619K, N626H, N626Y, R630S, I704T, G740E, K741N, G742D, D894G, Q903R, R1041H, I1241T, G347V, E622D, Y623C, R625H, R625L, H662D, H662Q, T663I, K666E, K666N,
  • the disclosure provides methods for treating or preventing sideroblastic anemia in a human subject, comprising administering to a subject in need thereof a polypeptide comprising an amino acid sequence that is at least 70%, 75%>, 80%>, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 29-109 of SEQ ID NO: 1, wherein the polypeptide comprises an acidic amino acid [a naturally occurring amino acid (e.g., D or E) or an artificial amino acid] at position 79 with respect to SEQ ID NO: 1, wherein the subject is on a dosing schedule that comprising administering from 0.125 to 1.75 mg/kg (e.g., 0.75 to 1.75 mg/kg) of the polypeptide to the subject.
  • a dosing schedule comprising administering from 0.125 to 1.75 mg/kg (e.g., 0.75 to 1.75 mg/kg) of the polypeptide to the subject.
  • the disclosure provides methods for treating or preventing sideroblastic anemia in a human subject, comprising administering to a subject in need thereof a polypeptide comprising an amino acid sequence that is at least 70%>, 75%>, 80%>, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 25-125 of SEQ ID NO: 1, wherein the polypeptide comprises an acidic amino acid [a naturally occurring amino acid (e.g., D or E) or an artificial amino acid] at position 79 with respect to SEQ ID NO: 1, wherein the subject is on a dosing schedule that comprising administering from 0.125 to 1.75 mg/kg (e.g., 0.75 to 1.75 mg/kg) of the polypeptide to the subject.
  • a dosing schedule comprising administering from 0.125 to 1.75 mg/kg (e.g., 0.75 to 1.75 mg/kg) of the polypeptide to the subject.
  • the disclosure provides methods for treating or preventing sideroblastic anemia in a human subject, comprising administering to a subject in need thereof a polypeptide comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 44, wherein the polypeptide comprises an acidic amino acid [a naturally occurring amino acid (e.g., D or E) or an artificial amino acid] at position 79 with respect to SEQ ID NO: 1, wherein the subject is on a dosing schedule that comprising administering from 0.125 to 1.75 mg/kg (e.g., 0.75 to 1.75 mg/kg) of the polypeptide to the subject.
  • the disclosure provides methods for treating or preventing one or more complications of sideroblastic anemia in a human subject, comprising administering to a subject in
  • polypeptide comprising an amino acid sequence that is at least 70%>, 75%>, 80%>, 85%>, 90%>, 91 >, 92%>, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 29-109 of SEQ ID NO: 1, wherein the polypeptide comprises an acidic amino acid [a naturally occurring amino acid (e.g., D or E) or an artificial amino acid] at position 79 with respect to SEQ ID NO: 1, wherein the subject is on a dosing schedule that comprising administering from 0.125 to 1.75 mg/kg (e.g., 0.75 to 1.75 mg/kg) of the polypeptide to the subject.
  • a dosing schedule comprising administering from 0.125 to 1.75 mg/kg (e.g., 0.75 to 1.75 mg/kg) of the polypeptide to the subject.
  • the disclosure provides methods for treating or preventing and/or one or more complications of sideroblastic anemia in a human subject, comprising administering to a subject in need thereof a polypeptide comprising an amino acid sequence that is at least 70%, 75%, 80%>, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 25-125 of SEQ ID NO: 1, wherein the polypeptide comprises an acidic amino acid [a naturally occurring amino acid (e.g., D or E) or an artificial amino acid] at position 79 with respect to SEQ ID NO: 1, wherein the subject is on a dosing schedule that comprising administering from 0.125 to 1.75 mg/kg (e.g., 0.75 to 1.75 mg/kg) of the polypeptide to the subject.
  • a polypeptide comprising an amino acid sequence that is at least 70%, 75%, 80%>, 85%, 90%, 91%, 92%, 93%, 94%, 95%
  • the disclosure provides methods for treating or preventing and/or one or more complications of sideroblastic anemia in a human subject, comprising administering to a subject in need thereof a polypeptide comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 70%>, 75%, 80%>, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 44, wherein the polypeptide comprises an acidic amino acid [a naturally occurring amino acid (e.g., D or E) or an artificial amino acid] at position 79 with respect to SEQ ID NO: 1, wherein the subject is on a dosing schedule that comprising administering from 0.125 to 1.75 mg/kg (e.g., 0.75 to 1.75 mg/kg) of the polypeptide to the subject.
  • a polypeptide comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 70%>, 75%
  • polypeptides to be used in accordance with the methods described herein are dimers (e.g., a homodimer comprising two polypeptides corresponding to the amino acid sequence of SEQ ID NO: 44 associated by covalent or non-covalent interactions).
  • the polypeptide may bind to one or more ligand of the TGFP superfamily.
  • polypeptides described herein e.g.,
  • ActRIIA and ActRIIB polypeptides as well as variant thereof such as GDF traps may bind to GDF11.
  • polypeptides described herein e.g., ActRIIA and ActRIIB polypeptides as well as variant thereof such as GDF traps
  • polypeptides described herein e.g., ActRIIA and ActRIIB polypeptides as well as variant thereof such as GDF traps
  • the polypeptide may comprises one or more amino acid modifications selected from: a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, and an amino acid conjugated to a lipid moiety.
  • the polypeptide is glycosylated and has a mammalian glycosylation pattern.
  • the polypeptide has a glycosylation pattern obtainable from a Chinese hamster ovary cell line.
  • the methods comprises subcutaneously administered the polypeptide to the subject.
  • the dosing schedule further comprises administering the polypeptide to the patient twice every week, once every week, once every 3 weeks, once every 4 weeks, once every 5 weeks, once every 6 weeks, once every 7 weeks, once every 8 weeks, once every 9 weeks, once every 10 weeks, once every 12 weeks, once every 14 weeks, once every 16 weeks, once every 18 weeks, once every 20 weeks, once every 24 weeks, once every 26 weeks, once every 28 weeks, once every 30 weeks, once every 32 weeks, once every 34 weeks, or once every 36 weeks
  • the dosing schedule further comprises administering the polypeptide to the patient once every three weeks.
  • the subject has undesirably high levels of endogenous EPO.
  • the subject has previously been treated with one or more EPO receptor agonists.
  • the subject has an inadequate response to the EPO receptor agonist.
  • the subject is no longer responsive to the EPO receptor agonist.
  • the EPO receptor agonist is EPO.
  • the treatment increases red blood cell levels.
  • the treatment increases hemoglobin levels.
  • the treatment results in a hemoglobin increase of > 1.5 g/dL for > two weeks.
  • the treatment results in a hemoglobin increase of > 1.5 g/dL for > eight weeks.
  • the subject has been administered one or more blood cell transfusions prior to the start of treatment.
  • the subject is a low transfusion burden subject.
  • the subject is a high transfusion burden subject.
  • the treatment decreases blood cell transfusion burden.
  • the treatment decreases blood cell transfusion by > 50% for at least four weeks relative to the equal time prior to start of treatment.
  • the treatment decreases blood cell transfusion by > 50%> for at least eight weeks relative to the equal time prior to start of treatment.
  • the patient has myelodysplasia syndrome.
  • the patient has an International Prognostic Scoring System (IPSS) or IPSS-R score of low or intermediate.
  • IPSS International Prognostic Scoring System
  • IPSS-R score of low or intermediate.
  • the sideroblastic anemia subject has at least 5%>, 6%>, 7%>, 8%>, 9%>, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% ring blasts as a percentage of bone marrow erythroid precursors in his or her bone marrow.
  • the treatment increases neutrophil levels.
  • the subject has bone marrow cells that test positive for one or more mutations in SF3B 1.
  • the subject has bone marrow cells that test positive for one or more mutations in DNMT3A.
  • the subject has bone marrow cells that test positive for one or more mutations in TET2.
  • the treatment decreases iron overload.
  • the treatment decrease tissue iron overload (e.g., iron overload in the kidney, liver, and/or spleen).
  • the treatment decrease serum iron overload.
  • the disclosure provides methods for treating or preventing disorders or complications of a disorder that is associated with germ line or somatic mutations in
  • DNMT3A such as myelodysplasia syndrome (MDS), chronic lymphocytic leukemia (CLL), and acute myeloid leukemia (AML) with one or more ActRII antagonists.
  • MDS myelodysplasia syndrome
  • CLL chronic lymphocytic leukemia
  • AML acute myeloid leukemia
  • the disorder may be in a subject that has bone marrow cells that test positive for a DNMT3A mutation, particularly myelodysplasia syndrome, CLL and AML.
  • a mutation in the DNMT3A gene is in an exon, intron and/or 5' or 3' untranslated region.
  • a mutation in the DNMT3A gene is in exon 10, 18, and/or 22 of
  • DNMT3A DNMT3A.
  • a mutation in DNMT3A causes a change in the amino acid sequence or does not cause a change in the amino acid sequence of the protein encoded by the gene.
  • a mutation in the DNMT3A gene causes a change in the amino acid of the protein encoded by the gene selected from the following changes: R882C, R882H, P904L, and
  • a mutation in the DNMT3A gene introduces a premature stop codon.
  • a mutation in the DNMT3A gene that introduces a premature stop codon is selected from the following positions: Y436X and W893X.
  • the disclosure provides methods for treating or preventing disorders or complications of a disorder that is associated with germ line or somatic mutations in TET2, such as myelodysplasia syndrome (MDS), chronic lymphocytic leukemia (CLL), and acute myeloid leukemia (AML) with one or more ActRII antagonists.
  • MDS myelodysplasia syndrome
  • CLL chronic lymphocytic leukemia
  • AML acute myeloid leukemia
  • the disorder may be in a subject that has bone marrow cells that test positive for a TET2 mutation, particularly myelodysplasia syndrome, CLL and AML.
  • a mutation in the TET2 gene is in an exon, intron and/or 5' or 3' untranslated region.
  • a mutation in the TET2 gene is in exon 1, exon 4, exon 5, exon 6, exon 7, exon 8, and/or exon 9 of TET2.
  • a mutation in TET2 causes a change in the amino acid sequence or does not cause a change in the amino acid sequence of the protein encoded by the gene.
  • a mutation in the TET2 gene causes a change in the amino acid of the protein encoded by the gene selected from the following changes: E47Q, Q1274R, W1291R, G1370R, N1387S, and Y1724H.
  • a mutation in the TET2 gene introduces a premature stop codon.
  • a mutation in the TET2 gene that introduces a premature stop codon is selected from the following positions: R550X, Q1009X, Y1337X, R1404X, R1516X, and Q1652X.
  • the disclosure provides methods for treating or preventing a bone marrow disorder in a subject, comprising administering to a subject in need thereof an effective amount of an ActRII antagonist, wherein the subject has bone marrow cells that test positive for one or more mutations in a gene selected from the group consisting of: SF3B1, DNMT3A, and TET2.
  • the subject tests positive for one or more SF3B1 mutations.
  • one or more of the SF3B1 mutations are in a SF3B1 exon.
  • one or more of the SF3B1 mutations are in a SF3B1 intron.
  • one or more of the SF3B1 mutations are in a SF3B1 5' and/or 3' region.
  • one or more of the SF3B1 mutations causes a deletion, addition, and/or substitution of an amino acid in the protein encoded by the mutated SF3B1 gene.
  • one or more SF3B1 mutations causes a substitution of one or more amino acid selected from the group consisting of: K182E, E491G, R590K, E592K, R625C, R625G, N626D, N626S, H662Y, T663A, K666M, K666Q, K666R, Q670E, G676D, V701I, I704N, I704V, G740R, A744P, D781G, Al 188V, N619K, N626H, N626Y, R630S, I704T, G740E, K741N, G742D, D894G, Q903R, R1041H, I1241T, G347V, E622D, Y623C, R625H, R625L, H662D, H662Q, T663I, K666E, K666N, K666T,
  • one or more SF3B1 mutations are in a SF3B1 exon selected from the group consisting of: exon 14, exon 15 and exon 16.
  • the subject tests positive for one or more DNMT3A mutations.
  • one or more of the DNMT3 A mutations are in a DNMT3 A exon.
  • one or more of the DNMT3 A mutations are in a DNMT3 A intron.
  • one or more of the DNMT3 A mutations are in a DNMT3A 5' and/or 3' region.
  • one or more of the DNMT3A mutations causes a deletion, addition, and/or substitution of an amino acid in the protein encoded by the mutated DNMT3A gene.
  • one or more DNMT3A mutations causes a substitution of one or more amino acid selected from the group consisting of: R882C, R882H, P904L, and P905P.
  • the one or more DNMT3A mutations are in a DNMT3A exon selected from the group consisting of: exon 10, exon 18 and exon 22.
  • one or more DNMT3A mutations are in a DNMT3A exon selected from the group consisting of: exon 10, exon 18 and exon 22.
  • DNMT3 A mutations introduces a premature stop codon.
  • one or more DNMT3 A mutations is selected from the group consisting of Y436X and W893X.
  • subject tests positive for one or more TET2 mutations are in a TET2 exon.
  • one or more of the TET2 mutations are in a TET2 intron.
  • one or more of the TET2 mutations are in a TET2 5' and/or 3' region.
  • one or more of the TET2 mutations causes a deletion, addition, and/or substitution of an amino acid in the protein encoded by the mutated TET2 gene.
  • one or more TET2 mutations causes a substitution of one or more amino acid selected from the group consisting of: E47Q, Q1274R, W1291R, G1370R, G1370E, N1387S, and Y1724H.
  • one or more TET2 mutations are in a TET2 exon selected from the group consisting of: exon 1, exon 4, exon 5, exon 6, exon 7, exon 8, and exon 9.
  • one or more TET2 mutations introduces a premature stop codon.
  • one or more TET2 mutations is selected from the group consisting of: R550X, Q1009X, Y1337X, R1404X, R1516X, and Q1652X.
  • the subject has anemia.
  • the subject has undesirably high levels of endogenous EPO.
  • the subject has previously been treated with one or more EPO receptor agonists.
  • the subject has an inadequate response to the EPO receptor agonist.
  • the subject is no longer responsive to the EPO receptor agonist.
  • the EPO receptor agonist is EPO.
  • the treatment delays conversion to leukemia.
  • the treatment delays conversion to acute myeloid leukemia.
  • the subject is a pre-leukemia patient.
  • the treatment increases red blood cell levels and/or hemoglobin levels in the subject.
  • the subject has been administered one or more blood cell transfusions prior to the start of the ActRII antagonist treatment.
  • the treatment decreases blood cell transfusion burden.
  • the treatment decreases blood cell transfusion by greater than about 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% for 4 to 8 weeks relative to the equal time prior to the start of the ActRII antagonist treatment.
  • the treatment decreases blood cell transfusion by greater than about 50% for 4 to 8 weeks relative to the equal time prior to the start of the ActRII antagonist treatment.
  • the treatment decreases iron overload.
  • the treatment decrease iron content in the liver and/or spleen.
  • the disclosure provides methods for treating or preventing myelodysplasia syndrome (MDS) and/or one or more complications of MDS, comprising administering to a subject in need thereof an effective amount of an ActRII antagonist, wherein the subject has bone marrow cells that test positive for one or more mutations in a gene selected from the group consisting of: SF3B1, DNMT3A, and TET2.
  • the subject tests positive for one or more SF3B1 mutations.
  • one or more of the mutations are in a SF3B1 exon.
  • one or more of the SF3B1 mutations are in a SF3B1 intron.
  • one or more of the SF3B1 mutations are in a SF3B1 5' and/or 3' region.
  • one or more of the SF3B1 mutations causes a deletion, addition, and/or substitution of an amino acid in the protein encoded by the mutated SF3B1 gene.
  • one or more SF3B1 mutations causes a substitution of one or more amino acid selected from the group consisting of: K182E, E491G, R590K, E592K, R625C, R625G, N626D, N626S, H662Y, T663A, K666M, K666Q, K666R, Q670E, G676D, V701I, I704N, I704V, G740R, A744P, D781G, Al 188V, N619K, N626H, N626Y, R630S, I704T, G740E, K741N, G742D, D894G, Q903R, R1041H, I1241T, G347V, E622D, Y623C, R625H, R625L, H662D, H662Q, T663I, K666E, K666N, K666T,
  • one or more SF3B1 mutations are in a SF3B1 exon selected from the group consisting of: exon 14, exon 14 and exon 16.
  • the subject tests positive for one or more DNMT3A mutations.
  • one or more of the DNMT3A mutations are in a DNMT3 A exon.
  • one or more of the DNMT3 A mutations are in a DNMT3 A intron.
  • one or more of the DNMT3A mutations are in a DNMT3A 5' and/or 3' region.
  • one or more of the DNMT3 A mutations causes a deletion, addition, and/or substitution of an amino acid in the protein encoded by the mutated DNMT3A gene.
  • one or more DNMT3 A mutations causes a substitution of one or more amino acid selected from the group consisting of: R882C, R882H, P904L, and P905P.
  • one or more DNMT3A mutations are in a DNMT3A exon selected from the group consisting of: exon 10, exon 18, and exon 22.
  • one or more DNMT3A mutations introduces a premature stop codon.
  • one or more DNMT3 A mutations are selected from the group consisting of Y436X and W893X.
  • the subject tests positive for one or more TET2 mutations.
  • one or more of the TET2 mutations are in a TET2 exon.
  • one or more of the TET2 mutations are in a TET2 intron.
  • one or more of the TET2 mutations are in a TET2 5' and/or 3' region.
  • one or more of the TET2 mutations causes a deletion, addition, and/or substitution of an amino acid in the protein encoded by the mutated TET2 gene.
  • one or more TET2 mutations causes a substitution of one or more amino acid selected from the group consisting of: E47Q, Q1274R, W1291R, G1370R, G1370E, N1387S, and Y1724H.
  • one or more TET2 mutations are in a TET2exon selected from the group consisting of: exon 1, exon 4, exon 5, exon 6, exon 7, exon 8, and exon 9.
  • one or more TET2 mutations introduces a premature stop codon.
  • one or more TET2 mutations is selected from the group consisting of: R550X, Q1009X, Y1337X, R1404X, R1516X, and Q1652X.
  • the subject has anemia.
  • the subject has undesirably high levels of endogenous EPO.
  • the subject has previously been treated with one or more EPO receptor agonists.
  • the subject has an inadequate response to the EPO receptor agonist.
  • the subject is no longer responsive to the EPO receptor agonist.
  • the EPO receptor agonist is EPO.
  • the treatment delays conversion to leukemia.
  • the treatment delays conversion to acute myeloid leukemia.
  • the treatment increases red blood cell levels and/or hemoglobin levels in the subject.
  • the subject has been administered one or more blood cell transfusions prior to the start of the ActRII antagonist treatment.
  • the treatment decreases blood cell transfusion burden.
  • the treatment decreases blood cell transfusion by greater than about 30%, 40%, 50%>, 60%>, 70%>, 80%, 90%, or 100% for 4 to 8 weeks relative to the equal time prior to the start of the ActRII antagonist treatment.
  • the treatment decreases blood cell transfusion by greater than about 50% for 4 to 8 weeks relative to the equal time prior to the start of the ActRII antagonist treatment.
  • the treatment decreases iron overload.
  • the treatment decrease iron content in the liver and/or spleen.
  • the subject has a subtype of MDS selected from: MDS with refractory anemia with ring sideroblasts (RARS); MDS with refractory anemia with ring sideroblasts and thrombocytosis (RARS-T); MDS with refractory cytopenia with unilineage dysplasia (RCUD); MDS with refractory cytopenia with multilineage dysplasia and ring sideroblasts (RCMD-RS); MDS with a somatic mutation in one or more of SF3B1, SRSF2, DNMT3A, and TET2; MDS without a somatic mutation in ASXL1 or ZRSR2; MDS with iron overload; and MDS with neutropenia.
  • RARS refractory anemia with ring sideroblasts
  • RARS-T MDS with refractory anemia with ring sideroblasts and thrombocytosis
  • RARS-T MDS with refractory cytopenia with unilineage dys
  • the subject has an International Prognostic Scoring System (IPSS) score selected from: low, intermediate 1, or intermediate 2.
  • IVS International Prognostic Scoring System
  • the subject has sideroblasts.
  • the subject has at least 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% sideroblasts as a percentage of bone marrow erythroid precursors in his or her bone marrow.
  • ActRII antagonists of the disclosure include, for example, agents that can inhibit
  • ActRII receptor e.g., an ActRIIA and/or ActRIIB receptor
  • a signal transduction pathway e.g., activation of signal transduction via intracellular mediators, such as SMAD 1, 2, 3, 5, and/or 8
  • agents that can inhibit one or more ActRII ligands e.g., activin A, activin B, activin AB, activin C, activin E, GDF11, GDF8, BMP6, BMP7, Nodal, etc.
  • agents that inhibit expression e.g.
  • an ActRII ligand and/or an ActRII receptor transcription, translation, cellular secretion, or combinations thereof
  • agents that can inhibit one or more intracellular mediators of the ActRII signaling pathway e.g., SMADs 1, 2, 3, 5, and/or 8.
  • the disclosure provides methods for using an ActRII antagonist, or combination of ActRII antagonists, to treat or prevent one or more complications of MDS and sideroblastic anemias including, for example, anemia, neutropenia, splenomegaly, blood transfusion requirement, development of acute myeloid leukemia, iron overload, and complications of iron overload, among which are congestive heart failure, cardiac arrhythmia, myocardial infarction, other forms of cardiac disease, diabetes mellitus, dyspnea, hepatic disease, and adverse effects of iron chelation therapy and as other examples, to increase red blood cell levels in a subject in need thereof, treat or prevent an anemia in a subject in need thereof (including, e.g., reduction of transfusion burden), treat MDS or sideroblastic anemias in a subject in need thereof, and/or treat or prevent one or more complications of MDS or sideroblastic anemias (e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myo
  • the disclosure provides methods for using an ActRII antagonist, or combination of ActRII antagonists, to treat or prevent complications in a subtype of MDS, including MDS patients with elevated numbers of erythroblasts (hypercellularity) in bone marrow; in MDS patients with more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% sideroblasts, as a percentage of erythroid precursors in bone marrow; in MDS patients with refractory anemia with ring sideroblasts (RARS); in MDS patients with refractory anemia with ring sideroblasts and thrombocytosis (RARS-T); in MDS patients with refractory cytopenia with un
  • the disclosure provides methods for using an ActRII antagonist, or combination of ActRII antagonists, to treat or prevent complications of a sideroblastic anemia, including refractory anemia with ring sideroblasts (RARS); refractory anemia with ring sideroblasts and thrombocytosis (RARS-T); refractory cytopenia with multilineage dysplasia and ring sideroblasts (RCMD-RS); sideroblastic anemia associated with alcoholism; drug- induced sideroblastic anemia; sideroblastic anemia resulting from copper deficiency (zinc toxicity); sideroblastic anemia resulting from hypothermia; X-linked sideroblastic anemia (XLS A); SLC25A38 deficiency; glutaredoxin 5 deficiency; erythropoietic protoporphyria; X- linked sideroblastic anemia with ataxia (XLSA/A); sideroblastic anemia with B-cell immunodefici
  • preferred ActRII antagonists to be used in accordance with the methods disclosed herein are agents that bind to and/or inhibit GDF11 and/or GDF8 (e.g., an agent that inhibits GDF11- and/or GDF8-mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • agents are referred to collectively as GDF-ActRII antagonists.
  • GDF-ActRII antagonists may further inhibit one or more of activin A, activin B, activin AB, activin C, activin E, GDF11, GDF8, BMP6, BMP7, and Nodal.
  • the disclosure provides methods of using one or more ActRII antagonists, including, for example, soluble ActRIIA polypeptides, soluble ActRIIB polypeptides, GDF trap polypeptides, anti-ActRIIA antibodies, anti-ActRIIB antibodies, anti- ActRII ligand antibodies (e.g, anti-GDFl l antibodies, anti-GDF8 antibodies, anti-activin A antibodies, anti-activin B antibodies, anti-activin AB antibodies, anti-activin C antibodies, anti-activin E antibodies, anti-BMP6 antibodies, anti-BMP7 antibodies, and anti- Nodal antibodies), small-molecule inhibitors of ActRIIA, small-molecule inhibitors of
  • ActRIIB small-molecule inhibitors of one or more ActRII ligands (e.g., activin A, activin B, activin AB, activin C, activin E, GDF11, GDF 8, BMP6, BMP7, Nodal, etc.), inhibitor nucleotides (nucleotide-based inhibitors) of ActRIIA, inhibitor nucleotides of ActRIIB, inhibitor nucleotides of one or more ActRII ligands (e.g., activin A, activin B, activin AB, activin C, activin E, GDF 11 , GDF 8, BMP6, BMP7, Nodal, etc.), or combinations thereof, to increase red blood cell levels and/or hemoglobin levels in a subject in need thereof, treat or prevent an anemia in a subject in need thereof, treat sideroblastic anemia or MDS in a subject in need thereof, or treat one or more complications of sideroblastic anemia or MDS in a subject in need thereof and as other examples
  • ActRII antagonists to be used in accordance with the methods disclosed herein do not substantially bind to and/or inhibit activin A ⁇ e.g., activin A-mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • an ActRII antagonist comprising a variant, extracellular (soluble) ActRIIB domain that binds to and inhibits GDF11 activity ⁇ e.g., GDF11 -mediated ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling) may be used to increase red blood cell levels in vivo, treat anemia resulting from various conditions/disorders, and treat sideroblastic anemia or MDS.
  • GDF11 activity e.g., GDF11 -mediated ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling
  • preferred ActRII antagonists to be used in accordance with the methods disclosed herein ⁇ e.g., methods of increase red blood cell levels in a subject in need thereof, treat or prevent an anemia in a subject in need thereof (including, e.g., reduction of transfusion burden), treat MDS or sideroblastic anemias in a subject in need thereof, and/or treat or prevent one or more complications of MDS or sideroblastic anemias ⁇ e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lymphoma) and or treat or prevent a disorder associatd with SF3B1 mutations in a subject in need thereof, etc.) are soluble ActRII polypeptides ⁇ e.g.
  • soluble ActRIIA or ActRIIB polypeptides that bind to and/or inhibit GDF11 ⁇ e.g., GDF11 -mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • GDF11 GDF11 -mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling.
  • soluble ActRIIA and soluble ActRIIB ActRII antagonists may affect red blood cell formation and/or morphology through a mechanism other than GDF11 antagonism, the disclosure nonetheless demonstrates that desirable therapeutic agents, with respect to the methods disclosed herein, may be selected on the basis of GDF1 1 antagonism or ActRII antagonism or both.
  • such soluble ActRII polypeptide antagonist may further bind to and/or inhibit GDF8 ⁇ e.g.
  • soluble ActRIIA and ActRIIB polypeptides of the disclosure that bind to and/or inhibit GDF11 and/or GDF8 may further bind to and/or inhibit one or more additional ActRII ligands selected from: activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, and Nodal.
  • the present disclosure provides GDF traps that are variant ActRII polypeptides (e.g., ActRIIA and ActRIIB polypeptides), including ActRII polypeptides having amino- and carboxy-terminal truncations and/or other sequence alterations (one or more amino acid substitutions, additions, deletions, or combinations thereof).
  • GDF traps of the invention may be designed to preferentially antagonize one or more ligands of ActRII receptors, such as GDF8 (also called myostatin), GDFl 1, Nodal, BMP6, and BMP7 (also called OP-1).
  • examples of GDF traps include a set of variants derived from ActRIIB that have greatly diminished affinity for activin, particularly activin A. These variants exhibit desirable effects on red blood cells while reducing effects on other tissues. Examples of such variants include those having an acidic amino acid [e.g., aspartic acid (D) or glutamic acid (E)] at the position corresponding to position 79 of SEQ ID NO: 1.
  • an acidic amino acid e.g., aspartic acid (D) or glutamic acid (E)
  • preferred GDF traps to be used in accordance with the methods disclosed herein bind to and/or inhibit GDFl 1.
  • MDS or sideroblastic anemias e.g., anemia, blood transfusion requirement, neutropenia
  • GDF traps may further bind to and/or inhibit GDF8.
  • GDF traps that bind to and/or inhibit GDFl 1 and/or GDF 8 may further bind to and/or inhibit one or more additional ActRII ligands (e.g., activin B, activin E, BMP6, BMP7, and Nodal).
  • additional ActRII ligands e.g., activin B, activin E, BMP6, BMP7, and Nodal
  • GDF traps to be used in accordance with the methods disclosed herein to not substantially bind to and/or inhibit activin A e.g., activin A-mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling.
  • a GDF trap polypeptide comprises an amino acid sequence that comprises, consists of, or consists essentially of, the amino acid sequence of SEQ ID NOs: 36, 37, 41, 44, 45, 50 or 51, and polypeptides that are at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to any of the foregoing.
  • a GDF trap polypeptide comprises an amino acid sequence that comprises, consists of, or consists essentially of the amino acid sequence of SEQ ID NOs: 2, 3, 4, 5, 6, 10, 11, 22, 26, 28, 29, 31, or 49, and polypeptides that are at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to any of the foregoing.
  • a GDF trap polypeptide comprises an amino acid sequence that comprises of the amino acid sequence of SEQ ID NOs: 2, 3, 4, 5, 6, 29, 31 , or 49, and polypeptides that are at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to any of the foregoing, wherein the position corresponding to 79 in SEQ ID NO: 1 , 4, or 50 is an acidic amino acid.
  • a GDF trap may include a functional fragment of a natural ActRII polypeptide, such as one comprising at least 10, 20, or 30 amino acids of a sequence selected from SEQ ID NOs: 1 , 2, 3, 4, 5, 6, 9, 10, 1 1 , or 49 or a sequence of SEQ ID NO: 2, 5, 10, 1 1 , or 49 lacking the C-terminal 1 , 2, 3, 4, 5 or 10 to 15 amino acids and lacking 1 , 2, 3, 4 or 5 amino acids at the N-terminus.
  • a preferred polypeptide will comprise a truncation relative to SEQ ID NO: 2 or 5 of between 2 and 5 amino acids at the N-terminus and no more than 3 amino acids at the C-terminus.
  • a preferred GDF trap for use in such a preparation consists of, or consists essentially of, the amino acid sequence of SEQ ID NO: 36.
  • a GDF trap comprising an altered ActRII ligand-binding domain has a ratio of IQ for activin A binding to Ka for GDF1 1 and/or GDF8 binding that is at least 2-, 5-, 10-, 20, 50-, 100-, or even 1000-fold greater relative to the ratio for the wild-type ligand- binding domain.
  • the GDF trap comprising an altered ligand-binding domain has a ratio of IC 50 for inhibiting activin A to IC 50 for inhibiting GDF1 1 and/or GDF8 that is at least 2-, 5-, 10-, 20-, 25- 50-, 100-, or even 1000-fold greater relative to the wild-type ActRII ligand-binding domain.
  • the GDF trap comprising an altered ligand-binding domain inhibits GDF1 1 and/or GDF8 with an IC 50 at least 2, 5, 10, 20, 50, or even 100 times less than the IC 50 for inhibiting activin A.
  • These GDF traps can be fusion proteins that include an immunoglobulin Fc domain (either wild-type or mutant).
  • the subject soluble GDF traps are antagonists (inhibitors) of GDF8 and/or GDF1 1.
  • the disclosure provides GDF traps which are soluble ActRIIB polypeptides comprising an altered ligand-binding (e.g., GDF 1 1 -binding) domain.
  • GDF traps with altered ligand-binding domains may comprise, for example, one or more mutations at amino acid residues such as E37, E39, R40, K55, R56, Y60, A64, K74, W78, L79, D80, F82 and F101 of human ActRIIB (numbering is relative to SEQ ID NO: 1).
  • the altered ligand-binding domain can have increased selectivity for a ligand such as
  • GDF8/GDF1 1 relative to a wild-type ligand-binding domain of an ActRIIB receptor.
  • these mutations are demonstrated herein to increase the selectivity of the altered ligand-binding domain for GDF1 1 (and therefore, presumably, GDF8) over activin: K74Y, K74F, K74I, L79D, L79E, and D80I.
  • the following mutations have the reverse effect, increasing the ratio of activin binding over GDF1 1 : D54A, K55A, L79A and F82A.
  • the overall (GDF1 1 and activin) binding activity can be increased by inclusion of the "tail" region or, presumably, an unstructured linker region, and also by use of a K74A mutation.
  • a GDF trap is an ActRIIB polypeptide comprising an L79D or L79E mutation, optionally in combination with additional amino acid substitutions, additions, or deletions.
  • ActRII antagonists to be used in accordance with the methods disclosed herein are ActRIIB polypeptides or ActRIIB-based GDF trap polypeptides.
  • ActRIIB polypeptides and ActRIIB-based GDF trap polypeptides are soluble polypeptides that comprise a portion/domain derived from the ActRIIB sequence of SEQ ID NO: 1 , 4, or 49, particularly an extracellular, ligand-binding portion/domain derived from the ActRIIB sequence of SEQ ID NO: l , 4, or 49.
  • the portion derived from ActRIIB corresponds to a sequence beginning at any one of amino acids 21 -29 (e.g., 21 , 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: l or 4 [optionally beginning at 22-25 (e.g., 22, 23, 24, or 25) of SEQ ID NO: l or 4] and ending at any one of amino acids 109-134 (e.g., 109, 1 10, 1 1 1 , 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, 133, or 134) of SEQ ID NO: 1 or 4.
  • amino acids 21 -29 e.g., 21 , 22, 23, 24, 25, 26, 27, 28, or 29
  • 109-134 e.g., 109, 1 10, 1 1 1 1 , 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121 ,
  • the portion derived from ActRIIB corresponds to a sequence beginning at any one of amino acids 20-29 (e.g., 20, 21 , 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 or 4 [optionally beginning at 22-25 (e.g., 22, 23, 24, or 25) of SEQ ID NO: l or 4] and ending at any one of amino acids 109-133 (e.g., 109, 1 10, 1 1 1 , 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, or 133) of SEQ ID NO: 1 or 4.
  • amino acids 20-29 e.g., 20, 21 , 22, 23, 24, 25, 26, 27, 28, or 29
  • SEQ ID NO: 1 or 4 [optionally beginning at 22-25 (e.g., 22, 23, 24, or 25) of SEQ ID NO: l or 4] and ending at any one of amino acids 109
  • the portion derived from ActRIIB corresponds to a sequence beginning at any one of amino acids 20-24 (e.g., 20, 21 , 22, 23, or 24) of SEQ ID NO: 1 or 4 [optionally beginning at 22-25 (e.g., 22, 23, 24, or 25) of SEQ ID NO: l or 4] and ending at any one of amino acids 109-133 (e.g., 109, 1 10, 1 1 1 , 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, or 133) of SEQ ID NO: 1 or 4.
  • amino acids 20-24 e.g., 20, 21 , 22, 23, or 24
  • 22-25 e.g., 22, 23, 24, or 25
  • amino acids 109-133 e.g., 109, 1 10, 1 1 1 1 , 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121 ,
  • the portion derived from ActRIIB corresponds to a sequence beginning at any one of amino acids 21-24 (e.g., 21 , 22, 23, or 24) of SEQ ID NO: 1 or 4 and ending at any of amino acids 109-134 (e.g. , 109, 1 10, 1 1 1 , 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, 133, or 134) of SEQ ID NO: 1 or 4.
  • the portion derived from ActRIIB corresponds to a sequence beginning at any one of amino acids 20-24 (e.g.
  • the portion derived from ActRIIB corresponds to a sequence beginning at any one of amino acids 21-24 (e.g., 21 , 22, 23, or 24) of SEQ ID NO: 1 or 4 and ending at any one of amino acids 1 18-134 (e.g., 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, or 134) of SEQ ID NO: 1 or 4.
  • the portion derived from ActRIIB corresponds to a sequence beginning at any one of amino acids 20-24 (e.g., 20, 21 , 22, 23, or 24) of SEQ ID NO: 1 or 4 and ending at any one of amino acids 128-133 (e.g. , 128, 129, 130, 131 , 132, or 133) of SEQ ID NO: 1 or 4.
  • the portion derived from ActRIIB corresponds to a sequence beginning at any of amino acids 20-24 (e.g. , 20, 21 , 22, 23, or 24) of SEQ ID NO: 1 or 39 and ending at any of amino acids 128-133 (e.g. , 128, 129,
  • the portion derived from ActRIIB corresponds to a sequence beginning at any one of amino acids 21 -29 (e.g. , 21 , 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 or 4 and ending at any one of amino acids 1 18-134 (e.g., 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, 133, or 134) of SEQ ID NO: 1 or 4.
  • amino acids 21 -29 e.g. , 21 , 22, 23, 24, 25, 26, 27, 28, or 29
  • amino acids 1 18-134 e.g., 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, 133, or 134
  • the portion derived from ActRIIB corresponds to a sequence beginning at any one of amino acids 20-29 (e.g., 20, 21 , 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 or 4 and ending at any one of amino acids 1 18-133 (e.g. , 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, or 133) of SEQ ID NO: 1 or 4.
  • amino acids 20-29 e.g., 20, 21 , 22, 23, 24, 25, 26, 27, 28, or 29
  • amino acids 1 18-133 e.g. , 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, or 133
  • the portion derived from ActRIIB corresponds to a sequence beginning at one any of amino acids 21-29 (e.g., 21 , 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 or 4 and ending at any one of amino acids 128-134 (e.g. , 128, 129, 130,
  • the portion derived from ActRIIB corresponds to a sequence beginning at any one of amino acids 20-29 (e.g. , 20, 21 , 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 or 4 and ending at any one of amino acids 128-133 (e.g. , 128, 129, 130, 131 , 132, or 133) of SEQ ID NO: 1 or 4.
  • ActRIIB polypeptides and ActRIIB-based GDF trap polypeptides comprise, consist essentially of, or consist of, an amino acid sequence beginning at amino acid position 25 of SEQ ID NO: 1 or 4 and ending at amino acid position 131 of SEQ ID NO: 1 or 4. Any of the foregoing ActRIIB
  • ActRIIB-based GDF trap polypeptides may be produced as a homodimer. Any of the foregoing ActRIIB polypeptides or ActRIIB-based GDF trap polypeptides may further comprise a heterologous portion that comprises a constant region from an IgG heavy chain, such as an Fc domain. Any of the above ActRIIB-based GDF trap polypeptides may comprise an acidic amino acid at the position corresponding to position 79 of SEQ ID NO: 1 , optionally in combination with one or more additional amino acid substitutions, deletions, or insertions relative to SEQ ID NO: 1.
  • any of the above ActRIIB polypeptides or ActRIIB- based GDF trap polypeptides, including homodimer and/or fusion proteins thereof, may bind to and/or inhibit signaling by activin (e.g., activin A, activin B, activin C, or activin AB) in a cell-based assay.
  • activin e.g., activin A, activin B, activin C, or activin AB
  • Any of the above ActRIIB polypeptides or ActRIIB-based GDF trap polypeptides, including homodimer and/or fusion proteins thereof, may bind to and/or inhibit signaling by GDF1 1 and/or GDF8 in a cell based assay.
  • any of the above ActRIIB polypeptides or ActRIIB-based GDF trap polypeptides, including homodimer and/or fusion proteins thereof may bind to and/or inhibit signaling by GDF1 1 and/or GDF8 in a cell based
  • ActRIIB polypeptides or ActRIIB-based GDF trap polypeptides may bind to and/or inhibit signaling of one or more of activin B, activin C, activin E, BMP6, BMP7, and Nodal in a cell-based assay.
  • ActRIIB polypeptides and ActRIIB-based GDF Trap polypeptides are contemplated, such as the following.
  • An ActRIIB polypeptide or GDF trap polypeptide comprising an amino acid sequence that is at least 80% (e.g., 85%, 90%, 95%, 96%>, 97%, 98%, 99%, or 100%) identical to the sequence of amino acids 29-109 of SEQ ID NO: 1 or 4, wherein the position corresponding to 64 of SEQ ID NO: 1 is an R or K, and wherein the ActRIIB polypeptide or ActRIIB-based GDF trap polypeptide inhibits signaling by activin, GDF8, and/or GDF1 1 in a cell-based assay.
  • ActRIIB polypeptide or ActRIIB-based GDF trap polypeptide as above, wherein at least one alteration with respect to the sequence of SEQ ID NO: 1 or 4 is an alteration at one or more positions selected from the group consisting of K74, R40, Q53, K55, F82, and L79.
  • Other ActRIIB polypeptides and ActRIIB-based GDF trap polypeptides are contemplated, such as the following.
  • An ActRIIB polypeptide or ActRIIB-based GDF trap polypeptide comprising an amino acid sequence that is at least 80% (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the sequence of amino acids 29-109 of SEQ ID NO: 1 or 4, and wherein the protein comprises at least one N-X-S/T sequence at a position other than an endogenous N-X-S/T sequence of ActRIIB, and at a position outside of the ligand binding pocket.
  • Any of the above ActRIIB polypeptides or ActRIIB-based GDF trap polypeptides, or fusion proteins thereof, may be produced as a homodimer.
  • Any of the above ActRIIB fusion proteins or ActRIIB-based GDF trap fusion proteins may have a heterologous portion that comprises a constant region from an IgG heavy chain, such as an Fc domain.
  • a preferred ActRIIB polypeptide for use in accordance with the methods disclosed herein, comprises an amino acid sequence that comprises, consists of, or consists essentially of, the amino acid sequence of SEQ ID NOs: 2, 3, 5, 6, 29, 31 , or 49, and polypeptides that are at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to any of the foregoing.
  • An ActRIIB polypeptide may include a functional fragment of a natural ActRIIB polypeptide, such as one comprising at least 10, 20 or 30 amino acids of a sequence selected from SEQ ID NOs: 2, 3, 5, 6, 29, 31 , or 49 or a sequence of SEQ ID NO: 2 or 5, lacking the C -terminal 1 , 2, 3, 4, 5 or 10 to 15 amino acids and lacking 1 , 2, 3, 4 or 5 amino acids at the N-terminus.
  • a preferred polypeptide will comprise a truncation relative to SEQ ID NO: 2 or 5 of between 2 and 5 amino acids at the N-terminus and no more than 3 amino acids at the C-terminus.
  • a preferred GDF trap for use in accordance with the methods described herein consists of, or consists essentially of, the amino acid sequence of SEQ ID NO:29.
  • ActRIIA polypeptide is one that comprises a polypeptide that starts at amino acid 30 and ends at amino acid 1 10 of SEQ ID NO:9. Accordingly, ActRIIA polypeptides and ActRIIA-based GDF traps of the present disclosure may comprise, consist, or consist essentially of a polypeptide that is at least 80%>, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 30-1 10 of SEQ ID NO:9.
  • ActRIIA polypeptides and ActRIIA-based GDF trap polypeptides of the present disclosure comprise, consists, or consist essentially of a polypeptide that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids amino acids 12-82 of SEQ ID NO:9 optionally beginning at a position ranging from 1-5 (e.g., 1 , 2, 3, 4, or 5) or 3-5 (e.g., 3, 4, or 5) and ending at a position ranging from 1 10-1 16 (e.g., 1 10, 1 1 1 , 1 12, 1 13, 1 14, 1 15, or 1 16) or 1 10-1 15 (e.g., 1 10, 1 1 1 , 1 12, 1 13, 1 14, or 1 15) or SEQ ID NO:9, respectively, and comprising no more than 1 , 2, 5, 10 or 15 conservative amino acid changes in the ligand binding pocket, and zero, one or more non-conservative alterations at positions 40, 53, 55, 74,
  • any of the foregoing ActRIIA polypeptides or ActRIIA-based GDF trap polypeptides may be produced as a homodimer. Any of the foregoing ActRIIA polypeptides or ActRIIA-based GDF trap polypeptides may further comprise a heterologous portion that comprises a constant region from an IgG heavy chain, such as an Fc domain. Any of the above ActRIIA polypeptides or ActRIIA-based GDF trap polypeptides, including homodimer and/or fusion proteins thereof, may bind to and/or inhibit signaling by activin (e.g., activin A, activin B, activin C, or activin AB) in a cell-based assay.
  • activin e.g., activin A, activin B, activin C, or activin AB
  • ActRIIA polypeptides or ActRIIA-based GDF trap polypeptides may bind to and/or inhibit signaling by GDF1 1 and/or GDF8 in a cell-based assay.
  • any of the above ActRIIA polypeptides or ActRIIB-based GDF trap polypeptides may bind to and/or inhibit signaling of one or more of activin B, activin C, activin E, GDF7, and Nodal in a cell-based assay.
  • preferred ActRIIA polypeptides and ActRIIA-based GDF- trap polypeptides for use in accordance with the methods disclosed herein, comprise an amino acid sequence that comprises, consists of, or consists essentially of, the amino acid sequence of SEQ ID NOs: 9, 10, 22, 26, or 28, and polypeptides that are at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to any of the foregoing.
  • An ActRIIA polypeptide or ActRIIA-based GDF-trap polypeptide may include a functional fragment of a natural ActRIIA polypeptide, such as one comprising at least 10, 20 or 30 amino acids of a sequence selected from SEQ ID NOs: 9, 10, 22, 26, or 28 or a sequence of SEQ ID NO: 10, lacking the C -terminal 1 , 2, 3, 4, 5 or 10 to 15 amino acids and lacking 1 , 2, 3, 4 or 5 amino acids at the N-terminus.
  • a preferred polypeptide will comprise a truncation relative to SEQ ID NO: 10 of between 2 and 5 amino acids at the N-terminus and no more than 3 amino acids at the C-terminus.
  • a preferred ActRIIA polypeptide for use in the methods described herein consists of, or consists essentially of, the amino acid sequence of SEQ ID NO: 26 or 28.
  • An ActRII polypeptide e.g. an ActRIIA or ActRIIB polypeptide
  • GDF trap polypeptide of the disclosure may include one or more alterations (e.g. , amino acid additions, deletions, substitutions, or combinations thereof) in the amino acid sequence of an ActRII polypeptide (e.g., in the ligand-binding domain) relative to a naturally occurring ActRII polypeptide.
  • the alteration in the amino acid sequence may, for example, alter glycosylation of the polypeptide when produced in a mammalian, insect, or other eukaryotic cell or alter proteolytic cleavage of the polypeptide relative to the naturally occurring ActRII polypeptide.
  • ActRII polypeptides e.g.
  • an ActRIIA or ActRIIB polypeptides and GDF trap polypeptides of the disclosure comprise one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, and an amino acid conjugated to an organic derivatizing agent.
  • an ActRII polypeptide e.g. an ActRIIA or ActRIIB
  • GDF trap polypeptide of the disclosure may be a fusion protein that has, as one domain, an ActRII polypeptide or GDF trap polypeptide (e.g., a ligand-binding domain of an ActRII receptor, optionally with one or more sequence variations) and one or more additional heterologous domains that provide a desirable property, such as improved pharmacokinetics, easier purification, targeting to particular tissues, etc.
  • a domain of a fusion protein may enhance one or more of in vivo stability, in vivo half-life, uptake/administration, tissue localization or distribution, formation of protein complexes, multimerization of the fusion protein, and/or purification.
  • ActRII polypeptide and GDF trap fusion proteins may include an immunoglobulin Fc domain (wild-type or mutant) or a serum albumin.
  • an ActRII polypeptide and GDF trap fusion protein comprises a relatively unstructured linker positioned between the Fc domain and the ActRII or GDF trap domain. This unstructured linker may correspond to the roughly 15 amino acid unstructured region at the C-terminal end of the extracellular domain of ActRII or GDF trap (the "tail"), or it may be an artificial sequence of between 3 and 5, 15, 20, 30, 50 or more amino acids that are relatively free of secondary structure.
  • a linker may be rich in glycine and proline residues and may, for example, contain repeating sequences of threonine/serine and glycines [e.g., TG 4 (SEQ ID NO:52), TG 3 (SEQ ID NO:53), or SG 4 (SEQ ID NO:54) singlets or repeats] or a series of three glycines.
  • a fusion protein may include a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
  • an ActRII fusion protein or GDF trap fusion comprises a leader sequence.
  • the leader sequence may be a native ActRII leader sequence ⁇ e.g., a native
  • an ActRII fusion protein or GDF trap fusion protein comprises an amino acid sequence as set forth in the formula A-B-C.
  • the B portion is an N- and C- terminally truncated ActRII or GDF trap polypeptide as described herein.
  • the A and C portions may be independently zero, one, or more than one amino acids, and both A and C portions are heterologous to B.
  • the A and/or C portions may be attached to the B portion via a linker sequence.
  • ActRII polypeptides ⁇ e.g., ActRIIA and ActRIIB polypeptides
  • GDF trap polypeptides including variants and fusion proteins thereof, to be used in accordance with the methods disclosed herein bind to one or more ActRIIB ligands ⁇ e.g., activin A, activin B, activin AB, activin C, activin E, GDFl 1, GDF 8, BMP6, BMP7, and/or Nodal) with a Kd less than 10 micromolar, less than 1 micromolar, less than 100 nanomolar, less than 10 nanomolar, or less than 1 nanomolar.
  • ActRII polypeptides or GDF trap polypeptides inhibit ActRII signaling, such as ActRIIA and/or ActRIIB intracellular signal transduction events triggered by an ActRII ligand (e.g., SMAD 2/3 and/or SMAD 1/5/8 signaling).
  • ActRII signaling such as ActRIIA and/or ActRIIB intracellular signal transduction events triggered by an ActRII ligand (e.g., SMAD 2/3 and/or SMAD 1/5/8 signaling).
  • the disclosure provides pharmaceutical preparations comprising an ActRII antagonist of the present disclosure (e.g., an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap polypeptide) and a pharmaceutically acceptable carrier.
  • a pharmaceutical preparation may also include one or more additional compounds such as a compound that is used to treat a disorder or condition described herein (e.g., an additional compound that increase red blood cell levels in a subject in need thereof, treat or prevent an anemia in a subject in need thereof (including, e.g., reduction of transfusion burden), treat MDS or sideroblastic anemias in a subject in need thereof, and/or treat or prevent one or more complications of MDS or sideroblastic anemias (e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lymphoma) and or treat or prevent a disorder associat
  • a pharmaceutical preparation of the disclosure is substantially pyrogen- free.
  • an ActRIIA polypeptide, an ActRIIB polypeptide, or a GDF trap polypeptide be expressed in a mammalian cell line that mediates suitably natural glycosylation of the polypeptide so as to diminish the likelihood of an unfavorable immune response in a patient.
  • Human and CHO cell lines have been used successfully, and it is expected that other common mammalian expression vectors will be useful.
  • preferable ActRIIA polypeptides, ActRIIB polypeptides, and GDF trap polypeptides are glycosylated and have a glycosylation pattern that is obtainable from a mammalian cell, preferably a CHO cell.
  • the disclosure provides packaged pharmaceuticals comprising a pharmaceutical preparation described herein and labeled for use in one or more of increasing red blood cell levels and/or hemoglobin in a mammal (preferably a human), treating or preventing anemia in a mammal (preferably a human), treating sideroblastic anemia or MDS in a mamal (preferably a human), and/or treating or preventing one or more complications of sideroblastic anemia or MDS (e.g., anemia, vaso-occlusive crisis, etc. ) in a mammal (preferably a human) or treat or prevent a disorder associatd with SF3B1 mutations in a mammal (preferably a human).
  • a mammal preferably a human
  • the disclosure provides nucleic acids encoding an ActRII polypeptide (e.g., an ActRIIA or ActRIIB polypeptide) or GDF trap polypeptide.
  • An isolated polynucleotide may comprise a coding sequence for a soluble ActRII polypeptide or GDF trap polypeptide, such as described herein.
  • an isolated nucleic acid may include a sequence coding for an ActRII polypeptide or GDF trap comprising an extracellular domain (e.g., ligand-binding domain) of an ActRII polypeptide having one or more sequence variations and a sequence that would code for part or all of the transmembrane domain and/or the cytoplasmic domain of an ActRII polypeptide, but for a stop codon positioned within the transmembrane domain or the cytoplasmic domain, or positioned between the extracellular domain and the transmembrane domain or cytoplasmic domain.
  • an extracellular domain e.g., ligand-binding domain
  • an isolated polynucleotide coding for a GDF trap may comprise a full-length ActRII polynucleotide sequence such as SEQ ID NO: 1 , 4, or 9 or having one or more variations, or a partially truncated version, said isolated polynucleotide further comprising a transcription termination codon at least six hundred nucleotides before the 3 '-terminus or otherwise positioned such that translation of the polynucleotide gives rise to an extracellular domain optionally fused to a truncated portion of a full-length ActRII.
  • Nucleic acids disclosed herein may be operably linked to a promoter for expression, and the disclosure provides cells transformed with such recombinant polynucleotides.
  • the cell is a mammalian cell, such as a CHO cell.
  • the disclosure provides methods for making an ActRII polypeptide or a GDF trap.
  • a method may include expressing any of the nucleic acids disclosed herein (e.g., SEQ ID NO: 8, 13, 27, 32, 39, 42, 46, or 48) in a suitable cell, such as a Chinese hamster ovary (CHO) cell.
  • a suitable cell such as a Chinese hamster ovary (CHO) cell.
  • Such a method may comprise: a) culturing a cell under conditions suitable for expression of the GDF trap polypeptide, wherein said cell is transformed with a GDF trap expression construct; and b) recovering the GDF trap polypeptide so expressed.
  • GDF trap polypeptides may be recovered as crude, partially purified or highly purified fractions using any of the well-known techniques for obtaining protein from cell cultures.
  • the present disclosure relates to an antibody, or combination of antibodies, that antagonize ActRII activity (e.g., inhibition of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 and/or SMAD 1/5/8 signaling).
  • ActRII activity e.g., inhibition of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 and/or SMAD 1/5/8 signaling.
  • the disclosure provides methods of using an antibody ActRII antagonist, or combination of antibody ActRII antagonists, to, e.g., increase red blood cell levels in a subject in need thereof, treat or prevent an anemia in a subject in need thereof (including, e.g., reduction of transfusion burden), treat MDS or sideroblastic anemias in a subject in need thereof, and/or treat or prevent one or more complications of MDS or sideroblastic anemias (e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lymphoma) and or treat or prevent a disorder associated with SF3B1, DNMT3A, and/or TET2 mutations in a subject in need thereof.
  • an anemia in a subject in need thereof including, e.g., reduction of transfusion burden
  • MDS or sideroblastic anemias e.g.,
  • a preferred antibody ActRII antagonist of the disclosure is an antibody, or combination of antibodies, that binds to and/or inhibits activity of at least
  • GDFl 1 ⁇ e.g., GDFl 1 -mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • the antibody, or combination of antibodies further binds to and/or inhibits activity of GDF8 ⁇ e.g., GDF8-mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling), particularly in the case of a multispecific antibody that has binding affinity for both GDFl 1 and GDF8 or in the context of a combination of one or more anti-GDFl 1 antibody and one or more anti-GDF8 antibody.
  • an antibody, or combination of antibodies, of the disclosure does not substantially bind to and/or inhibit activity of activin A ⁇ e.g., activin A-mediated activation of ActRIIA or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • an antibody, or combination of antibodies, of the disclosure that binds to and/or inhibits the activity of GDFl 1 and/or GDF8 further binds to and/or inhibits activity of one of more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, and Nodal ⁇ e.g., activation of ActRIIA or ActRIIB signaling transduction, such as SMAD 2/3 and/or SMAD 1/5/8 signaling), particularly in the case of a multispecific antibody that has binding affinity for multiple ActRII ligands or in the context of a combination multiple antibodies - each having binding affinity for a different ActRII ligand.
  • ActRII antagonists may be used in combination ⁇ e.g., administered at the same time or different times, but generally in such a manner as to achieve overlapping pharmacological effects) with EPO receptor activators to increase red blood cell levels (erythropoiesis) or, as examples, treat or prevent an anemia in a subject in need thereof (including, e.g., reduction of transfusion burden), treat MDS or sideroblastic anemias in a subject in need thereof, and/or treat or prevent one or more complications of MDS or sideroblastic anemias ⁇ e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lymphoma) and or treat or prevent a disorder associated with SF3B1, DNMT3A, and/or TET2 mutations in a subject in need thereof.
  • EPO receptor activators to increase red blood cell levels (erythrop
  • a GDF trap can be administered in combination with an EPO receptor activator to synergistically increase formation of red blood cells in a patient, particularly in sideroblastic anemia or MDS patients.
  • the effect of this combined treatment can be significantly greater than the sum of the effects of the ActRII antagonists and the EPO receptor activator when administered separately at their respective doses.
  • this synergism may be advantageous since it enables target levels of red blood cells to be attained with lower doses of an EPO receptor activator, thereby avoiding potential adverse effects or other problems associated with higher levels of EPO receptor activation.
  • the methods of the present disclosure comprise administering a patient in need thereof one or more ActRII antagonists (e.g., ActRIIA polypeptides, ActRIIB polypeptides, and/or GDF trap
  • polypeptides in combination with one or more EPO receptor activators.
  • EPO receptor activator may stimulate erythropoiesis by directly contacting and activating EPO receptor.
  • the EPO receptor activator is one of a class of compounds based on the 165 amino-acid sequence of native EPO and generally known as erythropoiesis-stimulating agents (ESAs), examples of which are epoetin alfa, epoetin beta, epoetin delta, and epoetin omega.
  • ESAs erythropoiesis-stimulating agents
  • ESAs include synthetic EPO proteins (SEPs) and EPO derivatives with nonpeptidic modifications conferring desirable pharmacokinetic properties (lengthened circulating half-life), examples of which are darbepoetin alfa and methoxy-polyethylene-glycol epoetin beta.
  • an EPO receptor activator may be an EPO receptor agonist that does not incorporate the EPO polypeptide backbone or is not generally classified as an ESA.
  • EPO receptor agonists may include, but are not limited to, peptidic and nonpeptidic mimetics of EPO, agonistic antibodies targeting EPO receptor, fusion proteins comprising an EPO mimetic domain, and erythropoietin receptor extended-duration limited agonists (EREDLA).
  • EREDLA erythropoietin receptor extended-duration limited agonists
  • an EPO receptor activator may stimulate erythropoiesis indirectly, without contacting EPO receptor itself, by enhancing production of endogenous EPO.
  • hypoxia-inducible transcription factors HIFs
  • HIFs hypoxia-inducible transcription factors
  • the disclosure provides increased erythropoiesis in a patient by combined treatment with a GDF trap and an indirect EPO receptor activator with HIF stabilizing properties, such as a prolyl hydroxylase inhibitor.
  • a GDF trap polypeptide when administering a GDF trap polypeptide for these other therapeutic indications, it may be desirable to monitor the effects on red blood cells during administration of the ActRII antagonist, or to determine or adjust the dosing of the ActRII antagonist, in order to reduce undesired effects on red blood cells. For example, increases in red blood cell levels, hemoglobin levels, or hematocrit levels may cause increases in blood pressure.
  • Figure 1 shows an alignment of extracellular domains of human ActRIIA (SEQ ID NO: 56) and human ActRIIB (SEQ ID NO: 2) with the residues that are deduced herein, based on composite analysis of multiple ActRIIB and ActRIIA crystal structures, to directly contact ligand indicated with boxes.
  • Figure 2 shows a multiple sequence alignment of various vertebrate ActRIIB proteins and human ActRIIA (SEQ ID NOs: 57-64).
  • Figure 3 shows the purification of ActRIIA-hFc expressed in CHO cells.
  • the protein purifies as a single, well-defined peak as visualized by sizing column (top panel) and Coomassie stained SDS-PAGE (bottom panel) (left lane: molecular weight standards; right lane: ActRIIA-hFc).
  • Figure 4 shows the binding of ActRIIA-hFc to activin and GDF-11, as measured by BiacoreTM assay.
  • Figures 5A and 5B shows the effects of ActRIIA-hFc on red blood cell counts in female non-human primates (NHPs).
  • Female cynomolgus monkeys (four groups of five monkeys each) were treated with placebo or 1 mg/kg, 10 mg/kg or 30 mg/kg of ActRIIA-hFc on day 0, day 7, day 14, and day 21.
  • Figure 5A shows red blood cell (RBC) counts.
  • Figure 5B shows hemoglobin levels. Statistical significance is relative to baseline for each treatment group. At day 57, two monkeys remained in each group.
  • Figures 6A and 6B shows the effects of ActRIIA-hFc on red blood cell counts in male non-human primates.
  • Male cynomolgus monkeys (four groups of five monkeys each) were treated with placebo or 1 mg/kg, 10 mg/kg, or 30 mg/kg of ActRIIA-hFc on day 0, day 7, day 14, and day 21.
  • Figure 6A shows red blood cell (RBC) counts.
  • Figure 6B shows hemoglobin levels. Statistical significance is relative to baseline for each treatment group. At day 57, two monkeys remained in each group.
  • Figures 7A and 7B shows the effects of ActRIIA-hFc on reticulocyte counts in female non-human primates. Cynomolgus monkeys (four groups of five monkeys each) were treated with placebo or 1 mg/kg, 10 mg/kg, or 30 mg/kg of ActRIIA-hFc on day 0, day 7, day 14, and day 21.
  • Figure 7A shows absolute reticulocyte counts.
  • Figure 7B shows the percentage of reticulocytes relative to RBCs. Statistical significance is relative to baseline for each group. At day 57, two monkeys remained in each group.
  • Figures 8A and 8B shows the effects of ActRIIA-hFc on reticulocyte counts in male non-human primates. Cynomolgus monkeys (four groups of five monkeys each) were treated with placebo or 1 mg/kg, 10 mg/kg, or 30 mg/kg of ActRIIA-hFc on day 0, day 7, day 14, and day 21.
  • Figure 8 A shows absolute reticulocyte counts.
  • Figure 8B shows the percentage of reticulocytes relative to RBCs. Statistical significance is relative to baseline for each group. At day 57, two monkeys remained in each group.
  • Figure 9 shows results from the human clinical trial described in Example 5, where the area-under-curve (AUC) and administered dose of ActRIIA-hFc have a linear correlation, regardless of whether ActRIIA-hFc was administered intravenously (IV) or subcutaneously (SC).
  • AUC area-under-curve
  • IV intravenously
  • SC subcutaneously
  • Figure 10 shows a comparison of serum levels of ActRIIA-hFc in patients
  • FIG 11 shows bone alkaline phosphatase (BAP) levels in response to different dose levels of ActRIIA-hFc.
  • BAP is a marker for anabolic bone growth.
  • Figure 12 depicts the median change from baseline of hematocrit levels from the human clinical trial described in Example 5. ActRIIA-hFc was administered intravenously (IV) at the indicated dosage.
  • Figure 13 depicts the median change from baseline of hemoglobin levels from the human clinical trial described in Example 5. ActRIIA-hFc was administered intravenously (IV) at the indicated dosage.
  • Figure 14 depicts the median change from baseline of RBC (red blood cell) count from the human clinical trial described in Example 5. ActRIIA-hFc was administered intravenously (IV) at the indicated dosage.
  • Figure 15 depicts the median change from baseline of reticulocyte count from the human clinical trial described in Example 5. ActRIIA-hFc was administered intravenously (IV) at the indicated dosage.
  • Figure 16 shows the full amino acid sequence for the GDF trap ActRIIB(L79D 20- 134)-hFc (SEQ ID NO:38), including the TPA leader sequence (double underlined), ActRIIB extracellular domain (residues 20-134 in SEQ ID NO: 1; underlined), and hFc domain.
  • the aspartate substituted at position 79 in the native sequence is double underlined and highlighted, as is the glycine revealed by sequencing to be the N-terminal residue in the mature fusion protein.
  • Figures 17A and 17B show a nucleotide sequence encoding ActRIIB(L79D 20-134)- hFc.
  • SEQ ID NO:39 corresponds to the sense strand
  • SEQ ID NO:40 corresponds to the antisense strand.
  • the TPA leader (nucleotides 1-66) is double underlined
  • the ActRIIB extracellular domain (nucleotides 76-420) is underlined.
  • Figure 18 shows the full amino acid sequence for the truncated GDF trap
  • ActRIIB(L79D 25-13 l)-hFc SEQ ID NO:41
  • TPA leader double underlined
  • truncated ActRIIB extracellular domain residues 25-131 in SEQ ID NO: l; underlined
  • hFc domain hFc domain.
  • the aspartate substituted at position 79 in the native sequence is double underlined and highlighted, as is the glutamate revealed by sequencing to be the N-terminal residue in the mature fusion protein.
  • Figures 19A and 19B shows a nucleotide sequence encoding ActRIIB(L79D 25-131)- hFc.
  • SEQ ID NO:42 corresponds to the sense strand
  • SEQ ID NO:43 corresponds to the antisense strand.
  • the TPA leader (nucleotides 1-66) is double underlined, and the truncated ActRIIB extracellular domain (nucleotides 76-396) is underlined.
  • the amino acid sequence for the ActRIIB extracellular domain is also shown.
  • Figure 20 shows the amino acid sequence for the truncated GDF trap ActRIIB(L79D 25-13 l)-hFc without a leader (SEQ ID NO:44).
  • the truncated ActRIIB extracellular domain (residues 25-131 in SEQ ID NO: 1) is underlined.
  • the aspartate substituted at position 79 in the native sequence is double underlined and highlighted, as is the glutamate revealed by sequencing to be the N-terminal residue in the mature fusion protein.
  • Figure 21 shows the amino acid sequence for the truncated GDF trap ActRIIB(L79D 25-131) without the leader, hFc domain, and linker (SEQ ID NO:45).
  • the aspartate substituted at position 79 in the native sequence is underlined and highlighted, as is the glutamate revealed by sequencing to be the N-terminal residue in the mature fusion protein.
  • Figures 22A and 22B shows an alternative nucleotide sequence encoding
  • ActRIIB(L79D 25-13 l)-hFc corresponds to the sense strand
  • SEQ ID NO:47 corresponds to the antisense strand.
  • the TPA leader (nucleotides 1-66) is double underlined
  • the truncated ActRIIB extracellular domain (nucleotides 76-396) is underlined
  • substitutions in the wild-type nucleotide sequence of the extracellular domain are double underlined and highlighted (compare with SEQ ID NO:42, Figures 19A and 19B).
  • the amino acid sequence for the ActRIIB extracellular domain is also shown.
  • Figure 23 shows nucleotides 76-396 (SEQ ID NO:48) of the alternative nucleotide sequence shown in Figures 22A and 22B (SEQ ID NO:46). The same nucleotide
  • SEQ ID NO:48 encodes only the truncated ActRIIB extracellular domain (corresponding to residues 25-131 in SEQ ID NO: l) with a L79D substitution, e.g., ActRIIB(L79D 25-131).
  • Figure 24 shows the effect of treatment with ActRIIB(L79D 20- 134)-hFc (gray) or
  • VEH vehicle.
  • Data are means + SEM.
  • n 4-8 per group.
  • Figure 25 shows the effect of treatment with ActRIIB(L79D 20-134)-hFc (gray) or ActRIIB(L79D 25-13 l)-hFc (black) on the absolute change in hematocrit from baseline in cynomolgus monkey.
  • Figure 26 shows the effect of treatment with ActRIIB(L79D 20-134)-hFc (gray) or ActRIIB(L79D 25-13 l)-hFc (black) on the absolute change in hemoglobin concentration from baseline in cynomolgus monkey.
  • Figure 27 shows the effect of treatment with ActRIIB(L79D 20-134)-hFc (gray) or
  • VEH vehicle.
  • Data are means + SEM.
  • n 4-8 per group.
  • Figure 28 shows the effect of combined treatment with erythropoietin (EPO) and ActRIIB(L79D 25-13 l)-hFc for 72 hours on hematocrit in mice.
  • Combined treatment increased hematocrit by 23% compared to vehicle, a synergistic increase greater than the sum of the separate effects of EPO and ActRIIB(L79D 25-131)-hFc.
  • Figure 29 shows the effect of combined treatment with EPO and ActRIIB(L79D 25-
  • TGF-beta transforming growth factor-beta
  • the transforming growth factor-beta (TGF-beta) superfamily contains a variety of growth factors that share common sequence elements and structural motifs. These proteins are known to exert biological effects on a large variety of cell types in both vertebrates and invertebrates. Members of the superfamily perform important functions during embryonic development in pattern formation and tissue specification and can influence a variety of differentiation processes, including adipogenesis, myogenesis, chondrogenesis, cardiogenesis, hematopoiesis, neurogenesis, and epithelial cell differentiation. By manipulating the activity of a member of the TGF-beta family, it is often possible to cause significant physiological changes in an organism.
  • the Piedmontese and Belgian Blue cattle breeds carry a loss-of-function mutation in the GDF8 (also called myostatin) gene that causes a marked increase in muscle mass [see, e.g., Grobet et al. (1997) Nat Genet. 17(l):71-4].
  • GDF8 also called myostatin
  • inactive alleles of GDF8 are associated with increased muscle mass and, reportedly, exceptional strength [see, e.g., Schuelke et al. (2004) N Engl J Med, 350:2682-8].
  • TGF- ⁇ signals are mediated by heteromeric complexes of type I and type II
  • serine/threonine kinase receptors which phosphorylate and activate downstream SMAD proteins ⁇ e.g., SMAD proteins 1, 2, 3, 5, and 8) upon ligand stimulation [see, e.g., Massague (2000) Nat. Rev. Mol. Cell Biol. 1 : 169-178].
  • SMAD proteins SMAD proteins 1, 2, 3, 5, and 8
  • ligand stimulation e.g., Massague (2000) Nat. Rev. Mol. Cell Biol. 1 : 169-178.
  • Type I receptors are essential for signaling.
  • Type II receptors are required for binding ligands and for activation of type I receptors.
  • Type I and II activin receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors.
  • ActRII Two related type II receptors (ActRII), ActRIIA and ActRIIB, have been identified as the type II receptors for activins [see, e.g., Mathews and Vale (1991) Cell 65:973-982; and Attisano et al. (1992) Cell 68: 97-108].
  • ActRIIA and ActRIIB can biochemically interact with several other TGF- ⁇ family proteins including, for example, BMP6, BMP7, Nodal, GDF8, and GDF11 [see, e.g., Yamashita et al. (1995) J. Cell Biol.
  • ALK4 is the primary type I receptor for activins, particularly for activin A, and ALK-7 may serve as a receptor for other activins as well, particularly for activin B.
  • the present disclosure relates to antagonizing a ligand of an ActRII receptor (also referred to as an ActRII ligand) with one or more inhibitor agents disclosed herein, particularly inhibitor agents that can antagonize one or more of activin A, activin B, activin C, activin E, GDF11 and/or GDF8.
  • ActRII receptor also referred to as an ActRII ligand
  • inhibitor agents that can antagonize one or more of activin A, activin B, activin C, activin E, GDF11 and/or GDF8.
  • Activins are dimeric polypeptide growth factors that belong to the TGF-beta superfamily. There are three principal activin forms (A, B, and AB) that are
  • the human genome also encodes an activin C and an activin E, which are primarily expressed in the liver, and heterodimeric forms containing ⁇ or ⁇ are also known.
  • activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos [DePaolo et al. (1991) Proc Soc Ep Biol Med. 198:500-512; Dyson et al. (1997) Curr Biol. 7:81-84; and Woodruff (1998) Biochem Pharmacol. 55 :953-963]. Moreover, erythroid differentiation factor (EDF) isolated from the stimulated human monocytic leukemic cells was found to be identical to activin A [Murata et al.
  • EDF erythroid differentiation factor
  • activin A promotes erythropoiesis in the bone marrow.
  • activin signaling is antagonized by its related heterodimer, inhibin.
  • FSH follicle-stimulating hormone
  • Other proteins that may regulate activin bioactivity and/or bind to activin include follistatin (FS), follistatin-related protein (FSRP, also known as FLRG or FSTL3), and a2-macroglobulin.
  • agents that bind to "activin A” are agents that specifically bind to the PA subunit, whether in the context of an isolated PA subunit or as a dimeric complex (e.g., a PAPA homodimer or a PAPB heterodimer).
  • agents that bind to "activin A” are specific for epitopes present within the PA subunit, but do not bind to epitopes present within the non-PA subunit of the complex (e.g., the PB subunit of the complex).
  • activin A are agents that inhibit one or more activities as mediated by a PA subunit, whether in the context of an isolated PA subunit or as a dimeric complex (e.g., a PAPA homodimer or a PAPB heterodimer).
  • agents that inhibit "activin A” are agents that specifically inhibit one or more activities of the PA subunit, but do not inhibit the activity of the non-PA subunit of the complex (e.g., the PB subunit of the complex). This principle applies also to agents that bind to and/or inhibit "activin B", “activin C", and "activin E”.
  • Agents disclosed herein that antagonize "activin AB” are agents that inhibit one or more activities as mediated by the PA subunit and one or more activities as mediated by the PB subunit.
  • Nodal proteins have functions in mesoderm and endoderm induction and formation, as well as subsequent organization of axial structures such as heart and stomach in early embryogenesis. It has been demonstrated that dorsal tissue in a developing vertebrate embryo contributes predominantly to the axial structures of the notochord and pre-chordal plate while it recruits surrounding cells to form non-axial embryonic structures. Nodal appears to signal through both type I and type II receptors and intracellular effectors known as SMAD proteins.
  • ActRIIA and ActRIIB serve as type II receptors for Nodal [see, e.g., Sakuma et al. (2002) Genes Cells. 2002, 7:401-12]. It is suggested that Nodal ligands interact with their co-factors (e.g., cripto) to activate activin type I and type II receptors, which phosphorylate SMAD2. Nodal proteins are implicated in many events critical to the early vertebrate embryo, including mesoderm formation, anterior patterning, and left-right axis specification. Experimental evidence has demonstrated that Nodal signaling activates pAR3-Lux, a luciferase reporter previously shown to respond specifically to activin and TGF-beta.
  • Nodal is unable to induce pTlx2-Lux, a reporter specifically responsive to bone morphogenetic proteins.
  • SMADs activin-TGF-beta pathway
  • SMAD2 SMAD2
  • SMAD3 extracellular cripto protein
  • GDF8 Growth and differentiation factor-8
  • GDF8 is a negative regulator of skeletal muscle mass. GDF8 is highly expressed in the developing and adult skeletal muscle. The GDF8 null mutation in transgenic mice is characterized by a marked hypertrophy and hyperplasia of the skeletal muscle [McPherron et al., Nature (1997) 387:83-90]. Similar increases in skeletal muscle mass are evident in naturally occurring mutations of GDF8 in cattle [see, e.g., Ashmore et al. (1974) Growth, 38:501-507; Swatland and Kieffer (1994) J. Anim. Sci. 38:752-757; McPherron and Lee (1997) Proc. Natl. Acad.
  • GDF8 can modulate the production of muscle-specific enzymes (e.g., creatine kinase) and modulate myoblast cell proliferation [see, e.g. international patent application publication no. WO 00/43781].
  • the GDF8 propeptide can noncovalently bind to the mature GDF8 domain dimer, inactivating its biological activity [see, e.g., Miyazono et al. (1988) J. Biol. Chem., 263: 6407-6415; Wakefield et al. (1988) J. Biol.
  • GDFl 1 Growth and differentiation factor- 11 (GDFl 1), also known as BMP11, is a secreted protein [McPherron et al. (1999) Nat. Genet. 22: 260-264]. GDFl 1 is expressed in the tail bud, limb bud, maxillary and mandibular arches, and dorsal root ganglia during mouse development [see, e.g., Nakashima et al. (1999) Mech. Dev. 80: 185-189]. GDFl 1 plays a unique role in patterning both mesodermal and neural tissues [see, e.g., Gamer et al. (1999) Dev Biol, 208:222-32].
  • GDFl 1 was shown to be a negative regulator of chondrogenesis and myogenesis in developing chick limb [see, e.g., Gamer et al. (2001) Dev Biol. 229:407-20].
  • the expression of GDFl 1 in muscle also suggests its role in regulating muscle growth in a similar way to GDF8.
  • the expression of GDF11 in brain suggests that GDF11 may also possess activities that relate to the function of the nervous system.
  • GDF11 was found to inhibit neurogenesis in the olfactory epithelium [see, e.g., Wu et al. (2003) Neuron. 37: 197-207].
  • Bone morphogenetic protein also called osteogenic protein- 1 (OP-1)
  • BMP7 also called osteogenic protein- 1 (OP-1)
  • BMP7 regulates a wide array of physiological processes.
  • BMP7 may be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. It is also found that BMP7 plays a role in calcium regulation and bone homeostasis.
  • BMP7 binds to type II receptors, ActRIIA and ActRIIB.
  • BMP7 and activin recruit distinct type I receptors into heteromeric receptor complexes.
  • the major BMP7 type I receptor observed was ALK2, while activin bound exclusively to ALK4 (ActRIIB).
  • ActRII polypeptides ⁇ e.g., ActRIIA and ActRIIB
  • a GDF trap polypeptide (specifically a variant ActRIIB polypeptide) is characterized by unique biological properties in comparison to a corresponding sample of a wild-type (unmodified) ActRII polypeptide.
  • This GDF trap is characterized, in part, by substantial loss of binding affinity for activin A, and therefore significantly diminished capacity to antagonize activin A activity, but retains near wild-type levels of binding and inhibition of GDF11.
  • the GDF trap is more effective at increasing red blood cell levels as compared to the wild-type ActRIIB polypeptide and has beneficial effects in a variety of models for anemia.
  • hematopoiesis is a complex process, regulated by a variety of factors, including erythropoietin, G-CSF, and iron homeostasis.
  • the terms "increase red blood cell levels” and “promote red blood cell formation” refer to clinically observable metrics, such as hematocrit, red blood cell counts, and hemoglobin measurements, and are intended to be neutral as to the mechanism by which such changes occur.
  • the data of the present disclosure therefore indicate that the observed biological activity of an ActRII polypeptide, with respect to red blood cell levels, is not dependent on activin A inhibition.
  • an ActRIIB or ActRIIA polypeptide that retains activin A inhibition may be more desirable in some applications, in comparison to a GDF trap having diminished binding affinity for activin A, where more modest gains in red blood cell levels are desirable and/or where some level of off-target activity is acceptable (or even desirable).
  • the methods of the present disclosure are directed to the use of one or more ActRII antagonist agents described herein, optionally in combination with one or more supportive therapies, to increase red blood cell formation in a subject in need thereof, treat or prevent an anemia in a subject in need thereof, to treat myelodysplastic syndrome, to treat sideroblastic anemia in a subject in need thereof, and to treat or prevent one or more complications of sideroblastic anemia or myelodysplastic syndrome (e.g., anemia, blood transfusion requirement, iron overload, neutropenia, splenomegaly, progression to acute myeloid leukemia), and, optionally, in a subgroup of patients with ring sideroblasts and/or one or more mutations in the SF3B1, DNMT3A, and/or TET2 gene in bone marrow cells.
  • Another subgroup of patients that are identified as being particularly likely to respond to an ActRII antagonist is patients that have failed prior treatment with EPO therapy or other EPO receptor activator therapy.
  • EPO is a glycoprotein hormone involved in the growth and maturation of erythroid progenitor cells into erythrocytes. EPO is produced by the liver during fetal life and by the kidney in adults. Decreased production of EPO, which commonly occurs in adults as a consequence of renal failure, leads to anemia. EPO has been produced by genetic engineering techniques based on expression and secretion of the protein from a host cell transfected with the EPO gene. Administration of such recombinant EPO has been effective in the treatment of anemia. For example, Eschbach et al. (1987, N Engl J Med 316:73) describe the use of EPO to correct anemia caused by chronic renal failure.
  • EPO Effects of EPO are mediated through its binding to, and activation of, a cell surface receptor belonging to the cytokine receptor superfamily and designated the EPO receptor.
  • the human and murine EPO receptors have been cloned and expressed [see, e.g., D 'Andrea et al. (1989) Cell 57:277; Jones et al. (1990) Blood 76:31; Winkelman et al. (1990) Blood 76:24; and U.S. Pat. No. 5,278,065].
  • the human EPO receptor gene encodes a 483-amino- acid transmembrane protein comprising an extracellular domain of approximately 224 amino acids and exhibits approximately 82% amino acid sequence identity with the murine EPO receptor (see, e.g., U.S. Pat. No. 6,319,499).
  • this form is thought to contain the main EPO binding determinant and is referred to as the EPO receptor.
  • the EPO receptor is thought to dimerize upon agonist binding. Nevertheless, the detailed structure of the EPO receptor, which may be a multimeric complex, and its specific mechanism of activation are not completely understood (see, e.g., U.S. Pat. No. 6,319,499).
  • EPO receptor Activation of the EPO receptor results in several biological effects. These include increased proliferation of immature erythroblasts, increased differentiation of immature erythroblasts, and decreased apoptosis in erythroid progenitor cells [see, e.g., Liboi et al. (1993) Proc Natl Acad Sci USA 90: 1 1351 - 1 1355; Koury et al. (1990) Science 248 :378-381 ].
  • the EPO receptor signal transduction pathways mediating proliferation and differentiation appear to be distinct [see, e.g., Noguchi et al. (1988) Mol Cell Biol 8 :2604; Patel et al.
  • EPO receptor activators include small molecule erythropoiesis-stimulating agents (ESAs) as well as EPO-based compounds.
  • ESAs small molecule erythropoiesis-stimulating agents
  • An example of the former is a dimeric peptide- based agonist covalently linked to polyethylene glycol (proprietary names HematideTM and Omontys®), which has shown erythropoiesis-stimulating properties in healthy volunteers and in patients with both chronic kidney disease and endogenous anti-EPO antibodies [see, e.g., Stead et al. (2006) Blood 108 : 1830-1834; and Macdougall et al. (2009) N Engl J Med 361 : 1848- 1855].
  • EPO receptor activators also include compounds that stimulate erythropoiesis indirectly, without contacting EPO receptor itself, by enhancing production of endogenous EPO.
  • hypoxia-inducible transcription factors HIFs
  • HIF prolyl hydroxylase enzymes are being investigated for EPO-inducing activity in vivo.
  • EPO receptor indirect activators of EPO receptor include inhibitors of GATA-2 transcription factor [see, e.g., Nakano et al. (2004) Blood 104:4300-4307], which tonically inhibits EPO gene expression, and inhibitors of hemopoietic cell phosphatase (HCP or SHP-1), which functions as a negative regulator of EPO receptor signal transduction [see, e.g. , Klingmuller et al. (1995) Cell 80:729-738].
  • GATA-2 transcription factor see, e.g., Nakano et al. (2004) Blood 104:4300-4307
  • HCP or SHP-1 hemopoietic cell phosphatase
  • ring sideroblasts may be particularly suited to treatment with ActRII antagonists.
  • Sideroblastic anemias can be classified broadly into congenital (inherited) and acquired forms, which can be further subdivided as shown in Table 1.
  • MLASA sideroblastic anemia
  • TRMA megaloblastic anemia
  • MDS represent the most common class of acquired bone-marrow- failure syndromes in adults. Although MDS are increasingly well understood from a biological standpoint, improved pathologic insight has not yet translated into highly effective or curative therapies for most patients suffering from these disorders.
  • Increasing failure of cellular differentiation in MDS is associated with evolution to secondary acute myeloid leukemia (AML), which is currently defined by the WHO as having at least 20% myeloblasts in the blood or marrow, or the presence of one of several AML-defining karyotypic abnormalities regardless of blast proportion [see, e.g., Vardiman et al. (2009) Blood 114:937-951]. AML is ultimately diagnosed in as many as 30% of MDS patients.
  • AML secondary acute myeloid leukemia
  • IPSS-R International Prognostic Scoring System
  • the prognosis helps define the severity of disease and sets expectations as to how it is likely to impact them. From a physician's standpoint, the prognosis provides a means of staging the disease in a manner that can be used to help direct therapy. Notably, such schemes do not typically take patient
  • ring sideroblasts are characteristic of RARS but can also be present in other subtypes of MDS [see, e.g., Juneja et al. (1983) J Clin Pathol 36:566-569; Malcovati et al. (2013) Best Pract Res Clin Haematol 26:377-385].
  • anemia can occur, for example, in the presence or absence of ring sideroblasts, alone or in combination with abnormally low numbers of neutrophils (neutropenia), low numbers of platelets
  • RARS-T Refractory anemia with ring sideroblasts associated with marked thrombocytosis
  • MDS-U MDS neoplasms unclassifiable
  • erythropoiesis and ring sideroblasts > 15% of erythroid precursors, no blasts in peripheral blood and ⁇ 5% in the bone marrow, and thrombocytosis with a platelet count > 450 x 10 9 /L [Malcovati et al. (2013) Best Pract Res Clin Haematol 26:377-385].
  • thrombocytopenia are at increased risk of internal hemorrhage, and depending on severity it may also be beneficial to treat this condition.
  • ActRII antagonists are useful for treating anemia in patients, including MDS patients or patients with sideroblastic anemia, in whom more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 1 1%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%o, 90%), or 95% of erythroid precursors are ring sideroblasts, e.g., in refractory anemia with ring sideroblasts (RARS), RARS associated with marked thrombocytosis (RARS-T), or refractory cytopenia with multilineage dysplasia (RCMD, also known as RCMD-RS in patients where ring sideroblasts are prominent).
  • RARS refractory anemia with ring sideroblasts
  • RARS-T RARS associated with marked
  • MDS myeloma sarcoma .
  • erythropoiesis in which there is impaired differentiation (maturation) of late-stage erythroid precursor cells despite EPO- stimulated hyperproliferation of early-stage erythroid progenitor cells in response to tissue hypoxia.
  • ineffective erythropoiesis is persistent anemia in spite of elevated levels of endogenous EPO.
  • iron Since iron cannot be actively secreted from the body, it initially accumulates in the reticuloendothelial macrophages and is later deposited primarily in parenchymal cells of the heart, liver, and endocrine glands [Siah et al. (2006) Clin Biochem Rev 27:5-16]. Under conditions of iron overload, non-transferrin bound iron changes to its redox-active form known as labile plasma iron, which is transported into cells where it promotes formation of reactive oxygen species. These highly toxic molecules adversely impact hematopoiesis and particularly damage cardiac, hepatic, and endocrine tissues.
  • the MDS patient population consists mainly of elderly with comorbid conditions - including a propensity for cardiac failure, infection, hemorrhage, and hepatic cirrhosis - and iron overload may rapidly exacerbate such pre-existing conditions.
  • patients at low or intermediate- 1 risk may be more prone to iron overload due to their longer life expectancy.
  • iron chelation therapy to reduce iron burden is considered advisable in patients with low- or intermediate- 1 risk MDS subtypes who have a long life expectancy and are anticipated to receive more than 20 RBC transfusions [Temraz et al. (2014) Crit Rev Oncol Hematol 91 :64-73].
  • Novel sequencing techniques have led in the past few years to identification of dozens of genes that are recurrently mutated in MDS.
  • a 2013 list of such genes classified by type is shown in Table 3.
  • One or more such mutations can be found in almost all patients with MDS, and knowing the nature of the genes involved has improved understanding of how MDS develops and evolves, although it has not yet had an impact on treatment.
  • Whole-genome sequencing applied to MDS patient samples has identified an entirely novel class of cancer- associated genes encoding mRNA splicing (spliceosome) factors.
  • the first such gene identified in MDS was SF3B1, which is mutated particularly frequently in patients with RARS [Papaemmanuil et al. (2011) N Engl J Med 365: 1384-1395].
  • mutated genes are epigenetic (DNA methylation) regulators, transcription factors, and signaling molecules [Cazzola et al. (2013) Blood 122:4021-4034; Bejar et al. (2014) Blood 124:2793-2803].
  • the extent to which these mutations co-occur in MDS patients seems to vary with gene type. For example, approximately 50% of MDS patients possess one of ten genes identified to date encoding mutant splicing factors, but these mutant genes rarely co- occur in the same patient [Bejar et al. (2014) Blood 124:2793-2803]. Thus, these mutant genes are seldom redundant markers for the same individuals.
  • mutant epigenetic regulators co-occur more frequently with each other and with mutant splicing factor genes in the same patient.
  • the differential occurrence of mutant genes such as those listed in Table 3 provides a genetic signature that can assist in predicting which patients with MDS or sideroblastic anemia are likely to be either responsive or nonresponsive therapeutically to an ActRII antagonist.
  • SF3B1 splicing factor 3B1
  • Somatic mutations in SF3B1 also occur in hematologic cancers including chronic lymphocytic leukemia (CLL), and acute myeloid leukemia (AML) as well as in breast cancer, pancreatic cancer, gastric cancer, prostate cancer, and uveal melanoma [Malcovati et al. (2011) Blood 118:6239-6246; Wang et al. (2011) N Engl J Med 365:2497-2506; The Cancer Genome Atlas Network (2012) Nature 490:61-70; Biankin et al. (2012) Nature 491 :399-405; Chesnais et al. (2012) Oncotarget 3: 1284-1293; Furney et al.
  • CLL chronic lymphocytic leukemia
  • AML acute myeloid leukemia
  • SF3B1 mutations identified in MDS include, for example, K182E, E491G, R590K, E592K, R625C, R625G, N626D, N626S, H662Y, T663A, K666M, K666Q, K666R, Q670E, G676D, V701I, I704N, I704V, G740R, A744P, D781G, and Al 188V.
  • SF3B1 mutations identified in cancer include, for example, N619K, N626H, N626Y, R630S, I704T, G740E, K741N, G742D, D894G, Q903R, R1041H, and I1241T.
  • SF3B1 mutations found in both MDS and cancer include, for example, G347V, E622D, Y623C, R625H, R625L, H662D, H662Q, T663I, K666E, K666N, K666T, K700E, and V701F.
  • the terms used in this specification generally have their ordinary meanings in the art, within the context of this disclosure and in the specific context where each term is used.
  • sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
  • sequence similarity when modified with an adverb such as “highly,” may refer to sequence similarity and may or may not relate to a common evolutionary origin.
  • Percent (%) sequence identity with respect to a reference polypeptide (or nucleotide) sequence is defined as the percentage of amino acid residues (or nucleic acids) in a candidate sequence that are identical to the amino acid residues (or nucleic acids) in the reference polypeptide (nucleotide) sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as
  • BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid (nucleic acid) sequence identity values are generated using the sequence comparison computer program ALIGN-2.
  • the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
  • the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif, or may be compiled from the source code.
  • the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
  • Alternize in all its grammatical forms, refers to the process of activating a protein and/or gene (e.g., by activating or amplifying that protein's gene expression or by inducing an inactive protein to enter an active state) or increasing a protein's and/or gene's activity.
  • “Antagonize”, in all its grammatical forms, refers to the process of inhibiting a protein and/or gene (e.g., by inhibiting or decreasing that protein's gene expression or by inducing an active protein to enter an inactive state) or decreasing a protein's and/or gene's activity.
  • does not substantially bind to JF is intended to mean that an agent has a KD that is greater than about 10 "7 , 10 "6 , 10 “5 , 10 “4 , or greater (e.g., no detectable binding by the assay used to determine the KD) for "X” or has relatively modest binding for "X", e.g., about 1 x 10 "8 M or about 1 x 10 "9 M.
  • the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably ⁇ 5 -fold and more preferably ⁇ 2-fold of a given value.
  • ActRII antagonists (inhibitors) of ActRII
  • antagonists e.g. , antagonist of ActRIIA and/or ActRIIB SMAD 2/3 and/or SMAD 1/5/8 signaling
  • ActRII antagonists are shown herein to be effective in treating various anemias as well as various complications (e.g., disorders/conditions) of MDS and sideroblastic anemias.
  • the present disclosure provides, in part, various ActRII antagonist agents that can be used, alone or in combination with one or more erythropoiesis stimulating agents (e.g.
  • hematopoietic growth factors e.g., G-CSF or GM- CSF
  • transfusion of red blood cells or whole blood iron chelation therapy
  • increase red blood cell levels in a subject in need thereof treat or prevent an anemia in a subject in need thereof (including, e.g., reduction of transfusion burden), treat MDS or sideroblastic anemias in a subject in need thereof, and/or treat or prevent one or more complications of MDS or sideroblastic anemias (e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lymphoma) and or treat or prevent a disorder associated with SF3B1, DNMT3A, and/or TET2 mutations in a subject in need thereof.
  • supportive therapies e.g., hematopoietic growth factors (e.g., G-CSF or GM
  • preferred ActRII antagonists to be used in accordance with the methods disclosed herein are GDF-ActRII antagonists (e.g., antagonists of GDF-mediated ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling), particularly GDF11- and/or GDF8-mediated ActRII signaling.
  • preferred ActRII antagonists of the present disclosure are soluble ActRII polypeptides (e.g., soluble ActRIIA and ActRIIB polypeptides) and GDF trap polypeptides, such as ActRIIA-Fc fusion proteins, ActRIIB-Fc fusion proteins, and GDF trap-Fc fusion proteins.
  • GDFl 1 and/or GDF8 inhibition may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of additional agents, including, perhaps, other members of the TGF- beta superfamily (e.g., activin B, activin C, activin E, BMP6, BMP7, and/or Nodal) and such collective inhibition may lead to the desired effect on, e.g., hematopoiesis]
  • GDF-ActRII antagonist are expected to be useful including, for example, anti-GDFl 1 antibodies; anti-GDF8 antibodies; anti-activin A, B, C and/or E antibodies, anti-ActRIIA antibodies; anti-ActRIIB antibodies; anti-ActRIIA/II
  • GDF-ActRII antagonists of the present disclosure may bind to and/or inhibit the activity (or expression) of other ActRII ligands including, for example, activin A, activin AB, activin B, activin C, activin E, BMP6, BMP7, and/or Nodal.
  • a GDF-ActRII antagonist of the present disclosure may be used in combination with at least one additional ActRII antagonist agent that binds to and/or inhibits the activity (or expression) of one or more additional ActRII ligands including, for example, activin A, activin AB, activin B, activin C, activin E, BMP6, BMP7, and/or Nodal.
  • ActRII antagonists to be used in accordance with the methods disclosed herein do not substantially bind to and/or inhibit activin A (e.g., activin A-mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • activin A e.g., activin A-mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling.
  • the present disclosure relates to ActRII polypeptides.
  • the disclosure provides methods of using ActRII polypeptides, alone or in combination with one or more erythropoiesis stimulating agents (e.g., EPO) or other supportive therapies [e.g., hematopoietic growth factors (e.g., G-CSF or GM-CSF), transfusion of red blood cells or whole blood, iron chelation therapy], to, e.g., increase red blood cell levels in a subject in need thereof, treat or prevent an anemia in a subject in need thereof (including, e.g., reduction of transfusion burden), treat MDS or sideroblastic anemias in a subject in need thereof, and/or treat or prevent one or more complications of MDS or sideroblastic anemias (e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to
  • ActRIIB refers to a family of activin receptor type IIB (ActRIIB) proteins from any species and variants derived from such ActRIIB proteins by mutagenesis or other modification. Reference to ActRIIB herein is understood to be a reference to any one of the currently identified forms. Members of the ActRIIB family are generally transmembrane proteins, composed of a ligand-binding extracellular domain comprising a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
  • ActRIIB polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRIIB family member as well as any variants thereof
  • ActRIIA polypeptides of the present disclosure can be used to increase red blood cell levels in a subject. Numbering of amino acids for all ActRIIB-related polypeptides described herein is based on the numbering of the human ActRIIB precursor protein sequence provided below (SEQ ID NO: l), unless specifically designated otherwise.
  • the human ActRIIB precursor protein sequence is as follows:
  • the signal peptide is indicated with single underline; the extracellular domain is indicated in bold font; and the potential, endogenous N-linked glycosylation sites are indicated with double underline.
  • the processed soluble (extracellular) human ActRIIB polypeptide sequence is as follows:
  • the protein may be produced with an "SGR" sequence at the N-terminus.
  • the C-terminal "tail" of the extracellular domain is indicated by single underline.
  • the sequence with the "tail” deleted (a ⁇ 15 sequence) is as follows:
  • a form of ActRIIB with an alanine at position 64 of SEQ ID NO: 1 (A64) is also reported in the literature [see, e.g., Hilden et al. (1994) Blood, 83(8): 2163-2170].
  • Applicants have ascertained that an ActRIIB-Fc fusion protein comprising an extracellular domain of ActRIIB with the A64 substitution has a relatively low affinity for activin and GDFl 1.
  • the same ActRIIB-Fc fusion protein with an arginine at position 64 R64
  • sequences with an R64 are used as the "wild-type" reference sequence for human ActRIIB in this disclosure.
  • ActRIIB with an alanine at position 64 is as follows: 1 MTAPWVALAL LWGSLCAGSG RGEAETRECI YYNANWELER TNQSGLERCE
  • the signal peptide is indicated by single underline and the extracellular domain is indicated by bold font.
  • the protein may be produced with an "SGR" sequence at the N-terminus.
  • the C-terminal "tail" of the extracellular domain is indicated by single underline.
  • the sequence with the "tail” deleted (a ⁇ 15 sequence) is as follows:
  • the nucleic acid sequence encoding human ActRIIB precursor protein is shown below (SEQ ID NO: 7), consisting of nucleotides 25-1560 of Genbank Reference Sequence NM 001106.3, which encode amino acids 1-513 of the ActRIIB precursor.
  • the sequence as shown provides an arginine at position 64 and may be modified to provide an alanine instead.
  • the signal sequence is underlined.
  • a nucleic acid sequence encoding processed soluble (extracellular) human ActRIIB polypeptide is as follows (SEQ ID NO: 8). The sequence as shown provides an arginine at position 64, and may be modified to provide an alanine instead. 1 GGGCGTGGGG AGGCTGAGAC ACGGGAGTGC ATCTACTACA ACGCCAACTG
  • ActRIIA refers to a family of activin receptor type IIA (ActRIIA) proteins from any species and variants derived from such ActRIIA proteins by mutagenesis or other modification. Reference to ActRIIA herein is understood to be a reference to any one of the currently identified forms.
  • ActRIIA family are generally transmembrane proteins, composed of a ligand-binding extracellular domain comprising a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
  • ActRIIA polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRIIA family member as well as any variants thereof
  • ActRIIA polypeptides of the present disclosure can be used to increase red blood cell levels in a subject.
  • Numbering of amino acids for all ActRIIA-related polypeptides described herein is based on the numbering of the human ActRIIA precursor protein sequence provided below (SEQ ID NO:9), unless specifically designated otherwise.
  • the human ActRIIA precursor protein sequence is as follows:
  • the signal peptide is indicated by single underline; the extracellular domain is indicated in bold font; and the potential, endogenous N-linked glycosylation sites are indicated by double underline.
  • the processed soluble (extracellular) human ActRIIA polypeptide sequence is as follows:
  • the nucleic acid sequence encoding human ActRIIA precursor protein is shown below (SEQ ID NO: 12), as follows nucleotides 159-1700 of Genbank Reference Sequence NM 001616.4. The signal sequence is underlined.
  • nucleic acid sequence encoding processed soluble (extracellular) human ActRIIA polypeptide is as follows:
  • FIG. 13 An alignment of the amino acid sequences of human ActRIIB soluble extracellular domain and human ActRIIA soluble extracellular domain are illustrated in Figure 1. This alignment indicates amino acid residues within both receptors that are believed to directly contact ActRIl ligands.
  • Figure 2 depicts a multiple-sequence alignment of various vertebrate ActRIIB proteins and human ActRIIA. From these alignments it is possible to predict key amino acid positions within the ligand-binding domain that are important for normal ActRII- ligand binding activities as well as to predict amino acid positions that are likely to be tolerant to substitution without significantly altering normal ActRII-ligand binding activities.
  • GDF trap polypeptides also referred to as "GDF traps" which may be used, for example, alone or in combination with one or more erythropoiesis stimulating agents (e.g. , EPO) or other supportive therapies [e.g.
  • hematopoietic growth factors e.g., G-CSF or GM-CSF
  • transfusion of red blood cells or whole blood iron chelation therapy
  • MDS or sideroblastic anemias e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lymphoma
  • MDS or sideroblastic anemias e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lymphoma
  • GDF traps of the present disclosure are soluble, variant ActRIl polypeptides (e.g. , ActRIIA and ActRIIB polypeptides) that comprise one or more mutations (e.g., amino acid additions, deletions, substitutions, and combinations thereof) in the extracellular domain (also referred to as the ligand-binding domain) of an ActRIl polypeptide (e.g., a "wild-type" ActRIl polypeptide) such that the variant ActRIl polypeptide has one or more altered ligand-binding activities than the corresponding wild-type ActRIl polypeptide.
  • ActRIl polypeptide e.g., ActRIIA and ActRIIB polypeptides
  • mutations e.g., amino acid additions, deletions, substitutions, and combinations thereof
  • the extracellular domain also referred to as the ligand-binding domain
  • an ActRIl polypeptide e.g., a "wild-type" ActRIl polypeptide
  • GDF trap polypeptides of the present disclosure retain at least one similar activity as a corresponding wild-type ActRIl polypeptide (e.g., an ActRIIA or ActRIIB polypeptide).
  • a GDF trap may bind to and/or inhibit (e.g. antagonize) the function of one or more ActRIl ligands (e.g., inhibit ActRIl ligand-mediated activation of the ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 and/or SMAD 1/5/8 signaling pathway).
  • GDF traps of the present disclosure bind to and/or inhibit one or more of activin A, activin B, activin AB, activin C, activin E, Nodal, GDF 8, GDF1 1 , BMP6 and/or BMP7).
  • GDF trap polypeptides of the disclosure have elevated binding affinity for one or more specific ActRII ligands (e.g., GDF8, GDFl 1, BMP6, Nodal, and/or BMP7).
  • GDF trap polypeptides of the disclosure have decreased binding affinity for one or more specific ActRII ligands (e.g., activin A, activin B, activin AB, activin C, and/or activin E).
  • GDF trap polypeptides of the disclosure have elevated binding affinity for one or more specific ActRII ligands and decreased binding affinity for one or more different/other ActRII ligands. Accordingly, the present disclosure provides GDF trap polypeptides that have an altered binding specificity for one or more ActRII ligands. In certain preferred embodiments, GDF traps of the present disclosure are designed to preferentially bind to and antagonize GDFl 1 and/or GDF8 (also known as myostatin), e.g., in comparision to a wild-type ActRII polypeptide.
  • such GDFl 1 and/or GDF8- binding traps may further bind to and/or antagonize one or more of Nodal, GDF8, GDFl 1, BMP6 and/or BMP7.
  • such GDFl 1 and/or GDF8-binding traps may further bind to and/or antagonize one or more of activin B, activin C, activin E, Nodal, GDF8, GDFl 1, BMP6 and/or BMP7.
  • GDFl 1 and/or GDF8-binding traps may further bind to and/or antagonize one or more of activin A, activin A/B, activin B, activin C, activin E, Nodal, GDF 8, GDFl 1, BMP6 and/or BMP7.
  • GDF traps of the present disclosure have diminished binding affinity for activins (e.g., activin A, activin A/B, activin B, activin C, activin E ), e.g., in comparision to a wild-type ActRII polypeptide.
  • a GDF trap polypeptide of the present disclosure has diminished binding affinity for activin A.
  • the disclosure provides GDF trap polypeptides that preferentially bind to and/or antagonize GDF8/GDF11 relative to activin A.
  • GDF trap polypeptides are more potent activators of erythropoiesis in vivo in comparision to ActRII polypeptides that retain high binding affinity for activin A.
  • these non-activin-A-binding GDF trap polypeptides demonstrate decreased effects on other tissues. Therefore, such GDF traps may be useful for increasing red blood cell levels in a subject while reducing potential off-target effects associated with
  • GDF trap polypeptides may be less desirable in some applications wherein more modest gains in red blood cell levels may be needed for therapeutic effect and wherein some level of off-target effect is acceptable (or even desirable).
  • Amino acid residues of the ActRIIB proteins e.g., E39, K55, Y60, K74, W78, L79, D80, and F101 are in the ActRIIB ligand-binding pocket and help mediated binding to its ligands including, for example, activin A, GDF1 1 , and GDF8.
  • GDF trap polypeptides comprising an altered-ligand binding domain (e.g., a GDF 8/GDF 1 1 -binding domain) of an ActRIIB receptor which comprises one or more mutations at those amino acid residues.
  • an altered-ligand binding domain e.g., a GDF 8/GDF 1 1 -binding domain
  • ActRIIB receptor which comprises one or more mutations at those amino acid residues.
  • the altered ligand-binding domain can have increased selectivity for a ligand such as GDF1 1 and/or GDF8 relative to a wild-type ligand-binding domain of an ActRIIB receptor.
  • a ligand such as GDF1 1 and/or GDF8 relative to a wild-type ligand-binding domain of an ActRIIB receptor.
  • one or more mutations may be selected that increase the selectivity of the altered ligand-binding domain for GDF1 1 and/or GDF8 over one or more activins (activin A, activin B, activin AB, activin C, and/or activin A), particularly activin A.
  • the altered ligand-binding domain has a ratio of K d for activin binding to Ka for GDF 1 1 and/or GDF 8 binding that is at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-fold greater relative to the ratio for the wild-type ligand-binding domain.
  • the altered ligand-binding domain has a ratio of IC 50 for inhibiting activin to IC 50 for inhibiting GDF1 1 and/or GDF8 that is at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-fold greater relative to the wild-type ligand-binding domain.
  • the altered ligand-binding domain inhibits GDF 1 1 and/or GDF 8 with an IC 50 at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-times less than the IC 50 for inhibiting activin.
  • the positively-charged amino acid residue Asp (D80) of the ligand-binding domain of ActRIIB can be mutated to a different amino acid residue to produce a GDF trap polypeptide that preferentially binds to GDF8, but not activin.
  • the D80 residue with respect to SEQ ID NO: l is changed to an amino acid residue selected from the group consisting of: an uncharged amino acid residue, a negative amino acid residue, and a hydrophobic amino acid residue.
  • the hydrophobic residue L79 of SEQ ID NO: 1 can be altered to confer altered activin- GDF1 1/GDF8 binding properties.
  • an L79P substitution reduces GDF1 1 binding to a greater extent than activin binding.
  • replacement of L79 with an acidic amino acid an aspartic acid or glutamic acid; an L79D or an L79E substitution] greatly reduces activin A binding affinity while retaining GDF1 1 binding affinity.
  • the methods described herein utilize a GDF trap polypeptide which is a variant ActRIIB polypeptide comprising an acidic amino acid (e.g., D or E) at the position corresponding to position 79 of SEQ ID NO: 1, optionally in combination with one or more additional amino acid substitutions, additions, or deletions.
  • a GDF trap polypeptide which is a variant ActRIIB polypeptide comprising an acidic amino acid (e.g., D or E) at the position corresponding to position 79 of SEQ ID NO: 1, optionally in combination with one or more additional amino acid substitutions, additions, or deletions.
  • the present disclosure relates to ActRII polypeptides
  • soluble ActRII polypeptide generally refers to polypeptides comprising an extracellular domain of an ActRII protein.
  • soluble ActRII polypeptide includes any naturally occurring extracellular domain of an ActRII protein as well as any variants thereof (including mutants, fragments, and peptidomimetic forms) that retain a useful activity (e.g., a GDF trap polypeptide as described herein).
  • Other examples of soluble ActRII polypeptides comprise a signal sequence in addition to the extracellular domain of an ActRII or GDF trap protein.
  • the signal sequence can be a native signal sequence of an ActRIIA or ActRIIB protein, or a signal sequence from another protein including, for example, a tissue plasminogen activator (TP A) signal sequence or a honey bee melittin (HBM) signal sequence.
  • TP A tissue plasminogen activator
  • HBM honey bee melittin
  • the present disclosure identifies functionally active portions and variants of ActRII polypeptides that can be used as guidance for generating and using ActRIIA polypeptides, ActRIIB polypeptides, and GDF trap polypeptides within the scope of the methods described herein.
  • ActRII proteins have been characterized in the art in terms of structural and functional characteristics, particularly with respect to ligand binding [see, e.g., Attisano et al. (1992) Cell 68(1):97-108; Greenwald et al. (1999) Nature Structural Biology 6(1): 18-22;
  • Attisano et al. showed that a deletion of the proline knot at the C- terminus of the extracellular domain of ActRIIB reduced the affinity of the receptor for activin.
  • An ActRIIB-Fc fusion protein containing amino acids 20-119 of present SEQ ID NO: l, "ActRIIB(20-l 19)-Fc”, has reduced binding to GDF- 11 and activin relative to an ActRIIB(20-134)-Fc, which includes the proline knot region and the complete juxtamembrane domain (see, e.g., U.S. Patent No. 7,842,663).
  • an ActRIIB(20- 129)-Fc protein retains similar but somewhat reduced activity relative to the wild-type, even though the proline knot region is disrupted.
  • ActRIIB extracellular domains that stop at amino acid 134, 133, 132, 131, 130 and 129 are all expected to be active, but constructs stopping at 134 or 133 may be most active.
  • mutations at any of residues 129-134 are not expected to alter ligand-binding affinity by large margins.
  • mutations of P129 and P130 do not substantially decrease ligand binding.
  • an ActRIIB polypeptide or an ActRIIB-based GDF trap polypeptide of the present disclosure may end as early as amino acid 109 (the final cysteine), however, forms ending at or between 109 and 119 (e.g., 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, or 119) are expected to have reduced ligand binding.
  • Amino acid 119 (with respect to present SEQ ID NO: 1) is poorly conserved and so is readily altered or truncated.
  • ActRIIB polypeptides and ActRIIB- based GDF traps ending at 128 (with respect to present SEQ ID NO: l) or later should retain ligand binding activity.
  • ActRIIB polypeptides and ActRIIB-based GDF traps ending at or between 119 and 127 will have an intermediate binding ability. Any of these forms may be desirable to use, depending on the clinical or experimental setting.
  • ActRIIB polypeptides and ActRIIB-based GDF traps beginning at position 20, 21, 22, 23, and 24 should retain general ligand-biding activity
  • ActRIIB polypeptides and ActRIIB-based GDF traps beginning at positions 25, 26, 27, 28, and 29 are also expected to retain ligand-biding activity.
  • Data shown herein as well as in, e.g., U.S. Patent No. 7,842,663 demonstrates that, surprisingly, an ActRIIB construct beginning at 22, 23, 24, or 25 will have the most activity.
  • an active portion e.g. , ligand-binding activity of ActRIIB comprises amino acids 29-109 of SEQ ID NO: 1. Therefore ActRIIB polypeptides and ActRIIB-based GDF traps of the present disclosure may, for example, comprise an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRIIB beginning at a residue corresponding to amino acids 20-29 (e.g., beginning at amino acid 20, 21 , 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 and ending at a position corresponding to amino acids 109-134 (e.g., ending at amino acid 109, 1 10, 1 1 1 1 , 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, 133, or 134) of SEQ
  • polypeptides of the present disclosure do not comprise or consist of amino acids 29-109 of SEQ ID NO: 1.
  • Other examples include polypeptides that begin at a position from 20-29 (e.g., position 20, 21 , 22, 23, 24, 25, 26, 27, 28, or 29) or 21-29 (e.g., position 21 , 22, 23, 24, 25, 26, 27, 28, or 29) and end at a position from 1 19-134 (e.g., 1 19, 120, 121 , 122, 123, 124, 125,
  • 129, 129, 130, 131 , 132, 133, or 134 1 19-133 (e.g., 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, or 133), 129-134 (e.g., 129, 130, 131 , 132, 133, or 134), or 129-133 (e.g., 129, 130, 131 , 132, or 133) of SEQ ID NO: 1.
  • constructs that begin at a position from 20-24 (e.g., 20, 21 , 22, 23, or 24), 21-24 (e.g., 21 , 22, 23, or 24), or 22-25 (e.g., 22, 22, 23, or 25) and end at a position from 109-134 (e.g., 109, 1 10, 1 1 1 , 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121 , 122, 123, 124, 125, 126, 127, 128, 129, 130, 131 , 132, 133, or 134), 1 19-134 (e.g., 1 19, 120, 121 , 122, 123, 124, 125, 126,
  • 129-134 e.g., 129, 130, 131 , 132, 133, or 134. Variants within these ranges are also contemplated, particularly those having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the corresponding portion of SEQ ID NO: 1.
  • the ActRIIB polypeptides and ActRIIB-based GDF traps comprise a polypeptide having an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acid residues 25-131 of SEQ ID NO: 1. In certain embodiments, ActRIIB-based GDF trap polypeptides do not comprise or consist of amino acids 25-131 of SEQ ID NO: 1.
  • the disclosure includes the results of an analysis of composite ActRIIB structures, shown in Figure 1 , demonstrating that the ligand-binding pocket is defined, in part, by residues Y31 , N33, N35, L38 through T41 , E47, E50, Q53 through K55, L57, H58, Y60, S62, K74, W78 through N83, Y85, R87, A92, and E94 through F101.
  • R40 is a K in Xenopus, indicating that basic amino acids at this position will be tolerated.
  • a general formula for an ActRIIB polypeptide and ActRIIB-based GDF trap polypeptide of the disclosure is one that comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 29-109 of SEQ ID NO: 1, optionally beginning at a position ranging from 20-24 (e.g., 20, 21, 22, 23, or 24) or 22-25(e.g., 22, 23, 24, or 25) and ending at a position ranging from 129-134 (e.g., 129, 130, 131, 132, 133, or 134), and comprising no more than 1, 2, 5, 10 or 15 conservative amino acid changes in the ligand-binding pocket, and zero, one or more non-conservative alterations at positions 40, 53, 55, 74,
  • Sites outside the binding pocket include the amino and carboxy termini of the extracellular domain (as noted above), and positions 42-46 and 65-73 (with respect to SEQ ID NO:l).
  • An asparagine-to-alanine alteration at position 65 actually improves ligand binding in the A64 background, and is thus expected to have no detrimental effect on ligand binding in the R64 background (see, e.g., U.S. Patent No. 7,842,663). This change probably eliminates glycosylation at N65 in the A64 background, thus demonstrating that a significant change in this region is likely to be tolerated.
  • an active, human ActRIIB variant polypeptide and ActRIIB-based GDF trap useful in accordance with the presently disclosed methods may include one or more amino acids at corresponding positions from the sequence of another vertebrate ActRIIB, or may include a residue that is similar to that in the human or other vertebrate sequence.
  • L46 is a valine in Xenopus ActRIIB, and so this position may be altered, and optionally may be altered to another hydrophobic residue, such as V, I or F, or a non-polar residue such as A.
  • E52 is a K in Xenopus, indicating that this site may be tolerant of a wide variety of changes, including polar residues, such as E, D, K, R, H, S, T, P, G, Y and probably A.
  • T93 is a K in Xenopus, indicating that a wide structural variation is tolerated at this position, with polar residues favored, such as S, K, R, E, D, H, G, P, G and Y.
  • F 108 is a Y in Xenopus, and therefore Y or other hydrophobic group, such as I, V or L should be tolerated.
  • El 11 is K in Xenopus, indicating that charged residues will be tolerated at this position, including D, R, K and H, as well as Q and N.
  • Rl 12 is K in Xenopus, indicating that basic residues are tolerated at this position, including R and H.
  • a at position 119 is relatively poorly conserved, and appears as P in rodents and V in Xenopus, thus essentially any amino acid should be tolerated at this position.
  • N-X-S/T glycosylation site
  • ActRIIB(R64)-Fc form see, e.g., U.S. Patent No. 7,842,663
  • N-X-S/T sequences may be generally introduced at positions outside the ligand binding pocket defined in Figure 1 in ActRIIB polypeptide and ActRIIB-based GDF traps of the present disclosure.
  • Particularly suitable sites for the introduction of non-endogenous N-X-S/T sequences include amino acids 20-29, 20-24, 22-25, 109-134, 120-134 or 129-134 (with respect to SEQ ID NO: l).
  • N-X-S/T sequences may also be introduced into the linker between the ActRIIB sequence and an Fc domain or other fusion component.
  • Such a site may be introduced with minimal effort by introducing an N in the correct position with respect to a pre-existing S or T, or by introducing an S or T at a position corresponding to a pre-existing N.
  • desirable alterations that would create an N-linked glycosylation site are: A24N, R64N, S67N (possibly combined with an N65A alteration), E105N, Rl 12N, G120N, E123N, P129N, A132N, Rl 12S and Rl 12T (with respect to SEQ ID NO: 1).
  • an S that is predicted to be glycosylated may be altered to a T without creating an immunogenic site, because of the protection afforded by the glycosylation.
  • any T that is predicted to be glycosylated may be altered to an S.
  • the alterations S67T and S44T are contemplated.
  • an S26T alteration may be used.
  • an ActRIIB polypeptide and ActRIIB-based GDF trap polypeptide of the present disclosure may be a variant having one or more additional, non-endogenous N-linked glycosylation consensus sequences as described above.
  • the results of the mutagenesis program described herein indicate that there are amino acid positions in ActRIIB that are often beneficial to conserve.
  • SEQ ID NO: 1 these include position 64 (basic amino acid), position 80 (acidic or hydrophobic amino acid), position 78 (hydrophobic, and particularly tryptophan), position 37 (acidic, and particularly aspartic or glutamic acid), position 56 (basic amino acid), position 60 (hydrophobic amino acid, particularly phenylalanine or tyrosine).
  • the disclosure provides a framework of amino acids that may be conserved.
  • ActRIIA polypeptide is one that comprises a polypeptide that starts at amino acid 30 and ends at amino acid 1 10 of SEQ ID NO:9. Accordingly, ActRIIA polypeptides and ActRIIA-based GDF traps of the present disclosure may comprise a polypeptide that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 30-1 10 of SEQ ID NO:9.
  • ActRIIA-based GDF traps of the present disclosure do not comprise or consist of amino acids 30-1 10 of SEQ ID NO:9.
  • ActRIIA polypeptides and ActRIIA-based GDF trap polypeptides of the present disclosure comprise a polypeptide that is at least 80%>, 85%, 90%>, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids amino acids 12-82 of SEQ ID NO:9 optionally beginning at a position ranging from 1-5 (e.g., 1 , 2, 3, 4, or 5) or 3-5 (e.g., 3, 4, or 5) and ending at a position ranging from 1 10-1 16 (e.g., 1 10, 1 1 1 , 1 12, 1 13, 1 14, 1 15, or 1 16) or 1 10-1 15 (e.g., 1 10, 1 1 1 , 1 12, 1 13, 1 14, or 1 15), respectively, and comprising no more than 1 , 2, 5, 10 or 15 conservative amino acid changes in the ligand binding pocket, and zero
  • ActRIIA and ActRIIB polypeptides and GDF trap polypeptides of the present disclosure can be obtained by screening polypeptides recombinantly produced from the corresponding fragment of the nucleic acid encoding an ActRII polypeptide or GDF trap polypeptide (e.g., SEQ ID NOs: 7, 8, 12, 13, 27, 32, 39, 40, 42, 46, and 48).
  • fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry.
  • an ActRIIA polypeptide of the present disclosure is a polypeptide comprising an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NOs: 9, 10, 1 1 , 22, 26, and 28.
  • the ActRIIA polypeptide comprises an amino acid sequence that is at least 80%, 85%, 90%>, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 9, 10, 11, 22, 26, and 28.
  • the ActRIIA polypeptide consists essentially of, or consists of, an amino acid sequence that is at least 80%>, 85%, 90%>, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 9, 10, 11, 22, 26, and 28.
  • an ActRIIB polypeptide of the present disclosure is a polypeptide comprising an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NOs: 1, 2, 3, 4, 5, 6, 29, 31, and 49. In certain embodiments, the ActRIIB polypeptide comprises an amino acid sequence that is at least
  • the ActRIIB polypeptide consists essentially of, or consists of, an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 1, 2, 3, 4, 5, 6, 29, 31, and 49.
  • a GDF trap polypeptide of the present disclosure is a variant ActRIIB polypeptide comprising an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NOs: 1, 2, 3, 4, 5, 6, 29, 30, 31, 36, 37, 38, 41, 44, 45, 49, 50, and 51.
  • the GDF trap comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 1, 2, 3, 4, 5, 6, 29, 30, 31, 36, 37, 38, 41, 44, 45, 49, 50, and 51.
  • the GDF trap comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 1, 2, 3, 4, 5, 6, 29, 30, 31, 36, 37, 38, 41, 44, 45, 49, 50, and 51, wherein the position corresponding to L79 of SEQ ID NO: 1 , 4, or 49 is an acidic amino acids (a D or E amino acid residue).
  • the GDF trap consists essentially of, or consists of, an amino acid sequence that at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from SEQ ID NOs: 36, 37, 38, 41, 44, 45, 50, and 51. In certain embodiments, the GDF trap does not comprise or consists of an amino acid sequence selected from SEQ ID NOs: 1, 2, 3, 4, 5, 6, 29, and 31.
  • a GDF trap polypeptide of the present disclosure is a variant ActRIIA polypeptide comprising an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NOs: 9, 10, 11, 22, 26, 28, 29, and 31.
  • the GDF trap comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 9, 10, 11, 22, 26, 28, 29, and 31.
  • the GDF trap consists essentially of, or consists of, an amino acid sequence that at least 80%>, 85%, 90%>, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 9, 10, 11 , 22, 26, 28, 29, and 31. In certain embodiments, the GDF trap does not comprise or consists of an amino acid sequence selected from SEQ ID NOs: 9, 10, 11, 22, 26, 28, 29, and 31.
  • the present disclosure contemplates making functional variants by modifying the structure of an ActRII polypeptide (e.g. and ActRIIA or ActRIIB
  • Variants can be produced by amino acid substitution, deletion, addition, or combinations thereof. For instance, it is reasonable to expect that an isolated replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid (e.g., conservative mutations) will not have a major effect on the biological activity of the resulting molecule. Conservative replacements are those that take place within a family of amino acids that are related in their side chains.
  • Whether a change in the amino acid sequence of a polypeptide of the disclosure results in a functional homolog can be readily determined by assessing the ability of the variant polypeptide to produce a response in cells in a fashion similar to the wild-type polypeptide, or to bind to one or more ligands, such as GDF11, activin A, activin B, activin AB, activin C, activin E, GDF8, BMP6, and BMP7, as compared to the unmodified or a wild-type
  • polypeptide In certain embodiments, the present disclosure contemplates specific mutations of
  • ActRII polypeptides and GDF trap polypeptides of the present disclosure so as to alter the glycosylation of the polypeptide.
  • Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as 0-linked or N-linked glycosylation sites.
  • Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine or asparagine-X-serine (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
  • the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the polypeptide (for O-linked glycosylation sites).
  • a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
  • Another means of increasing the number of carbohydrate moieties on a polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide.
  • the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine. Removal of one or more carbohydrate moieties present on a polypeptide may be accomplished chemically and/or enzymatically.
  • Chemical deglycosylation may involve, for example, exposure of a polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N- acetylgalactosamine), while leaving the amino acid sequence intact.
  • Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al. [Meth. Enzymol. (1987) 138:350].
  • the sequence of a polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect, and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
  • ActRII polypeptides and GDF trap polypeptides of the present disclosure for use in humans may be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines are expected to be useful as well.
  • This disclosure further contemplates a method of generating mutants, particularly sets of combinatorial mutants of ActRII polypeptides and GDF trap polypeptides of the present disclosure, as well as truncation mutants. Pools of combinatorial mutants are especially useful for identifying ActRII and GDF trap sequences.
  • the purpose of screening such combinatorial libraries may be to generate, for example, polypeptides variants which have altered properties, such as altered pharmacokinetic or altered ligand binding.
  • a variety of screening assays are provided below, and such assays may be used to evaluate variants.
  • ActRII polypeptides and GDF trap polypeptides may be screened for ability to bind to an ActRII receptor, to prevent binding of an ActRII ligand (e.g., GDF11, GDF8, activin A, activin B, activin AB, activin C, activin E, BMP7, BMP6, and/or Nodal) to an ActRII polypeptide, or to interfere with signaling caused by an ActRII ligand.
  • an ActRII ligand e.g., GDF11, GDF8, activin A, activin B, activin AB, activin C, activin E, BMP7, BMP6, and/or Nodal
  • the activity of an ActRII polypeptides or GDF trap polypeptides may also be tested in a cell-based or in vivo assay.
  • the effect of an ActRII polypeptide or GDF trap polypeptide on the expression of genes involved in hematopoiesis may be assessed. This may, as needed, be performed in the presence of one or more recombinant ActRII ligand proteins ⁇ e.g., GDF11, GDF8, activin A, activin B, activin AB, activin C, activin E, BMP7, BMP6, and/or Nodal), and cells may be transfected so as to produce an ActRII polypeptide or GDF trap polypeptide, and optionally, an ActRII ligand.
  • ActRII ligand proteins e.g., GDF11, GDF8, activin A, activin B, activin AB, activin C, activin E, BMP7, BMP6, and/or Nodal
  • an ActRII polypeptide or GDF trap polypeptide may be administered to a mouse or other animal, and one or more blood measurements, such as an RBC count, hemoglobin, or reticulocyte count may be assessed using art-recognized methods.
  • Combinatorial-derived variants can be generated which have a selective or generally increased potency relative to a reference ActRII polypeptide or GDF trap polypeptide.
  • Such variants when expressed from recombinant DNA constructs, can be used in gene therapy protocols.
  • mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding unmodified ActRII polypeptide or GDF trap polypeptide.
  • the altered protein can be rendered either more stable or less stable to proteolytic degradation or other cellular processes which result in destruction, or otherwise inactivation, of an unmodified polypeptide.
  • Such variants can be utilized to alter ActRII polypeptide or GDF trap polypeptide levels by modulating the half-life of the polypeptide. For instance, a short half-life can give rise to more transient biological effects and, when part of an inducible expression system, can allow tighter control of recombinant ActRII polypeptide or GDF trap polypeptide levels within the cell.
  • mutations may be made in the linker (if any) and/or the Fc portion to alter the half-life of the protein.
  • a combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ActRII or GDF trap sequences.
  • a mixture of synthetic oligonucleotides can be
  • the library of potential homologs can be generated from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes can then be ligated into an appropriate vector for expression. The synthesis of degenerate oligonucleotides is well known in the art.
  • ActRII polypeptides or GDF trap polypeptides of the present disclosure can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis [see, e.g., Ruf et al. (1994) Biochemistry 33: 1565-1572; Wang et al. (1994) J. Biol. Chem. 269:3095-3099; Balint et al. (1993) Gene 137:109-118; Grodberg et al.
  • Linker scanning mutagenesis is an attractive method for identifying truncated (bioactive) forms of ActRII polypeptides.
  • the most widely used techniques for screening large gene libraries typically comprises cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
  • Preferred assays include ActRII ligand (e.g., GDF1 1 , GDF 8, activin A, activin B, activin AB, activin C, activin E, BMP7, BMP6, and/or Nodal) binding assays and/or ActRII ligand-mediated cell signaling assays.
  • ActRII polypeptides or GDF trap polypeptides of the present disclosure may further comprise post-translational modifications in addition to any that are naturally present in the ActRII (e.g. , an ActRIIA or ActRIIB polypeptide) or GDF trap polypeptide.
  • Such modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
  • the ActRII polypeptide or GDF trap polypeptide may contain non-amino acid elements, such as polyethylene glycols, lipids, polysaccharide or monosaccharide, and phosphates.
  • a polypeptide of the disclosure is produced in cells by cleaving a nascent form of the polypeptide, post-translational processing may also be important for correct folding and/or function of the protein.
  • Different cells e.g., CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293 have specific cellular machinery and
  • characteristic mechanisms for such post-translational activities may be chosen to ensure the correct modification and processing of the ActRII polypeptides or GDF trap polypeptides.
  • ActRII polypeptides or GDF trap polypeptides of the present disclosure include fusion proteins having at least a portion (domain) of an ActRII polypeptide (e.g. , an ActRIIA or ActRIIB polypeptide) or GDF trap polypeptide and one or more heterologous portions (domains).
  • fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S-transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy-chain constant region (Fc), maltose binding protein (MBP), or human serum albumin.
  • a fusion domain may be selected so as to confer a desired property.
  • fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
  • relevant matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used.
  • Many of such matrices are available in "kit” form, such as the Pharmacia GST purification system and the QIAexpressTM system (Qiagen) useful with (HIS 6 ) fusion partners.
  • a fusion domain may be selected so as to facilitate detection of the ligand trap polypeptides.
  • detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
  • epitope tags for which specific monoclonal antibodies are readily available include FLAG, influenza virus haemagglutinin (HA), and c-myc tags.
  • the fusion domains have a protease cleavage site, such as for Factor Xa or thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation.
  • an ActRII polypeptide or a GDF trap polypeptide is fused with a domain that stabilizes the polypeptide in vivo (a "stabilizer” domain).
  • stabilizing is meant anything that increases serum half-life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect. Fusions with the Fc portion of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins.
  • fusions to human serum albumin can confer desirable properties.
  • Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function, such as further stimulation of muscle growth).
  • the present disclosure provides ActRII or GDF trap fusion proteins comprising the following IgGl Fc domain sequence:
  • the present disclosure provides ActRII or GDF trap fusion proteins comprising the following variant of the IgGl Fc domain:
  • VKFNWYVDGV EVHNAKTKPR EEQYNSTYRV VSVLTVLHQD WLNGKEYKCK 101 VSNKALPAPI EKTISKAKGQ PREPQVYTLP PSREEMTKNQ VSLTCLVKGF 151 YPSDIAVEWE SNGQPENNYK TTPPVLDSDG SFFLYSKLTV DKSRWQQGNV 201 FSCSVMHEAL HNHYTQKSLS LSPGK (SEQ ID NO:64)
  • the present disclosure provides ActRII or GDF trap fusion proteins comprising the following variant of the IgGl Fc domain: 1 THTCPPCPAP ELLGGPSVFL FPPKPKDTLM ISRTPEVTCV VVD (A) VSHEDPE
  • VKFNWYVDGV EVHNAKTKPR EEQYNSTYRV VSVLTVLHQD WLNGKEYKCK A) 101 VSNKALPVPI EKTISKAKGQ PREPQVYTLP PSREEMTKNQ VSLTCLVKGF 151 YPSDIAVEWE SNGQPENNYK TTPPVLDSDG PFFLYSKLTV DKSRWQQGNV 201 FSCSVMHEAL HN (A) HYTQKSLS LSPGK (SEQ ID NO: 15).
  • the IgGl Fc domain has one or more mutations at residues such as Asp-
  • mutant IgGl Fc domain having one or more of these mutations has reduced ability of binding to the Fey receptor relative to a wild-type Fc domain.
  • mutant Fc domain having one or more of these mutations has increased ability of binding to the MHC class I-related Fc-receptor (FcRN) relative to a wild-type IgGl Fc domain.
  • the present disclosure provides ActRII or GDF trap fusion proteins comprising variants of the IgG2 Fc domain, including the following:
  • an ActRII polypeptide domain or GDF trap polypeptide domain may be placed C-terminal to a heterologous domain, or alternatively, a heterologous domain may be placed C-terminal to an ActRII polypeptide domain or GDF trap polypeptide domain.
  • the ActRII polypeptide domain or GDF trap polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
  • an ActRII or GDF trap fusion protein may comprise an amino acid sequence as set forth in the formula A-B-C.
  • the B portion corresponds to an ActRII polypeptide domain or a GDF trap polypeptide domain.
  • the A and C portions may be independently zero, one, or more than one amino acid, and both the A and C portions when present are heterologous to B.
  • the A and/or C portions may be attached to the B portion via a linker sequence.
  • Exemplary linkers include short polypeptide linkers such as 2-10, 2-5, 2-4, 2-3 glycine residues, such as, for example, a Gly-Gly-Gly linker.
  • an ActRII or GDF trap fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a leader (signal) sequence, B consists of an ActRII or GDF polypeptide domain, and C is a polypeptide portion that enhances one or more of in vivo stability, in vivo half- life, uptake/administration, tissue localization or distribution, formation of protein complexes, and/or purification.
  • an ActRII or GDF trap fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a TPA leader sequence, B consists of an ActRII or GDF polypeptide domain, and C is an immunoglobulin Fc domain.
  • Preferred fusion proteins comprises the amino acid sequence set forth in any one of SEQ ID NOs: 22, 26, 29, 31, 36, 38, 41, 44, and 51.
  • ActRII polypeptides or GDF trap polypeptides of the present disclosure contain one or more modifications that are capable of stabilizing the polypeptides.
  • Such modifications enhance the in vitro half-life of the polypeptides, enhance circulatory half-life of the polypeptides, and/or reduce proteolytic degradation of the polypeptides.
  • Such stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an ActRII polypeptide domain or a GDF trap polypeptide domain and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a glycosylation site to a polypeptide of the disclosure), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from a polypeptide of the disclosure).
  • the term "stabilizer domain” not only refers to a fusion domain (e.g., an immunoglobulin Fc domain) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous moiety, such as polyethylene glycol.
  • ActRII polypeptides and GDF traps to be used in accordance with the methods described herein are isolated polypeptides.
  • an isolated protein or polypeptide is one which has been separated from a component of its natural environment.
  • a polypeptide of the disclosure is purified to greater than 95%, 96%, 97%, 98%, or 99% purity as determined by, for example,
  • ActRII polypeptides and GDF traps of the disclosure can be produced by a variety of art-known techniques.
  • polypeptides of the disclosure can be synthesized using standard protein chemistry techniques such as those described in Bodansky, M. Principles of Peptide Synthesis, Springer Verlag, Berlin (1993) and Grant G. A.
  • polypeptides of the disclosure may be recombinantly produced using various expression systems [e.g., E. coli, Chinese Hamster Ovary (CHO) cells, COS cells, baculovirus] as is well known in the art.
  • expression systems e.g., E. coli, Chinese Hamster Ovary (CHO) cells, COS cells, baculovirus
  • unmodified polypeptides of the disclosure may be produced by digestion of recombinantly produced full-length ActRII or GDF trap polypeptides by using, for example, a protease, e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
  • a protease e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
  • Computer analysis using a commercially available software, e.g., MacVector, Omega, PCGene, Molecular Simulation, Inc.
  • such polypeptides may be produced from recombinantly produced full- length ActRII or GDF trap polypeptides using chemical cleavage (e.g., cyanogen bromide, hydroxylamine, etc.).
  • ActRII polypeptides disclosed herein e.g. , ActRIIA or ActRIIB
  • polypeptides can be combined with one or more additional ActRII antagonist agents of the disclosure to achieve the desired effect (e.g., increase red blood cell levels and/or hemoglobin in a subject in need thereof, treat or prevent an anemia, treat MDS or sideroblastic anemias, treat or prevent one or more complications of MDS or sideroblastic anemias s).
  • additional ActRII antagonist agents of the disclosure e.g., increase red blood cell levels and/or hemoglobin in a subject in need thereof, treat or prevent an anemia, treat MDS or sideroblastic anemias, treat or prevent one or more complications of MDS or sideroblastic anemias s).
  • an ActRII polypeptide disclosed herein can be used in combination with i) one or more additional ActRII polypeptides disclosed herein, ii) one or more GDF traps disclosed herein; iii) one or more ActRII antagonist antibodies disclosed herein (e.g., an anti-activin A antibody, an anti-activin B antibody, an anti-activin C antibody, an anti-activin E antibody, an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-BMP6 antibody, an anti-BMP7 antibody, an anti-ActRIIA antibody, and/or or an anti-ActRIIB antibody); iv) one or more small-molecule ActRII antagonists disclosed herein (e.g.
  • any of the GDF traps disclosed herein can be combined with one or more additional ActRII antagonist agents of the disclosure to achieve the desired effect (e.g., increase red blood cell levels and/or hemoglobin in a patient in need thereof, treat or prevent an anemia, treat MDS or sideroblastic anemias, treat or prevent one or more complications of MDS or sideroblastic anemias).
  • a GDF trap disclosed herein can be used in combination with i) one or more additional GDF traps disclosed herein, ii) one or more ActRII polypeptides disclosed herein (e.g.
  • ActRIIA or ActRIIB polypeptides disclosed herein; iii) one or more ActRII antagonist antibodies disclosed herein (e.g., an anti-activin A antibody, an anti-activin B antibody, an anti-activin C antibody, an anti-activin E antibody, an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-BMP6 antibody, an anti-BMP7 antibody, an anti-ActRIIA antibody, and/or or an anti-ActRIIB antibody); iv) one or more small-molecule ActRII antagonists disclosed herein (e.g., an anti-activin A antibody, an anti-activin B antibody, an anti-activin C antibody, an anti-activin E antibody, an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-BMP6 antibody, an anti-BMP7 antibody, an anti-ActRIIA antibody, and/or or an anti-ActRIIB antibody); iv) one or more small-molecule ActRII antagonists disclosed here
  • the present disclosure provides isolated and/or recombinant nucleic acids encoding the ActRII polypeptides and GDF trap polypeptides (including fragments, functional variants, and fusion proteins thereof) disclosed herein.
  • SEQ ID NO: 12 encodes the naturally occurring human ActRII A precursor polypeptide
  • SEQ ID NO: 13 encodes the processed extracellular domain of ActRIIA
  • SEQ ID NO: 7 encodes a naturally occurring human ActRIIB precursor polypeptide (the R64 variant described above)
  • SEQ ID NO: 8 encodes the processed extracellular domain of
  • the subject nucleic acids may be single-stranded or double stranded. Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making ActRII-based ligand trap polypeptides of the present disclosure.
  • isolated nucleic acid(s) refers to a nucleic acid molecule that has been separated from a component of its natural environment.
  • An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
  • nucleic acids encoding ActRII polypeptides and GDF traps of the present disclosure are understood to include nucleic acids that are variants of any one of SEQ ID NOs: 7, 8, 12, 13, 27, 32, 39, 40, 42, 43, 46, 47, and 48.
  • Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions, or deletions including allelic variants, and therefore, will include coding sequence that differ from the nucleotide sequence designated in any one of SEQ ID NOs: 7, 8, 12, 13, 27, 32, 39, 40, 42, 43, 46, 47, and 48.
  • ActRII polypeptides and GDF traps of the present disclosure are encoded by isolated or recombinant nucleic acid sequences that are at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to SEQ ID NOs: 7, 8, 12, 13, 27, 32, 39, 40, 42, 43, 46, 47, and 48
  • GDF traps of the present disclosure are not encoded by nucleic acid sequences that comprise or consist of any one of nucleotide sequences
  • nucleic acid sequences that are at least 80%>, 85%, 90%>, 95%, 97%, 98%o, or 99%) identical to the sequences complementary to SEQ ID NOs: 7, 8, 12, 13, 27, 32, 39, 42, 47, and 48, and variants thereof, are also within the scope of the present disclosure.
  • the nucleic acid sequences of the disclosure can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
  • nucleic acids of the present disclosure also include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NOs: 7, 8, 12, 13, 27, 32, 39, 40, 42, 43, 46, 47, and 48, complement sequences of SEQ ID NOs: 7, 8, 12, 13, 27, 32, 39, 40, 42, 43, 46, 47, and 48, or fragments thereof.
  • appropriate stringency conditions which promote DNA hybridization can be varied.
  • appropriate stringency conditions which promote DNA hybridization can be varied. For example, one could perform the
  • the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 °C to a high stringency of about 0.2 x SSC at 50 °C.
  • the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 °C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
  • the disclosure provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
  • Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NOs: 7, 8, 12, 13, 27, 32, 39, 40, 42, 43, 46, 47, and 48 due to degeneracy in the genetic code are also within the scope of the disclosure.
  • a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
  • CAU and CAC are synonyms for histidine
  • nucleotides up to about 3-5% of the nucleotides
  • nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this disclosure.
  • the recombinant nucleic acids of the present disclosure may be operably linked to one or more regulatory nucleotide sequences in an expression construct. Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art for a variety of host cells.
  • said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the disclosure.
  • the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
  • An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
  • the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
  • the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding an ActRII polypeptide or a GDF trap and operably linked to at least one regulatory sequence.
  • Regulatory sequences are art-recognized and are selected to direct expression of the ActRII or GDF trap polypeptide. Accordingly, the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, CA (1990).
  • any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an ActRII or GDF trap polypeptide.
  • useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast a-mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of
  • the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
  • a recombinant nucleic acid of the present disclosure can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
  • Expression vehicles for production of a recombinant ActRII or GDF trap polypeptide include plasmids and other vectors.
  • suitable vectors include plasmids of the following types: pBR322- derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
  • Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
  • the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
  • vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
  • derivatives of viruses such as the bovine papilloma virus (BPV-1), or Epstein- Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
  • BBV-1 bovine papilloma virus
  • pHEBo Epstein- Barr virus
  • examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
  • the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
  • suitable expression systems for both prokaryotic and eukaryotic cells, as well as general recombinant procedures see, e.g., Molecular Cloning A
  • baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the ⁇ -gal containing pBlueBac III).
  • a vector will be designed for production of the subject ActRII or GDF trap polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
  • a Pcmv-Script vector (Stratagene, La Jolla, Calif)
  • pcDNA4 vectors Invitrogen, Carlsbad, Calif.
  • pCI-neo vectors Promega, Madison, Wise
  • This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence for one or more of the subject ActRII or GDF trap polypeptides.
  • the host cell may be any prokaryotic or eukaryotic cell.
  • an ActRII or GDF trap polypeptide of the disclosure may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells [e.g. a Chinese hamster ovary (CHO) cell line].
  • Other suitable host cells are known to those skilled in the art.
  • the present disclosure further pertains to methods of producing the subject ActRII and GDF trap polypeptides.
  • a host cell transfected with an expression vector encoding an ActRII or GDF trap polypeptide can be cultured under appropriate conditions to allow expression of the ActRII or GDF trap polypeptide to occur.
  • the polypeptide may be secreted and isolated from a mixture of cells and medium containing the polypeptide.
  • the ActRII or GDF trap polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
  • a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
  • the subject polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, immunoaffinity purification with antibodies specific for particular epitopes of the ActRII or GDF trap polypeptides, and affinity purification with an agent that binds to a domain fused to the ActRII or GDF trap polypeptide ⁇ e.g., a protein A column may be used to purify an ActRII-Fc or GDF Trap-Fc fusion protein).
  • the ActRII or GDF trap polypeptide is a fusion protein containing a domain which facilitates its purification.
  • purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenylsepharose chromatography, size exclusion chromatography, and cation exchange chromatography.
  • the purification could be completed with viral filtration and buffer exchange.
  • An ActRII-Fc or GDF trap-Fc protein may be purified to a purity of >90%, >95%, >96%, >98%, or >99% as determined by size exclusion chromatography and >90%, >95%, >96%, >98%, or >99% as determined by SDS PAGE.
  • a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant ActRII or GDF trap polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni 2+ metal resin. The purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified ActRII or GDF trap polypeptide. See, e.g., Hochuli et al. (1987)
  • fusion genes are well known. Essentially, the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
  • the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
  • PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence. See, e.g., Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992.
  • the present disclosure relates to an antibody, or combination of antibodies, that antagonize ActRII activity ⁇ e.g., inhibition of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 and/or SMAD 1/5/8 signaling).
  • Such antibodies may bind to and inhibit one or more ligands (e.g., GDF 8, GDF11, activin A, activin B, activin C, activin E, BMP6, BMP7 or Nodal) or one or more receptors (e.g., ActRIIA, ActRIIB, ALK4, ALK5).
  • the disclosure provides methods of using an antibody ActRII antagonist, or combination of antibody ActRII antagonists,alone or in combination with one or more erythropoiesis stimulating agents ⁇ e.g. , EPO) or other supportive therapies [e.g., hematopoietic growth factors (e.g., G-CSF or GM-CSF), transfusion of red blood cells or whole blood, iron chelation therapy], to, e.g., increase red blood cell levels in a subject in need thereof, treat or prevent an anemia in a subject in need thereof (including, e.g., reduction of transfusion burden), treat MDS or sideroblastic anemias in a subject in need thereof, and/or treat or prevent one or more complications of MDS or sideroblastic anemias (e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lympho
  • a preferred antibody ActRII antagonist of the disclosure is an antibody, or combination of antibodies, that binds to and/or inhibits activity of at least GDFl 1 (e.g., GDFl 1 -mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • GDFl 1 e.g., GDFl 1 -mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling.
  • the antibody, or combination of antibodies further binds to and/or inhibits activity of GDF8 (e.g., GDF8-mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling), particularly in the case of a multispecific antibody that has binding affinity for both GDFl 1 and GDF8 or in the context of a combination of one or more anti-GDFl 1 antibodies and one or more anti-GDF8 antibodies.
  • an antibody, or combination of antibodies, of the disclosure does not substantially bind to and/or inhibit activity of activin A (e.g., activin A-mediated activation of ActRIIA or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • an antibody, or combination of antibodies, of the disclosure that binds to and/or inhibits the activity of GDFl 1 and/or GDF8 further binds to and/or inhibits activity of one of more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, and Nodal (e.g., activation of ActRIIA or ActRIIB SMAD 2/3 and/or SMAD 1/5/8 signaling), particularly in the case of a multispecific antibody that has binding affinity for multiple ActRII ligands or in the context of a combination of multiple antibodies - each having binding affinity for a different ActRII ligand.
  • an ActRII antagonist of the present disclosure is an antibody, or combination of antibodies, that binds to and/or inhibits activity of at least GDF8 (e.g., GDF8- mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • GDF8 e.g., GDF8- mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling.
  • the antibody, or combination of antibodies further binds to and/or inhibits activity of GDFl 1 (e.g., GDFl 1 -mediated activation of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling), particularly in the case of a multispecific antibody that has binding affinity for both GDF8 and GDFl 1 or in the context of a combination of one or more anti-GDF8 antibodies and one or more anti-GDFl 1 antibodies.
  • an antibody, or combination of antibodies, of the disclosure does not substantially bind to and/or inhibit activity of activin A (e.g., activin A-mediated activation of ActRIIA or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • an antibody, or combination of antibodies, of the disclosure that binds to and/or inhibits the activity of GDF8 and/or GDFl 1 further binds to and/or inhibits activity of one of more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, and Nodal (e.g. , activation of ActRIIA or ActRIIB signaling transduction, such as SMAD 2/3 and/or SMAD 1/5/8 signaling), particularly in the case of a multispecific antibody that has binding affinity for multiple ActRII ligands or in the context of a combination multiple antibodies - each having binding affinity for a different ActRII ligand.
  • activin A activin B, activin AB, activin C, activin E, BMP6, BMP7, and Nodal
  • activation of ActRIIA or ActRIIB signaling transduction such as SMAD 2/3 and/or SMAD 1/5/8 signaling
  • an ActRII antagonist of the present disclosure is an antibody, or combination of antibodies, that binds to and/or inhibits activity of an ActRII receptor (e.g. an ActRIIA or ActRIIB receptor).
  • an anti- ActRII receptor antibody e.g. an anti-ActRIIA or anti-ActRIIB receptor antibody
  • an anti-ActRII receptor antibody, or combination of antibodies, of the disclosure further prevents binding and/or activation of the ActRII receptor by GDF8.
  • an anti-ActRII receptor antibody, or combination of antibodies, of the disclosure does not substantially inhibit activin A from binding to and/or activating an ActRII receptor.
  • an anti-ActRII receptor antibody, or combination of antibodies, of the disclosure that binds to an ActRII receptor and prevents binding and/or activation of the ActRII receptor by GDFl 1 and/or GDF8 further prevents binding and/or activation of the ActRII receptor by one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, and Nodal.
  • antibody is used herein in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
  • An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies; linear antibodies; single-chain antibody molecules (e.g., scFv); and multispecific antibodies formed from antibody fragments. See, e.g., Hudson et al.
  • Antibodies disclosed herein may be polyclonal antibodies or monoclonal antibodies.
  • the antibodies of the present disclosure comprise a label attached thereto and able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme, or enzyme co-factor).
  • the antibodies of the present disclosure are isolated antibodies.
  • Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, e.g., EP 404,097; WO 1993/01161; Hudson et al. (2003) Nat. Med. 9:129- 134 (2003); and Hollinger et al. (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448.
  • Single-domain antibodies are antibody fragments comprising all or a portion of the heavy-chain variable domain or all or a portion of the light-chain variable domain of an antibody.
  • a single-domain antibody is a human single-domain antibody. See, e.g., U.S. Pat. No. 6,248,516.
  • Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.
  • recombinant host cells e.g., E. coli or phage
  • the antibodies herein may be of any class.
  • the class of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
  • the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu.
  • an antibody for use in the methods disclosed herein specifically binds to its target antigen, preferably with high binding affinity.
  • Affinity may be expressed as a K D value and reflects the intrinsic binding affinity (e.g., with minimized avidity effects).
  • binding affinity is measured in vitro, whether in a cell-free or cell-associated setting. Any of a number of assays known in the art, including those disclosed herein, can be used to obtain binding affinity measurements including, for example, surface plasmon resonance (BiacoreTM assay), radiolabeled antigen binding assay (RIA), and ELISA.
  • antibodies of the present disclosure bind to their target antigens (e.g.
  • GDF11, GDF8, ActRIIA, ActRIIB, etc. with at least a K D of lx 10 ⁇ 7 or stronger, lxlO "8 or stronger, lxlO "9 or stronger, lxl 0 "10 or stronger, lxl 0 "11 or stronger, lxl 0 ⁇ 12 or stronger, lxl 0 ⁇ 13 or stronger, or lxl 0 ⁇ 14 or stronger.
  • K D is measured by RIA performed with the Fab version of an antibody of interest and its target antigen as described by the following assay.
  • Solution binding affinity of Fabs for the antigen is measured by equilibrating Fab with a minimal concentration of radiolabeled antigen (e.g., 125 I-labeled) in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate [see, e.g., Chen et al. (1999) J. Mol. Biol. 293:865-881].
  • multi-well plates e.g., MICROTITER ® from Thermo Scientific
  • a capturing anti-Fab antibody e.g. , from Cappel Labs
  • bovine serum albumin preferably at room temperature (approximately 23°C).
  • radiolabeled antigen are mixed with serial dilutions of a Fab of interest [e.g., consistent with assessment of the anti-VEGF antibody, Fab-12, in Presta et al., (1997) Cancer Res. 57:4593-4599].
  • the Fab of interest is then incubated, preferably overnight but the incubation may continue for a longer period (e.g. , about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation, preferably at room temperature for about one hour. The solution is then removed and the plate is washed times several times, preferably with polysorbate 20 and PBS mixture. When the plates have dried, scintillant (e.g., MICROSCINT ® from Packard) is added, and the plates are counted on a gamma counter (e.g., TOPCOUNT ® from Packard).
  • K D is measured using surface plasmon resonance assays using, for example a BIACORE ® 2000 or a BIACORE ® 3000 (Biacore, Inc.,
  • CM5 carboxymethylated dextran biosensor chips
  • EDC N-ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride
  • NHS N- hydroxysuccinimide
  • an antigen can be diluted with 10 mM sodium acetate, pH 4.8, to 5 ⁇ g/ml (about 0.2 ⁇ ) before injection at a flow rate of 5 ⁇ /minute to achieve approximately 10 response units (RU) of coupled protein.
  • a fluorescent quenching technique
  • anti-GDFl 1 antibody generally refers to an antibody that is capable of binding to GDF11 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDF11.
  • the extent of binding of an anti-GDFl 1 antibody to an unrelated, non-GDFl 1 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than 1% of the binding of the antibody to GDF11 as measured, for example, by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an anti- GDFl 1 antibody binds to an epitope of GDF11 that is conserved among GDF11 from different species.
  • an anti-GDFl 1 antibody of the present disclosure is an antagonist antibody that can inhibit GDF11 activity.
  • an anti- GDFl 1 antibody of the disclosure may inhibit GDF11 from binding to a cognate receptor ⁇ e.g. , ActPvIIA or ActRIIB receptor) and/or inhibit GDF 11 -mediated signal transduction
  • anti-GDFl 1 antibodies of the present disclosure do not substantially bind to and/or inhibit activity of activin A. It should be noted that GDF11 has high sequence homology to GDF8 and therefore antibodies that bind and/or to GDF11, in some cases, may also bind to and/or inhibit GDF8.
  • an anti-GDF8 antibody refers to an antibody that is capable of binding to GDF8 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDF8.
  • the extent of binding of an anti-GDF8 antibody to an unrelated, non-GDF8 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than 1% of the binding of the antibody to GDF8 as measured, for example, by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an anti-GDF8 antibody binds to an epitope of GDF8 that is conserved among GDF8 from different species.
  • an anti-GDF8 antibody of the present disclosure is an antagonist antibody that can inhibit GDF8 activity.
  • an anti-GDF8 antibody of the disclosure may inhibit GDF8 from binding to a cognate receptor (e.g., ActRIIA or ActRIIB receptor) and/or inhibit GDF8-mediated signal transduction (activation) of a cognate receptor, such as SMAD2/3 signaling by ActRIIA and/or ActRIIB receptors.
  • anti-GDF8 antibodies of the present disclosure do not substantially bind to and/or inhibit activity of activin A. It should be noted that GDF8 has high sequence homology to GDFl 1 and therefore antibodies that bind and/or to GDF8, in many cases, may also bind to and/or inhibit GDF1 1.
  • an anti-ActRIIA antibody refers to an antibody that is capable of binding to ActRIIA with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ActRIIA.
  • the extent of binding of an anti-ActRIIA antibody to an unrelated, non- ActRIIA protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%), 3%), 2%>, or less than 1% of the binding of the antibody to ActRIIA as measured, for example, by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an anti-ActRIIA antibody binds to an epitope of ActRIIA that is conserved among ActRIIA from different species.
  • an anti-ActRIIA antibody of the present disclosure is an antagonist antibody that can inhibit ActRIIA activity.
  • an anti-ActRIIA antibody of the present disclosure may inhibit one or more ActRIIA ligands selected from activin A, activin B, activin AB, activin C, activin E, GDFl 1 , GDF8, activin A, BMP6, and BMP7 from binding to the ActRIIA receptor and/or inhibit one of these ligands from activating ActRIIA signaling (e.g., SMAD2/3 and/or SMAD 1/5/8 ActRIIA signaling).
  • ActRIIA signaling e.g., SMAD2/3 and/or SMAD 1/5/8 ActRIIA signaling.
  • anti-ActRIIA antibodies of the present disclosure inhibit GDFl 1 from binding to the ActRIIA receptor and/or inhibit GDFl 1 from activating ActRIIA signaling.
  • anti-ActRIIA antibodies of the disclosure further inhibit GDF8 from binding to the ActRIIA receptor and/or inhibit GDF8 from activating ActRIIA signaling.
  • anti-ActRIIA antibodies of the present disclosure do not substantially inhibit activin A from binding to the ActRIIA receptor and/or do not substantially inhibit activin A-mediated activation of ActRIIA signaling.
  • an anti-ActRIIA antibody of the disclosure that inhibits GDF1 1 and/or GDF8 from binding to and/or activating an ActRIIA receptor further inhibits one or more of activin A, activin B, activin AB, activin C, activin E, activin A, GDF8, BMP6, and BMP7 from binding to and/or activating the ActRIIA receptor.
  • an anti-ActRIlB antibody refers to an antibody that is capable of binding to ActRIIB with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ActRIIB.
  • the extent of binding of an anti-ActRIIB antibody to an unrelated, non- ActRIIB protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than 1% of the binding of the antibody to ActRIIB as measured, for example, by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an anti-ActRIIB antibody binds to an epitope of ActRIIB that is conserved among ActRIIB from different species.
  • an anti-ActRIIB antibody of the present disclosure is an antagonist antibody that can inhibit ActRIIB activity.
  • an anti-ActRIIB antibody of the present disclosure may inhibit one or more ActRIIB ligands selected from activin A, activin B, activin AB, activin C, activin E, GDF1 1 , GDF8, activin A, BMP6, and BMP7 from binding to the ActRIIB receptor and/or inhibit one of these ligands from activating ActRIIB signaling (e.g., SMAD2/3 and/or SMAD 1/5/8 ActRIIB signaling).
  • ActRIIB signaling e.g., SMAD2/3 and/or SMAD 1/5/8 ActRIIB signaling.
  • anti-ActRIIB antibodies of the present disclosure inhibit GDF1 1 from binding to the ActRIIB receptor and/or inhibit GDF1 1 from activating ActRIIB signaling.
  • anti-ActRIIB antibodies of the disclosure further inhibit GDF8 from binding to the ActRIIB receptor and/or inhibit GDF8 from activating ActRIIB signaling.
  • anti-ActRIIB antibodies of the present disclosure do not substantially inhibit activin A from binding to the ActRIIB receptor and/or do not substantially inhibit activin A-mediated activation of ActRIIB signaling.
  • an anti-ActRIIB antibody of the disclosure that inhibits GDF1 1 and/or GDF8 from binding to and/or activating an ActRIIB receptor further inhibits one or more of activin A, activin B, activin AB, activin C, activin E, activin A, GDF8, BMP6, and BMP7 from binding to and/or activating the ActRIIB receptor.
  • nucleic acid and amino acid sequences of human GDF1 1 , GDF8, activin A, activin B, activin AB, activin C, activin E, GDF8, BMP6, BMP7, ActRIIB, and ActRIIA are well known in the art and thus antibody antagonists for use in accordance with this disclosure may be routinely made by the skilled artisan based on the knowledge in the art and teachings provided herein.
  • an antibody provided herein is a chimeric antibody.
  • a chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species. Certain chimeric antibodies are described, for example, in U.S. Pat. No. 4,816,567; and Morrison et al., (1984) Proc. Natl. 5 Acad. Sci. USA, 81 :6851-6855.
  • a chimeric antibody comprises a non-human variable region ⁇ e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region.
  • a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody.
  • chimeric antibodies include antigenic ) binding fragments thereof.
  • a chimeric antibody provided herein ⁇ e.g., an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-ActRIIA antibody, or an anti-ActRIIB antibody
  • a humanized antibody refers to a chimeric antibody comprising amino acid residues from non-human hypervariable regions (HVRs) and amino acid residues
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
  • a humanized antibody optionally may comprise at least a portion of an antibody constant region derived
  • a "humanized form" of an antibody e.g., a non-human antibody, refers to an antibody that has undergone humanization.
  • Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best- fit” method [see, e.g., Sims et al.
  • an antibody provided herein e.g., an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-ActRIIA antibody, or an anti-ActRIIB antibody
  • Human antibodies can be produced using various techniques known in the art.
  • Human antibodies may be prepared by administering an immunogen (e.g., a GDF11 polypeptide, GDF8 polypeptide, an ActRIIA polypeptide, or an ActRIIB polypeptide) to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge.
  • an immunogen e.g., a GDF11 polypeptide, GDF8 polypeptide, an ActRIIA polypeptide, or an ActRIIB polypeptide
  • Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic animals, the endogenous immunoglobulin loci have generally been inactivated.
  • Human antibodies provided herein can also be made by hybridoma-based methods.
  • Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described [see, e.g., Kozbor J. Immunol, (1984) 133: 3001; Brodeur et al. (1987) Monoclonal Antibody Production Techniques and Applications, pp. 51- 63, Marcel Dekker, Inc., New York; and Boerner et al. (1991) J. Immunol., 147: 86].
  • Human antibodies generated via human B-cell hybridoma technology are also described in Li et al., (2006) Proc. Natl. Acad. Sci. USA, 103:3557-3562.
  • Additional methods include those described, for example, in U.S. Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue (2006) 26(4):265-268 (2006) (describing human-human hybridomas).
  • Human hybridoma technology Trioma technology is also described in Vollmers and Brandlein (2005) Histol. HistopathoL, 20(3):927-937 (2005) and Vollmers and Brandlein (2005) Methods Find Exp. Clin. Pharmacol, 27(3): 185-91.
  • Human antibodies provided herein may also be generated by isolating Fv clone variable-domain sequences selected from human-derived phage display libraries. Such variable-domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described herein.
  • antibodies of the present disclosure may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities.
  • a variety of methods are known in the art for generating phage-display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, for example, in Hoogenboom et al. (2001) in Methods in Molecular Biology 178: 1- 37, O'Brien et al., ed., Human Press, Totowa, N.J. and further described, for example, in the McCafferty et al. (1991) Nature 348:552-554; Clackson et al., (1991) Nature 352: 624-628; Marks et al. (1992) J. Mol. Biol.
  • repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al. (1994) Ann. Rev. Immunol., 12: 433-455.
  • Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
  • Libraries from immunized sources provide high-affinity antibodies to the immunogen (e.g., GDF11, activin B, ActRIIA, or ActRIIB) without the requirement of constructing hybridomas.
  • naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies directed against a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al. (1993) EMBO J, 12: 725-734.
  • naive libraries can also be made synthetically by cloning un-rearranged V-gene segments from stem cells and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter (1992) J. Mol. Biol, 227: 381-388.
  • Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No.
  • an antibody provided herein is a multispecific antibody, for example, a bispecific antibody.
  • Multispecific antibodies typically monoclonal antibodies
  • a multispecific antibody of the present disclosure comprises two or more binding specificities, with at least one of the binding specificities being for a GDF11 epitope, and optionally one or more additional binding specificities being for an epitope on a different ActRII ligand (e.g., GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6 BMP7 and/or Nodal) and/or an ActRII receptor (e.g., an ActRIIA and/or ActRIIB receptor).
  • multispecific antibodies may bind to two or more different epitopes of GDF11.
  • a multispecific antibody of the disclosure that has binding affinity, in part, for a GDF11 epitope can be used to inhibit a GDF11 activity (e.g., the ability to bind to and/or activate an ActRIIA and/or ActRIIB receptor), and optionally inhibit the activity of one or more different ActRII ligands (e.g., GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7 and/or Nodal) and/or an ActRII receptor (e.g., an ActRIIA or ActRIIB receptor).
  • a GDF11 activity e.g., the ability to bind to and/or activate an ActRIIA and/or ActRIIB receptor
  • an ActRII ligands e.g., GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7 and/or Nodal
  • an ActRII receptor e.g.
  • multispecific antibodies of the present disclosure that bind to and/or inhibit GDF11 further bind to and/or inhibit at least GDF8.
  • multispecific antibodies of the disclosure that bind to and/or inhibit GDF11 do not substantially bind to and/or substantially inhibit activin A.
  • multispecific antibodies of the disclosure that bind to and/or inhibit GDF11 and GDD8 further bind to and/or inhibit one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7 and/or Nodal.
  • a multispecific antibody of the present disclosure comprises two or more binding specificities, with at least one of the binding specificities being for a GDF8 epitope, and optionally one or more additional binding specificities being for an epitope on a different ActRII ligand (e.g., GDFl 1, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7 and/or Nodal) and/or an ActRII receptor (e.g., an ActRIIA and/or ActRIIB receptor).
  • multispecific antibodies may bind to two or more different epitopes of GDF8.
  • a multispecific antibody of the disclosure that has binding affinity, in part, for an GDF8 epitope can be used to inhibit an GDF8 activity (e.g., the ability to bind to and/or activate an ActRIIA and/or ActRIIB receptor), and optionally inhibit the activity of one or more different ActRII ligands (e.g., GDFl 1, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7 and/or Nodal) and/or an ActRII receptor (e.g., an ActRIIA or ActRIIB receptor).
  • an ActRII ligands e.g., GDFl 1, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7 and/or Nodal
  • an ActRII receptor e.g., an ActRIIA or ActRIIB receptor
  • multispecific antibodies of the present disclosure that bind to and/or inhibit GDF8 further bind to and/or inhibit at least GDFl 1.
  • multispecific antibodies of the disclosure that bind to and/or inhibit GDF8 do not substantially bind to and/or substantially inhibit activin A.
  • multispecific antibodies of the disclosure that bind to and/or inhibit GDF8 and GDFl 1 further bind to and/or inhibit one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7 and/or Nodal.
  • the antibodies disclosed herein are monoclonal antibodies.
  • Monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
  • each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present methods may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
  • anti-protein/anti- peptide antisera or monoclonal antibodies can be made by standard protocols [see, e.g., Antibodies: A Laboratory Manual (1988) ed. by Harlow and Lane, Cold Spring Harbor Press].
  • a mammal such as a mouse, hamster, or rabbit can be immunized with an immunogenic form of the GDF11 or GDF8 polypeptide, an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein.
  • Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art.
  • An immunogenic portion of a GDF11 or GDF8 polypeptide can be administered in the presence of adjuvant.
  • the progress of immunization can be monitored by detection of antibody titers in plasma or serum.
  • Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibody production and/or level of binding affinity.
  • antibody-producing cells can be harvested from an immunized animal and fused by standard somatic cell fusion procedures with immortalizing cells such as myeloma cells to yield hybridoma cells.
  • immortalizing cells such as myeloma cells.
  • Hybridoma cells can be screened for human monoclonal antibodies.
  • one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein ⁇ e.g., an anti-GDFl 1 antibody, an anti- activin B antibody, an anti-ActRIIA antibody, or an anti-ActRIIB antibody), thereby generating an Fc-region variant.
  • the Fc-region variant may comprise a human Fc-region sequence ⁇ e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g., a substitution, deletion, and/or addition) at one or more amino acid positions.
  • the present disclosure contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody in vivo is important yet for which certain effector functions [e.g. , complement-dependent cytotoxicity (CDC) and antibody-dependent cellular
  • effector functions e.g. , complement-dependent cytotoxicity (CDC) and antibody-dependent cellular
  • cytotoxicity are unnecessary or deleterious.
  • In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
  • Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
  • the primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII.
  • FcR expression on hematopoietic cells is summarized in, for example, Ravetch and Kinet (1991) Annu. Rev. Immunol. 9:457-492.
  • Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest are described in U.S. Pat. No. 5,500,362; Hellstrom, I. et al. (1986) Proc. Nafl Acad. Sci. USA 83:7059-7063; Hellstrom, I et al. (1985) Proc. Nafl Acad. Sci. USA 82: 1499-1502; U.S. Pat. No. 5,821,337; and Bruggemann, M. et al. (1987) J. Exp. Med. 166: 1351-1361.
  • nonradioactive assay methods may be employed (e.g., ACTITM, non-radioactive cytotoxicity assay for flow cytometry; CellTechnology, Inc. Mountain View, Calif.; and CytoTox 96 ® non-radioactive cytotoxicity assay, Promega, Madison, Wis.).
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and natural killer (NK) cells.
  • PBMC peripheral blood mononuclear cells
  • NK natural killer
  • ADCC activity of the molecule of interest may be assessed in vivo, for example, in an animal model such as that disclosed in Clynes et al. (1998) Proc. Nafl Acad. Sci. USA 95:652-656.
  • Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity [see, e.g., Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402].
  • a CDC assay may be performed [see, e.g., Gazzano-Santoro et al. (1996) J.
  • Antibodies of the present disclosure include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056).
  • Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
  • cysteine-engineered antibodies e.g., "thioMAbs”
  • one or more residues of an antibody are substituted with cysteine residues.
  • the substituted residues occur at accessible sites of the antibody.
  • reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
  • any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy-chain Fc region.
  • Cysteine engineered antibodies may be generated as described, for example., in U.S. Pat. No. 7,521,541.
  • the techniques used to screen antibodies in order to identify a desirable antibody may influence the properties of the antibody obtained. For example, if an antibody is to be used for binding an antigen in solution, it may be desirable to test solution binding.
  • a variety of different techniques are available for testing interaction between antibodies and antigens to identify particularly desirable antibodies. Such techniques include ELISAs, surface plasmon resonance binding assays ⁇ e.g., the BiacoreTM binding assay, Biacore AB, Uppsala, Sweden), sandwich assays ⁇ e.g., the paramagnetic bead system of IGEN
  • amino acid sequence variants of the antibodies and/or the binding polypeptides provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody and/or binding polypeptide.
  • Amino acid sequence variants of an antibody and/or binding polypeptides may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody and/or binding polypeptide, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into, and/or substitutions of residues within, the amino acid sequences of the antibody and/or binding polypeptide. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., target-binding (GDF11, GDF8, ActRIIA, and/or ActRIIB binding).
  • target-binding GDF11, GDF8, ActRIIA, and/or ActRIIB binding
  • Alterations ⁇ e.g., substitutions) may be made in HVRs, for example, to improve antibody affinity.
  • Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury (2008) Methods Mol. Biol. 207: 179-196 (2008)), and/or SDRs (a-CDRs), with the resulting variant VH or VL being tested for binding affinity.
  • affinity maturation by constructing and reselecting from secondary libraries has been described in the art [see, e.g., Hoogenboom et ah, in Methods in Molecular Biology 178: 1-37, O'Brien et al., ed., Human Press, Totowa, N.J., (2001)].
  • affinity maturation diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g. , error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis).
  • a secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity.
  • HVR-directed approaches in which several HVR residues (e.g., 4-6 residues at a time) are randomized.
  • HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling.
  • CDR-H3 and CDR-L3 in particular are often targeted.
  • substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind to the antigen.
  • conservative alterations e.g., conservative substitutions as provided herein
  • Such alterations may be outside of HVR "hotspots" or SDRs.
  • each HVR either is unaltered, or contains no more than one, two, or three amino acid substitutions.
  • a useful method for identification of residues or regions of the antibody and/or the binding polypeptide that may be targeted for mutagenesis is called “alanine scanning mutagenesis", as described by Cunningham and Wells (1989) Science, 244: 1081-1085.
  • a residue or group of target residues e.g., charged residues such as arg, asp, his, lys, and glu
  • a neutral or negatively charged amino acid e.g., alanine or polyalanine
  • Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions.
  • a crystal structure of an antigen-antibody complex can be used to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
  • Amino-acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue.
  • Other insertional variants of the antibody molecule include fusion of the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
  • an antibody and/or binding polypeptide provided herein may be further modified to contain additional non-proteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the antibody and/or binding polypeptide include but are not limited to water-soluble polymers.
  • Non-limiting examples of water-soluble polymers include, but are not limited to, polyethylene glycol (PEG),
  • dextran polyvinyl alcohol
  • polyvinyl pyrrolidone poly-l ,3-dioxolane
  • poly-l ,3,6-trioxane ethylene/maleic anhydride copolymer
  • Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the antibody and/or binding polypeptide may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody and/or binding polypeptide to be improved, whether the antibody derivative and/or binding polypeptide derivative will be used in a therapy under defined conditions.
  • any of the ActRII antagonist antibodies disclosed herein e.g., an anti-activin A antibody, an anti-activin B antibody, an anti-activin C antibody, an anti-activin E antibody, an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-BMP6 antibody, an anti-BMP7 antibody, an anti-ActRIIA antibody, and/or or an anti- ActRIIB antibody
  • an anti-activin A antibody e.g., an anti-activin A antibody, an anti-activin B antibody, an anti-activin C antibody, an anti-activin E antibody, an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-BMP6 antibody, an anti-BMP7 antibody, an anti-ActRIIA antibody, and/or or an anti- ActRIIB antibody
  • an anti-activin A antibody e.g., an anti-activin A antibody, an anti-activin B antibody, an anti-activin C antibody, an anti-activin E antibody, an anti-
  • an ActRII antagonist antibody disclosed herein e.g., an anti-GDFl 1 antibody, an anti-activin B antibody, an anti-activin C antibody, an anti-activin E antibody, an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-BMP6 antibody, an-anti-BMP7 antibody, an anti-ActRIIA antibody, or an anti- ActRIIB antibody
  • an ActRII antagonist antibody disclosed herein can be used in combination with i) one or more additional ActRII antagonist antibodies disclosed herein, ii) one or more ActRII polypeptides disclosed herein (e.g., ActRIIA and/or ActRIIB polypeptides), iii) one or more GDF traps disclosed herein; iv) one or more small-molecule ActRII antagonist disclosed herein (e.g., a small molecule antagonist of one or more of GDFl 1, GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6, B
  • the present disclosure relates to a small molecule, or combination of small molecules, that antagonizes ActRII activity (e.g., inhibition of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 and/or SMAD 1/5/8 signaling).
  • ActRII activity e.g., inhibition of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 and/or SMAD 1/5/8 signaling.
  • the disclosure provides methods of using a small-molecule antagonist, or combination of antibody antagonists, of ActRII , alone or in combination with one or more erythropoiesis stimulating agents (e.g. , EPO) or other supportive therapies [e.g.
  • hematopoietic growth factors e.g., G-CSF or GM-CSF
  • transfusion of red blood cells or whole blood iron chelation therapy
  • MDS or sideroblastic anemias in a subject in need thereof
  • one or more complications of MDS or sideroblastic anemias e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lymphoma
  • a disorder associated with SF3B1, DNMT3A, and/or TET2 mutations in a subject in need thereof.
  • a preferred ActRII antagonist of the present disclosure is a small-molecule antagonist, or combination of small-molecule antagonists, that direct or indirect inhibits at least GDFl 1 activity.
  • a small-molecule antagonist, or combination of small-molecule antagonists may further inhibit, either directly or indirectly, GDF8.
  • a small-molecule antagonist, or combination of small-molecule antagonists, of the present disclosure does not substantially inhibit activin A activity.
  • a small-molecule antagonist, or combination of small-molecule antagonists, of the present disclosure that inhibits, either directly or indirectly, GDFl 1 and/or GDF8 activity further inhibits, either directly or indirectly, activity of one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB.
  • a small-molecule antagonist, or combination of small- molecule antagonists, of the present disclosure is an indirect inhibitor of one or more of GDFl 1 , GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6, Nodal, ActRIIA, and ActRIIB.
  • a small-molecule antagonist, or combination of small-molecule antagonists, of the present disclosure may inhibit the expression (e.g., transcription, translation, cellular secretion, or combinations thereof) of at least GDFl 1.
  • such a small-molecule antagonist, or combination of small-molecule antagonists may further inhibit expression of GDF8.
  • a small-molecule antagonist, or combinations of small- molecule antagonists, of the disclosure does not substantially inhibit the expression of activin A.
  • a small-molecule antagonist, or combination of small-molecule antagonists, of the disclosure that inhibits expression of GDFl 1 and/or GDF8 may further inhibit the expression of one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB.
  • a small-molecule antagonist, or combination of small-molecule antagonists, of the present disclosure is direct inhibitor of one or more of GDFl 1 , GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB.
  • a preferred small-molecule antagonist, or combination of small- molecule antagonists, of the present disclosure directly binds to and inhibits at least GDFl 1 activity (e.g. inhibits the ability GDFl 1 to bind to an ActRIIA and/or ActRIIB receptor;
  • a small-molecule antagonist, or combinations of small-molecule antagonists, of the disclosure may further bind to and inhibit GDF8 activity (e.g. inhibits the ability of GDF8 to bind to an ActRIIA and/or ActRIIB receptor; inhibits GDF8-mediated activation of the ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • GDF8 activity e.g. inhibits the ability of GDF8 to bind to an ActRIIA and/or ActRIIB receptor; inhibits GDF8-mediated activation of the ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling.
  • a small-molecule antagonist, or combinations of small- molecule antagonists, of the disclosure does not substantially bind to or inhibit activin A activity (e.g.
  • a small-molecule antagonist, or combinations of small-molecule antagonists, of the disclosure that binds to and inhibits the activity of GDF1 1 and/or GDF8 further binds to and inhibits the activity of one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB.
  • a small-molecule antagonist, or combination of small- molecule antagonists, of the present disclosure directly binds to and inhibits at least GDF8 activity (e.g. inhibits the ability GDF8 to bind to an ActRIIA and/or ActRIIB receptor;
  • a small-molecule antagonist, or combinations of small-molecule antagonists, of the disclosure may further bind to and inhibit GDF1 1 activity (e.g. inhibit the ability of GDF1 1 to bind to an ActRIIA and/or ActRIIB receptor; inhibit GDF1 1 -mediated activation of the ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • a small-molecule antagonist, or combinations of small- molecule antagonists, of the disclosure does not substantially bind to or inhibit activin A activity (e.g.
  • a small-molecule antagonist, or combinations of small- molecule antagonists, of the disclosure that binds to and inhibits the activity of GDF8 and/or GDF1 1 further binds to and inhibits the activity of one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB.
  • a small-molecule antagonist, or combination of small- molecule antagonists, of the present disclosure directly binds to and inhibits at least ActRIIA activity (e.g. ActRII ligand-mediated activation of ActRIIA signaling transduction, such as SMAD 2/3 signaling).
  • a preferred small-molecule antagonist, or combination of small-molecule antagonists, of the disclosure binds to an ActRIIA receptor and inhibits at least GDF1 1 from binding to and/or activating the ActRIIA receptor.
  • such a small-molecule antagonist, or combination of small-molecule antagonists may further inhibit GDF8 from binding to and/or activating the ActRIIA receptor.
  • a small-molecule antagonist, or combination of small-molecule antagonists, of the disclosure does not substantially inhibit activin A from binding to and/or activating an ActRIIA receptor.
  • a small-molecule antagonist, or combination of small-molecule antagonists, of the disclosure that inhibits GDF11 and/or GDF8 from binding to and/or activating the ActRIIA receptor further inhibits one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, and Nodal from binding to/and or activating the ActRIIA receptor.
  • a small-molecule antagonist, or combination of small- molecule antagonists, of the present disclosure directly binds to and inhibits at least ActRIIB activity (e.g. ActRII ligand-mediated activation of ActRIIB signaling transduction, such as SMAD 2/3 signaling).
  • a preferred small-molecule antagonist, or combination of small-molecule antagonists, of the disclosure binds to an ActRIIB receptor and inhibits at least GDF11 from binding to and/or activating the ActRIIB receptor.
  • such a small-molecule antagonist, or combination of small-molecule antagonists may further inhibit GDF8 from binding to and/or activating the ActRIIB receptor.
  • a small-molecule antagonist, or combination of small-molecule antagonists, of the disclosure does not substantially inhibit activin A from binding to and/or activating an ActRIIB receptor.
  • a small-molecule antagonist, or combination of small-molecule antagonists, of the disclosure that inhibits GDF11 and/or GDF8 from binding to and/or activating the ActRIIB receptor further inhibits one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, and Nodal from binding to/and or activating the ActRIIB receptor.
  • Binding organic small molecule antagonists of the present disclosure may be identified and chemically synthesized using known methodology (see, e.g., PCT Publication Nos. WO 00/00823 and WO 00/39585).
  • small-molecule antagonists of the disclosure are usually less than about 2000 daltons in size, alternatively less than about 1500, 750, 500, 250 or 200 daltons in size, wherein such organic small molecules that are capable of binding, preferably specifically, to a polypeptide as described herein (e.g., GDF11, GDF8, ActRIIA, and ActRIIB).
  • Such small-molecule antagonists may be identified without undue experimentation using well-known techniques.
  • Binding organic small molecules of the present disclosure may be, for example, aldehydes, ketones, oximes, hydrazones, semicarbazones, carbazides, primary amines, secondary amines, tertiary amines, N-substituted hydrazines, hydrazides, alcohols, ethers, thiols, thioethers, disulfides, carboxylic acids, esters, amides, ureas, carbamates, carbonates, ketals, thioketals, acetals, thioacetals, aryl halides, aryl sulfonates, alkyl halides, alkyl sulfonates, aromatic compounds, heterocyclic compounds, anilines, alkenes, alkynes, diols, amino alcohols, oxazolidines, oxazolines, thiazolidines, thiazolines, enamines, sulfonamide
  • any of the small-molecule ActRII antagonists disclosed herein can be combined with one or more additional ActRII antagonist agents of the disclosure to achieve the desired effect (e.g., increase red blood cell levels and/or hemoglobin in a subject in need thereof, treat or prevent an anemia, treat MDS or sideroblastic anemias, treat or prevent one or more complications of MDS or sideroblastic anemias).
  • a small-molecule ActRII antagonist disclosed herein e.g.
  • a small-molecule antagonist of one or more of GDFl 1 , GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and/or ActRIIB can be used in combination with i) one or more additional small molecule ActRII antagonists disclosed herein, ii) one or more ActRII polypeptides disclosed herein (e.g., ActRIIA and/or ActRIIB polypeptides), iii) one or more GDF traps disclosed herein; iv) one or more ActRII antagonist antibodies disclosed herein (e.g., an anti-GDFl 1 antibody, an anti-activin B antibody, an anti-activin C antibody, an anti-activin E antibody, an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-BMP6 antibody, an-anti-BMP7 antibody, an anti-ActRIIA antibody, or an anti-ActRIIB antibody);
  • the present disclosure relates to a polynucleotide, or combination of polynucleotides, that antagonizes ActRII activity (e.g. , inhibition of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 and/or SMAD 1/5/8 signaling).
  • ActRII activity e.g. , inhibition of ActRIIA and/or ActRIIB signaling transduction, such as SMAD 2/3 and/or SMAD 1/5/8 signaling.
  • the disclosure provides methods of using a polynucleotide ActRII antagonist, or combination of polynucleotide ActRII antagonists, , alone or in combination with one or more erythropoiesis stimulating agents (e.g. , EPO) or other supportive therapies [e.g.
  • hematopoietic growth factors e.g., G-CSF or GM-CSF
  • transfusion of red blood cells or whole blood iron chelation therapy
  • MDS or sideroblastic anemias in a subject in need thereof
  • one or more complications of MDS or sideroblastic anemias e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lymphoma
  • a disorder associated with SF3B1, DNMT3A, and/or TET2 mutations in a subject in need thereof.
  • a polynucleotide ActRII antagonist, or combination of polynucleotide ActRII antagonists, of the present disclosure can be used to inhibit the activity and/or expression on one or more of GDF11, GDF8, activin A, activin B, activin AB, activin C, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and/or ActRIIB.
  • a polynucleotide ActRII antagonist, or combination of polynucleotide ActRII antagonists, of the disclosure is a GDF-ActRII antagonist.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure inhibits the activity and/or expression (e.g., transcription, translation, secretion, or combinations thereof) of at least GDF11.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists may further inhibit the activity and/or expression of GDF8.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure does not substantially inhibit the activity and/or expression of activin A.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure that inhibits the activity and/or expression of GDF11 and/or GDF8 may further inhibit the activity and or expression of one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and/or ActRIIB.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure inhibits the activity and/or expression (e.g., transcription, translation, secretion, or combinations thereof) of at least GDF8.
  • such polynucleotide antagonist, or combination of polynucleotide antagonists may further inhibit the activity and/or expression of GDFl 1.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure does not substantially inhibit the activity and/or expression of activin A.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure that inhibits the activity and/or expression of GDF8 and/or GDFl 1 may further inhibit the activity and or expression of one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and/or ActRIIB.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure inhibits the activity and/or expression (e.g., transcription, translation, secretion, or combinations thereof) of at least ActRIIA.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure inhibits the activity and/or expression (e.g., transcription, translation, secretion, or combinations thereof) of at least ActRIIA.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure inhibits the activity and/or expression (e.g., transcription, translation, secretion, or combinations thereof) of at least ActRIIA.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure inhibits the activity and/or expression (e.g., transcription, translation, secretion, or combinations thereof) of at least ActRIIA.
  • polynucleotide antagonist or combination of polynucleotide antagonists, of the disclosure does not substantially inhibit the activity and/or expression of activin A.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure that inhibits the activity and/or expression of ActRIIA may further inhibit the activity and or expression of one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, and/or ActRIIB.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure inhibits the activity and/or expression (e.g., transcription, translation, secretion, or combinations thereof) of at least ActRIIB.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure inhibits the activity and/or expression (e.g., transcription, translation, secretion, or combinations thereof) of at least ActRIIB.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure inhibits the activity and/or expression (e.g., transcription, translation, secretion, or combinations thereof) of at least ActRIIB.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure inhibits the activity and/or expression (e.g., transcription, translation, secretion, or combinations thereof) of at least ActRIIB.
  • polynucleotide antagonist or combination of polynucleotide antagonists, of the disclosure does not substantially inhibit the activity and/or expression of activin A.
  • a polynucleotide antagonist, or combination of polynucleotide antagonists, of the disclosure that inhibits the activity and/or expression of ActRIIB may further inhibit the activity and or expression of one or more of activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, and/or ActRIIA.
  • the polynucleotide antagonists of the present disclosure may be an antisense nucleic acid, an RNAi molecule [e.g., small interfering RNA (siRNA), small-hairpin RNA (shRNA), microRNA (miRNA)], an aptamer and/or a ribozyme.
  • RNAi molecule e.g., small interfering RNA (siRNA), small-hairpin RNA (shRNA), microRNA (miRNA)
  • siRNA small interfering RNA
  • shRNA small-hairpin RNA
  • miRNA microRNA
  • nucleic acid and amino acid sequences of human GDFl 1 , GDF8, activin A, activin B, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB are known in the art and thus polynucleotide antagonists for use in accordance with methods of the present disclosure may be routinely made by the skilled artisan based on the knowledge in the art and teachings provided herein.
  • antisense technology can be used to control gene expression through antisense DNA or RNA, or through triple -helix formation. Antisense techniques are discussed, for example, in Okano (1991) J. Neurochem.
  • the antisense nucleic acids comprise a single-stranded RNA or DNA sequence that is complementary to at least a portion of an RNA transcript of a gene disclosed herein (e.g., GDF11, GDF8, activin A, activin B, activin C, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB).
  • GDF11, GDF8 activin A, activin B, activin C, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB.
  • absolute complementarity is not required.
  • a sequence "complementary to at least a portion of an RNA,” referred to herein, means a sequence having sufficient complementarity to be able to hybridize with the RNA, forming a stable duplex; in the case of double-stranded antisense nucleic acids of a gene disclosed herein (e.g., GDF11, GDF8, activin A, activin B, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB), a single strand of the duplex DNA may thus be tested, or triplex formation may be assayed.
  • the ability to hybridize will depend on both the degree of complementarity and the length of the antisense nucleic acid.
  • the larger the hybridizing nucleic acid the more base mismatches with an RNA it may contain and still form a stable duplex (or triplex as the case may be).
  • One skilled in the art can ascertain a tolerable degree of mismatch by use of standard procedures to determine the melting point of the hybridized complex.
  • Polynucleotides that are complementary to the 5' end of the message should work most efficiently at inhibiting translation.
  • sequences complementary to the 3'- untranslated sequences of mRNAs have been shown to be effective at inhibiting translation of mRNAs as well [see, e.g., Wagner, R., (1994) Nature 372:333-335].
  • oligonucleotides complementary to either the 5'- or 3 '-untranslated, noncoding regions of a gene of the disclosure e.g., GDF11, GDF8, activin A, activin B, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB
  • GDF11, GDF8 activin A, activin B, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB
  • Polynucleotides complementary to the 5 '-untranslated region of the mRNA should include the complement of the AUG start codon.
  • polynucleotides complementary to mRNA coding regions are less efficient inhibitors of translation but could be used in accordance with the methods of the present disclosure.
  • antisense nucleic acids should be at least six nucleotides in length, and are preferably oligonucleotides ranging from 6 to about 50 nucleotides in length.
  • the oligonucleotide is at least 10 nucleotides, at least 17 nucleotides, at least 25 nucleotides, or at least 50 nucleotides.
  • the antisense nucleic acid of the present disclosure e.g. , a
  • GDF11, GDF8, activin A, activin B, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, or ActRIIB antisense nucleic acid is produced intracellularly by transcription from an exogenous sequence.
  • a vector or a portion thereof is transcribed, producing an antisense nucleic acid (RNA) of a gene of the disclosure.
  • RNA antisense nucleic acid
  • Such a vector would contain a sequence encoding the desired antisense nucleic acid.
  • Such a vector can remain episomal or become chromosomally integrated, as long as it can be transcribed to produce the desired antisense RNA.
  • Such vectors can be constructed by recombinant DNA technology methods standard in the art.
  • Vectors can be plasmid, viral, or others known in the art, used for replication and expression in vertebrate cells. Expression of the sequence encoding desired genes of the instant disclosure, or fragments thereof, can be by any promoter known in the art to act in vertebrate, preferably human cells. Such promoters can be inducible or constitutive. Such promoters include, but are not limited to, the SV40 early promoter region [see, e.g., Benoist and Chambon (1981) Nature 29:304-310], the promoter contained in the 3' long terminal repeat of Rous sarcoma virus [see, e.g., Yamamoto et al.
  • the polynucleotide antagonists are interfering RNA or RNAi molecules that target the expression of one or more of: GDF11, GDF8, activin A, activin B, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB.
  • RNAi refers to the expression of an RNA which interferes with the expression of the targeted mRNA.
  • RNAi silences a targeted gene via interacting with the specific mRNA through a siRNA (small interfering RNA).
  • siRNA small interfering RNA
  • the ds RNA complex is then targeted for degradation by the cell.
  • An siRNA molecule is a double-stranded RNA duplex of 10 to 50 nucleotides in length, which interferes with the expression of a target gene which is sufficiently complementary (e.g. at least 80% identity to the gene).
  • the siRNA molecule comprises a nucleotide sequence that is at least 85, 90, 95, 96, 97, 98, 99, or 100% identical to the nucleotide sequence of the target gene.
  • RNAi molecules include short-hairpin RNA (shRNA); also short- interfering hairpin and microRNA (miRNA).
  • shRNA short-hairpin RNA
  • miRNA microRNA
  • the shRNA molecule contains sense and antisense sequences from a target gene connected by a loop. The shRNA is transported from the nucleus into the cytoplasm, and it is degraded along with the mRNA.
  • Pol III or U6 promoters can be used to express RNAs for RNAi.
  • Paddison et al. [Genes & Dev. (2002) 16:948-958, 2002] have used small RNA molecules folded into hairpins as a means to effect RNAi. Accordingly, such short hairpin RNA (shRNA) molecules are also advantageously used in the methods described herein.
  • stem lengths can range anywhere from about 25 to about 30 nt, and loop size can range between 4 to about 25 nt without affecting silencing activity. While not wishing to be bound by any particular theory, it is believed that these shRNAs resemble the double - stranded RNA (dsRNA) products of the DICER RNase and, in any event, have the same capacity for inhibiting expression of a specific gene.
  • the shRNA can be expressed from a lentiviral vector.
  • An miRNA is a single-stranded RNA of about 10 to 70 nucleotides in length that are initially transcribed as pre -miRNA characterized by a "stem-loop" structure and which are subsequently processed into mature miRNA after further processing through the RISC.
  • RNAi molecules that mediate RNAi, including without limitation siRNA
  • chemical synthesis Hohjoh, FEBS Lett 521 : 195-199, 2002
  • hydrolysis of dsRNA Yang et al, Proc Natl Acad Sci USA 99:9942-9947, 2002
  • T7 RNA polymerase Trigger RNA polymerase
  • hydrolysis of double-stranded RNA using a nuclease such as E. coli RNase III
  • the disclosure provides polynucleotide antagonists including but not limited to, a decoy DNA, a double-stranded DNA, a single-stranded DNA, a complexed DNA, an encapsulated DNA, a viral DNA, a plasmid DNA, a naked RNA, an encapsulated RNA, a viral RNA, a double-stranded RNA, a molecule capable of generating RNA interference, or combinations thereof.
  • a decoy DNA including but not limited to, a decoy DNA, a double-stranded DNA, a single-stranded DNA, a complexed DNA, an encapsulated DNA, a viral DNA, a plasmid DNA, a naked RNA, an encapsulated RNA, a viral RNA, a double-stranded RNA, a molecule capable of generating RNA interference, or combinations thereof.
  • the polynucleotide antagonists of the disclosure are aptamers.
  • Aptamers are nucleic acid molecules, including double-stranded DNA and single-stranded RNA molecules, which bind to and form tertiary structures that specifically bind to a target molecule, such as a GDF11, GDF8, activin A, activin B, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB polypeptide.
  • a target molecule such as a GDF11, GDF8, activin A, activin B, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and ActRIIB polypeptide.
  • the generation and therapeutic use of aptamers are well established in the art. See, e.g., U.S. Pat. No. 5,475,096. Additional information on aptamers can be found in U.S. Patent Application Publication No.
  • Nucleic acid aptamers are selected using methods known in the art, for example via the Systematic Evolution of Ligands by Exponential Enrichment (SELEX) process.
  • SELEX is a method for the in vitro evolution of nucleic acid molecules with highly specific binding to target molecules as described in, e.g., U.S. Pat. Nos. 5,475,096, 5,580,737, 5,567,588, 5,707,796, 5,763,177, 6,011,577, and 6,699,843.
  • Another screening method to identify aptamers is described in U.S. Pat. No. 5,270,163.
  • the SELEX process is based on the capacity of nucleic acids for forming a variety of two- and three-dimensional structures, as well as the chemical versatility available within the nucleotide monomers to act as ligands (form specific binding pairs) with virtually any chemical compound, whether monomeric or polymeric, including other nucleic acid molecules and polypeptides. Molecules of any size or composition can serve as targets.
  • the SELEX method involves selection from a mixture of candidate oligonucleotides and step-wise iterations of binding, partitioning and amplification, using the same general selection scheme, to achieve desired binding affinity and selectivity.
  • the SELEX method includes steps of contacting the mixture with the target under conditions favorable for binding; partitioning unbound nucleic acids from those nucleic acids which have bound specifically to target molecules; dissociating the nucleic acid-target complexes; amplifying the nucleic acids dissociated from the nucleic acid-target complexes to yield a ligand enriched mixture of nucleic acids.
  • the steps of binding, partitioning, dissociating and amplifying are repeated through as many cycles as desired to yield highly specific high affinity nucleic acid ligands to the target molecule.
  • binding molecules are separately administered to the animal [see, e.g. , O'Connor (1991) J. Neurochem. 56:560], but such binding molecules can also be expressed in vivo from polynucleotides taken up by a host cell and expressed in vivo [see, e.g.,
  • any of the polynucleotide ActRII antagonists disclosed herein ⁇ e.g. , a polynucleotide antagonist of one or more of GDF11, GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and/or ActRIIB) can be combined with one or more additional ActRII antagonist agents of the disclosure to achieve the desired effect (e.g., increase red blood cell levels and/or hemoglobin in a subject in need thereof, treat or prevent an anemia, treat MDS or sideroblastic anemias, treat or prevent one or more complications of MDS or sideroblastic anemias).
  • a polynucleotide antagonist of one or more of GDF11, GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and/or ActRIIB can be combined with one or more additional Act
  • an polynucleotide ActRII antagonist disclosed herein e.g., a polynucleotide antagonist of one or more of GDF11, GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and/or ActRIIB
  • an additional polynucleotide ActRII antagonists disclosed herein ii) one or more ActRII polypeptides disclosed herein (e.g., ActRIIA and/or ActRIIB polypeptides), iii) one or more GDF traps disclosed herein;
  • one or more ActRII antagonist antibodies disclosed herein e.g., an anti-GDFl 1 antibody, an anti-activin B antibody, an anti-activin C antibody, an anti-activin E antibody, an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-BMP6 antibody, an anti-GDFl 1 antibody, an anti-activin B antibody
  • an agent for use in accordance with the methods disclosed herein is a follistatin polypeptide, which may be used alone or in combination with one or more erythropoiesis stimulating agents (e.g., EPO) or other supportive therapies [e.g.,
  • hematopoietic growth factors e.g., G-CSF or GM-CSF
  • transfusion of red blood cells or whole blood iron chelation therapy
  • MDS or sideroblastic anemias in a subject in need thereof
  • one or more complications of MDS or sideroblastic anemias e.g., anemia, blood transfusion requirement, neutropenia, iron overload, acute myocardial infarction, hepatic failure, hepatomegaly, splenomegaly, progression to acute myeloid lymphoma
  • a disorder associated with SF3B1, DNMT3A, and/or TET2 mutations in a subject in need thereof.
  • follistatin polypeptide includes polypeptides comprising any naturally occurring polypeptide of follistatin as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of follistatin.
  • follistatin polypeptides of the disclosure bind to and/or inhibit activin activity, particularly activin A (e.g., activin-mediated activation of ActRIIA and/or ActRIIB SMAD 2/3 signaling).
  • activin A e.g., activin-mediated activation of ActRIIA and/or ActRIIB SMAD 2/3 signaling.
  • Variants of follistatin polypeptides that retain activin binding properties can be identified based on previous studies involving follistatin and activin interactions.
  • WO2008/030367 discloses specific follistatin domains ("FSDs”) that are shown to be important for activin binding.
  • FSDs follistatin domains
  • SEQ ID NOs: 18-20 the follistatin N- terminal domain
  • FSD2 SEQ ID NO: 20
  • FSDl SEQ ID NO: 19
  • methods for making and testing libraries of polypeptides are described above in the context of ActRII polypeptides, and such methods also pertain to making and testing variants of follistatin.
  • Follistatin polypeptides include polypeptides derived from the sequence of any known follistatin having a sequence at least about 80% identical to the sequence of a follistatin polypeptide, and optionally at least 85%, 90%, 95%, 96%), 97%), 98%), 99%o or greater identity.
  • follistatin polypeptides include the mature follistatin polypeptide or shorter isoforms or other variants of the human follistatin precursor polypeptide (SEQ ID NO: 16) as described, for example, in WO2005/025601.
  • the human follistatin precursor polypeptide isoform FST344 is as follows:
  • the signal peptide is underlined; also underlined above are the last 27 residues which represent the C-terminal extension distinguishing this follistatin isoform from the shorter follistatin isoform FST317 shown below.
  • the human follistatin precursor polypeptide isoform FST317 is as follows:
  • the signal peptide is underlined.
  • FSND follistatin N-terminal domain
  • the FSD1 and FSD2 sequences are as follows :
  • an agent for use in accordance with the methods disclosed herein is a follistatin-like related gene (FLRG), also known as follistatin-related protein 3 (FSTL3).
  • FLRG polypeptide includes polypeptides comprising any naturally occurring polypeptide of FLRG as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity.
  • FLRG polypeptides of the disclosure bind to and/or inhibit activin activity, particularly activin A (e.g., activin-mediated activation of ActRIIA and/or ActRIIB SMAD 2/3 signaling).
  • activin A e.g., activin-mediated activation of ActRIIA and/or ActRIIB SMAD 2/3 signaling.
  • Variants of FLRG polypeptides that retain activin binding properties can be identified using routine methods to assay FLRG and activin interactions (see, e.g., US 6,537,966).
  • methods for making and testing libraries of polypeptides are described above in the context of ActRII polypeptides and such methods also pertain to making and testing variants of FLRG.
  • FLRG polypeptides include polypeptides derived from the sequence of any known FLRG having a sequence at least about 80% identical to the sequence of an FLRG polypeptide, and optionally at least 85%, 90%, 95%, 97%, 99% or greater identity.
  • the human FLRG precursor (follistatin-related protein 3 precursor) polypeptide is as follows:
  • the signal peptide is underlined.
  • follistatin polypeptides and FLRG polypeptides include fusion proteins having at least a portion of the follistatin polypeptide or FLRG polypeptide and one or more fusion domains, such as, for example, domains that facilitate isolation, detection, stabilization or multimerization of the polypeptide. Suitable fusion domains are discussed in detail above with reference to the ActRII polypeptides.
  • an antagonist agent of the disclosure is a fusion protein comprising an activin-binding portion of a follistatin polypeptide fused to an Fc domain.
  • an antagonist agent of the disclosure is a fusion protein comprising an activin binding portion of an FLRG polypeptide fused to an Fc domain.
  • any of the follistatin polypeptides disclosed herein may be combined with one or more additional ActRII antagonist agents of the disclosure to achieve the desired effect (e.g., increase red blood cell levels and/or hemoglobin in a subject in need thereof, treat or prevent an anemia, treat MDS or sideroblastic anemias, treat or prevent one or more complications of MDS or sideroblastic anemias).
  • a follistatin polypeptide disclosed herein can be used in combination with i) one or more additional follistatin polypeptides disclosed herein, ii) one or more ActRII polypeptides disclosed herein (e.g., ActRIIA and/or ActRIIB
  • ActRII antagonist antibodies disclosed herein e.g., an anti-GDFl 1 antibody, an anti-activin B antibody, an anti- activin C antibody, an anti-activin E antibody, an anti-GDFl 1 antibody, an anti-GDF8 antibody, an anti-BMP6 antibody, an-anti-BMP7 antibody, an anti- ActRIIA antibody, or an anti- ActRIIB antibody
  • v) one or more small molecule ActRII antagonists disclosed herein e.g., a small molecule antagonist of one or more of GDF1 1 , GDF8, activin A, activin B, activin AB, activin C, activin E, BMP6, BMP7, Nodal, ActRIIA, and/or ActRIIB
  • one or more polynucleotide ActRII antagonists disclosed herein e.g.
  • any of the FLRG polypeptides disclosed herein may be combined with one or more additional ActRII antagonist agents of the disclosure to achieve the desired effect.
  • a FLRG polypeptide disclosed herein can be used in combination with i) one or more additional FLRG polypeptides disclosed herein, ii) one or more ActRII polypeptides disclosed herein (e.g. , ActRIIA and/or ActRIIB polypeptides), iii) one or more GDF traps disclosed herein; iv) one or more ActRII antagonist antibodies disclosed herein (e.g.
  • the present disclosure relates to the use of the subject ActRII polypeptides (e.g. , ActRIIA and ActRIIB polypeptides) and GDF trap polypeptides to identify compounds (agents) which are agonist or antagonists of ActRIIB polypeptides.
  • Compounds identified through this screening can be tested to assess their ability to modulate red blood cell, hemoglobin, and/or reticulocyte levels in vivo or in vitro. These compounds can be tested, for example, in animal models.
  • ActRII signaling e.g., ActRIIA and/or ActRIIB SMAD 2/3 and/or SMAD 1/5/8 signaling.
  • high-throughput screening of compounds can be carried out to identify agents that perturb ActRII-mediated effects on a selected cell line.
  • the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an ActRII polypeptide or GDF trap polypeptide to its binding partner, such as an ActRII ligand (e.g., activin A, activin B, activin AB, activin C, Nodal, GDF8, GDF11 or BMP7).
  • an ActRII ligand e.g., activin A, activin B, activin AB, activin C, Nodal, GDF8, GDF11 or BMP7.
  • the assay can be used to identify compounds that enhance binding of an ActRII polypeptide or GDF trap polypeptide to its binding partner such as an ActRII ligand.
  • the compounds can be identified by their ability to interact with an ActRII polypeptide or GDF trap polypeptide.
  • test compounds (agents) of the invention may be created by any combinatorial chemical method.
  • the subject compounds may be naturally occurring biomolecules synthesized in vivo or in vitro.
  • Compounds (agents) to be tested for their ability to act as modulators of tissue growth can be produced, for example, by bacteria, yeast, plants or other organisms ⁇ e.g., natural products), produced chemically ⁇ e.g., small molecules, including peptidomimetics), or produced recombinantly.
  • Test compounds contemplated by the present invention include non-peptidyl organic molecules, peptides, polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
  • the test agent is a small organic molecule having a molecular weight of less than about 2,000 Daltons.
  • the test compounds of the disclosure can be provided as single, discrete entities, or provided in libraries of greater complexity, such as made by combinatorial chemistry. These libraries can comprise, for example, alcohols, alkyl halides, amines, amides, esters, aldehydes, ethers and other classes of organic compounds. Presentation of test compounds to the test system can be in either an isolated form or as mixtures of compounds, especially in initial screening steps.
  • the compounds may be optionally derivatized with other compounds and have derivatizing groups that facilitate isolation of the compounds.
  • derivatizing groups include biotin, fluorescein, digoxygenin, green fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S-transferase (GST), photoactivatible crosslinkers or any combinations thereof.
  • GST glutathione S-transferase
  • Assays which are performed in cell-free systems such as may be derived with purified or semi-purified proteins, are often preferred as "primary" screens in that they can be generated to permit rapid development and relatively easy detection of an alteration in a molecular target which is mediated by a test compound.
  • the effects of cellular toxicity or bioavailability of the test compound can be generally ignored in the in vitro system, the assay instead being focused primarily on the effect of the drug on the molecular target as may be manifest in an alteration of binding affinity between an ActRII polypeptide or a GDF trap polypeptide and its binding partner ⁇ e.g., an ActRII ligand).
  • the compound of interest is contacted with an isolated and purified ActRIIB polypeptide which is ordinarily capable of binding to an ActRIIB ligand, as appropriate for the intention of the assay.
  • an isolated and purified ActRIIB polypeptide which is ordinarily capable of binding to an ActRIIB ligand, as appropriate for the intention of the assay.
  • an ActRIIB ligand ⁇ e.g., GDF11
  • Detection and quantification of ActRIIB/ ActRIIB ligand complexes provides a means for determining the compound's efficacy at inhibiting (or potentiating) complex formation between the ActRIIB polypeptide and its binding protein.
  • the efficacy of the compound can be assessed by generating dose- response curves from data obtained using various concentrations of the test compound.
  • a control assay can also be performed to provide a baseline for comparison.
  • isolated and purified ActRIIB ligand is added to a composition containing the ActRIIB polypeptide, and the formation of ActRIIB/ ActRIIB ligand complex is quantitated in the absence of the test compound. It will be understood that, in general, the order in which the reactants may be admixed can be varied, and can be admixed
  • cellular extracts and lysates may be used to render a suitable cell-free assay system.
  • Complex formation between an ActRII polypeptide or GDF trap polypeptide and its binding protein may be detected by a variety of techniques. For instance, modulation of the formation of complexes can be quantitated using, for example, detectably labeled proteins
  • the present disclosure contemplates the use of fluorescence polarization assays and fluorescence resonance energy transfer (FRET) assays in measuring, either directly or indirectly, the degree of interaction between an ActRII polypeptide of GDF trap polypeptide and its binding protein.
  • FRET fluorescence resonance energy transfer
  • an interaction trap assay also known as the "two-hybrid assay," for identifying agents that disrupt or potentiate interaction between an ActRII polypeptide or GDF trap polypeptide and its binding partner. See, e.g., U.S. Pat. No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J Biol Chem 268:12046-12054; Bartel et al. (1993) Biotechniques 14:920-924; and Iwabuchi et al. (1993) Oncogene 8: 1693-1696).
  • the present disclosure contemplates the use of reverse two-hybrid systems to identify compounds ⁇ e.g., small molecules or peptides) that dissociate interactions between an ActRII polypeptide or GDF trap and its binding protein [see, e.g., Vidal and Legrain, (1999) Nucleic Acids Res 27:919- 29; Vidal and Legrain, (1999) Trends Biotechnol 17:374-81; and U.S. Pat. Nos. 5,525,490; 5,955,280; and 5,965,368].
  • the subject compounds are identified by their ability to interact with an ActRII polypeptide or GDF trap polypeptide.
  • the interaction between the compound and the ActRII polypeptide or GDF trap polypeptide may be covalent or non- covalent.
  • such interaction can be identified at the protein level using in vitro biochemical methods, including photo-crosslinking, radiolabeled ligand binding, and affinity chromatography [see, e.g., Jakoby WB et al. (1974) Methods in Enzymology 46: 1].
  • the compounds may be screened in a mechanism-based assay, such as an assay to detect compounds which bind to an ActRII polypeptide of GDF trap polypeptide. This may include a solid-phase or fluid-phase binding event.
  • the gene encoding an ActRII polypeptide or GDF trap polypeptide can be transfected with a reporter system ⁇ e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein) into a cell and screened against the library preferably by high-throughput screening or with individual members of the library.
  • a reporter system ⁇ e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein
  • Other mechanism-based binding assays may be used; for example, binding assays which detect changes in free energy. Binding assays can be performed with the target fixed to a well, bead or chip or captured by an immobilized antibody or resolved by capillary electrophoresis. The bound compounds may be detected usually using colorimetric endpoints or fluorescence or surface plasmon resonance. 4.
  • the disclosure provides methods of treating MDS and sideroblastic anemias, particularly treating or preventing one or more subtypes or complications of MDS, with one or more ActRII antagonists, including the treatment of patients with MDS
  • the disclosure provides methods for using an ActRII antagonist, or combination of ActRII antagonists, to treat or prevent one or more complications of MDS and sideroblastic anemias including, for example, anemia, neutropenia, splenomegaly, blood transfusion requirement, development of acute myeloid leukemia, iron overload, and complications of iron overload, among which are congestive heart failure, cardiac arrhythmia, myocardial infarction, other forms of cardiac disease, diabetes mellitus, dyspnea, hepatic disease, and adverse effects of iron chelation therapy.
  • an ActRII antagonist, or combination of ActRII antagonists to treat or prevent one or more complications of MDS and sideroblastic anemias including, for example, anemia, neutropenia, splenomegaly, blood transfusion requirement, development of acute myeloid leukemia, iron overload, and complications of iron overload, among which are congestive heart failure, cardiac arrhythmia, myocardial infarction, other forms of cardiac disease, diabetes mellitus
  • the disclosure provides methods for using an ActRII antagonist, or combination of ActRII antagonists, to treat or prevent anemia or other complications in a subtype of MDS, including MDS patients with elevated numbers of erythroblasts
  • the disclosure provides methods for using an ActRII antagonist, or combination of ActRII antagonists, to treat or prevent anemia or other complications of a sideroblastic anemia, including but not limited to refractory anemia with ring sideroblasts (RARS); refractory anemia with ring sideroblasts and thrombocytosis (RARS-T); refractory cytopenia with multilineage dysplasia and ring sideroblasts (RCMD-RS); sideroblastic anemia associated with alcoholism; drug-induced sideroblastic anemia; sideroblastic anemia resulting from copper deficiency (zinc toxicity); sideroblastic anemia resulting from hypothermia; X- linked sideroblastic anemia (XLSA); SLC25A38 deficiency; glutaredoxin 5 deficiency; erythropoietic protoporphyria; X-linked sideroblastic anemia with ataxia
  • RARS refractory anemia with ring sideroblasts
  • XLSA/ A sideroblastic anemia with B-cell immunodeficiency, fevers, and developmental delay (SIFD); Pearson marrow-pancreas syndrome; myopathy, lactic acidosis, and
  • MLASA sideroblastic anemia
  • TRMA thiamine-responsive megaloblastic anemia
  • syndromic/nonsyndromic sideroblastic anemia of unknown cause MLASA
  • TRMA thiamine-responsive megaloblastic anemia
  • the disclosure provides methods for treating or preventing disorders or complications of a disorder that is associated with germ line or somatic mutations in SF3B1, DNMT3A, and/or TET2, such as myelodysplasia syndrome, chronic lymphocytic leukemia (CLL), and acute myeloid leukemia (AML) as well as in breast cancer, pancreatic cancer, gastric cancer, prostate cancer, and uveal melanoma.
  • the disorder may be in a subject that has bone marrow cells that test positive for an SF3B1, DNMT3A, and/or TET2 mutation, particularly myelodysplasia syndrome, CLL and AML.
  • a mutation in the SF3B1 gene is in an exon, intron or 5 ' or 3 ' untranslated region.
  • a mutation in SF3B1, DNMT3A, and/or TET2 causes a change in the amino acid sequence or does not cause a change in the amino acid sequence of the protein encoded by the gene.
  • a mutation in the SF3B1 gene causes a change in the amino acid of the protein encoded by the gene selected from the following changes: K182E, E491G, R590K, E592K, R625C, R625G, N626D, N626S, H662Y, T663A, K666M, K666Q, K666R, Q670E, G676D, V701I, I704N, I704V, G740R, A744P, D781G, Al 188V, N619K, N626H, N626Y, R630S, I704T, G740E, K741N, G742D, D894G, Q903R, R1041H, I1241T, G347V, E622D, Y623C, R625H, R625L, H662D, H662Q, T663I, K666E, K666N,
  • a mutation in the DNMT3A gene causes a change in the amino acid of the protein encoded by the gene selected from the following changes: R882C, R882H, P904L, and P905P.
  • a mutation in the DNMT3A gene introduces a premature stop codon.
  • a mutation in the DNMT3A gene that introduces a premature stop codon is selected from the following positions: Y436X and W893X.
  • a mutation in the TET2 gene causes a change in the amino acid of the protein encoded by the gene selected from the following changes: E47Q, Q1274R, W1291R, G1370R, N1387S, and Y1724H.
  • a mutation in the TET2 gene introduces a premature stop codon.
  • a mutation in the TET2 gene that introduces a premature stop codon is selected from the following positions: R550X, Q1009X, Y1337X, R1404X, R1516X, and Q1652X.
  • the terms "subject,” an "individual,” or a “patient” are interchangeable throughout the specification and generally refer to mammals. Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats).
  • a therapeutic that "prevents" a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
  • treating includes amelioration or elimination of the condition once it has been established. In either case, prevention or treatment may be discerned in the diagnosis provided by a physician or other health care provider and the intended result of administration of the therapeutic agent.
  • treatment or prevention of a disease or condition as described in the present disclosure is achieved by administering one or more of the ActRII antagonists (e.g., an ActRIIA and/or ActRIIB antagonist) of the present disclosure in an effective amount.
  • An effective amount of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
  • a “therapeutically effective amount” of an agent of the present disclosure may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the agent to elicit a desired response in the individual.
  • a “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result.
  • MDS Myelodysplasia syndromes
  • RCUD refractory cytopenia with unilineage dysplasia
  • RARS refractory anemia with ringed sideroblasts
  • RARS-T marked thrombocytosis
  • RAEB-1 refractory anemia with excess blasts
  • RAEB-2 refractory anemia with excess blasts in transformation
  • RCMD refractory cytopenia with multilineage dysplasia
  • MDS-U MDS unclassified
  • MDS-U myelodysplastic syndrome associated with an isolated 5q chromosome abnormality [MDS with del(5q)].
  • Allogenic stem-cell transplantation is the only known potentially curative therapy for MDS. However, only a minority of patients undergo this procedure due to advanced age, medical comorbidities, and limited availability of appropriate stem cell donors. Even for those patients who proceed to allogenic stem-cell transplantation, significant treatment- related mortality and morbidity, including acute and chronic graft-versus-host-disease, and high relapse rates compromise long-term disease-free survival [Zeidan et al. (2013) Blood Rev 27:243-259]. For these reasons, the majority of patients with MDS are still managed on a non-curative intent therapeutic paradigm. Treatment is based on prognostic factors that predict survival or progression to acute myeloid leukemia. Survival of lower-risk MDS patients ranges from several months to more than a decade, and most of these patients die from causes directly related to complications of MDS [Dayyani et al. (2010) Cancer
  • therapeutic strategies for lower-risk patients are adapted to the specific patient's situation, including severity and type of cytopenias and expected survival.
  • Lower-risk patients have multiple therapeutic options, including treatment with growth factors, lenalidomide in the case of del(5q) syndrome, thalidomide, pomalidomide, hypomethylating agents such as azacitidine or decitibine, and potentially investigational agents.
  • higher-risk MDS patients who are not eligible for allogenic stem-cell transplantation are typically treated with hypomethylating agents, intensive chemotherapy, or investigational agents [Garcia-Manero et al. (2011) 29:516-523].
  • MDS patients are afflicted with chronic anemia.
  • Approximately 80% to 90%) of MDS patients develop anemia during the course of their disease, of whom at least 40% become RBC transfusion-dependent [Santini (2011) Oncologist 16:35-42; Malcovati et al. (2005) J Clin Oncol 23:7594-7603; Leitch (2011) Blood Rev 25: 17-31].
  • Patients in higher-risk MDS groups are even more likely to become transfusion-dependent; for example, in one study 79%> of high-risk category patients versus 39% of low-risk patients required chronic transfusions to treat or prevent severe anemia
  • MDS low hemoglobin levels and dependence on red blood cell transfusions have been associated with inferior cardiovascular outcomes and increased mortality in patients with MDS, representing a strong rationale for aggressive management of anemia in MDS [Goldberg et al. (2010) J Clin Oncol 28:2847-2852; Leitch (2011) Blood Rev 25: 17-31; Oliva et al. (2011) Am J Blood Res 1 : 160-166; Ozcan et al. (2013) Expert Rev Hematol 6: 165-189]. MDS patients eventually require blood transfusions and/or treatment with
  • erythropoietic growth factors e.g., ESAs such as EPO
  • ESAs such as EPO
  • a colony-stimulating factor e.g., an analog of granulocyte colony-stimulating factor (G-CSF) such as filgrastim or an analog of granulocyte macrophage colony-stimulating factor (GM- GSF) such as sargramostim
  • G-CSF granulocyte colony-stimulating factor
  • GM- GSF granulocyte macrophage colony-stimulating factor
  • sargramostim an analog of granulocyte macrophage colony-stimulating factor
  • the frequency of transfusions depends on the extent of the disease and on the presence of comorbidities. Chronic transfusions are known to increase hemoglobin levels, which in turn improve brain and peripheral tissue oxygenation, thereby improving physical activity and mental alertness.
  • many MDS patients develop side-effects from the use of such therapies.
  • one or more ActRII antagonist agents of the disclosure may be used to treat patients with MDS or sideroblastic anemias.
  • patients suffering from MDS or a siderblastic anemia may be treated using one or more ActRII antagonist agents of the disclosure (e.g.
  • a GDF-ActRII antagonist an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • an EPO receptor activator optionally in combination with an EPO receptor activator.
  • patients suffering from MDS or a sideroblastic anemia may be treated using a combination of one or more ActRII antagonist agents of the disclosure (e.g.
  • a GDF-ActRII antagonist an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF Trap, etc.
  • additional therapeutic agents for treating MDS including, for example, ESAs including, e.g., epoetin alfa, epoetin beta (e.g., NeoRecormon), epoetin delta (e.g., Dynepo), epoetin omega, darbepoetin alfa (e.g., Aranesp), methoxy-polyethylene-glycol epoetin beta (e.g., Micera), and synthetic erythropoiesis protein (SEP); G-CSF analogs, including filgrastim; GM-CSF analogs , including sargramostim; lenalidomide; thalidomide; pomalidomide,
  • hypomethylating agents including azacitidine and decitabine
  • iron-chelating agents including deferoxamine (a.k.a., desferoxamine B, desferoxamine B, DFO-B, DFOA, DFB, or desferal), deferiprone (a.k.a., Ferriprox), and deferasirox (a.k.a., bis-hydroxyphenyl- triazole, ICL670, or ExjadeTM).
  • thrombopoietin mimetics including romiplostim and eltrombopag
  • chemotherapeutic agents including cytarabine (ara-C) alone or in combination with idarubicin, topotecan, or fludarabine
  • immunosuppressants including antithymocyte globulin, alemtuzumab, and cyclosporine
  • HDAC inhibitors histone deacetylase inhibitors
  • One or more ActRII antagonist agents of the disclosure may be used to increase red blood cell levels, hemoglobin levels, and/or hematocrit levels in a patient with anemia (MDS or sideroblastic anemia).
  • MDS or sideroblastic anemia
  • hematocrit levels in humans a level of less than normal for the appropriate age and gender category may be indicative of anemia, although individual variations are taken into account.
  • a hemoglobin level from 10-12.5 g/dl, and typically about 11.0 g/dl is considered to be within the normal range in healthy adults, although, in terms of therapy, a lower target level may cause fewer cardiovascular side effects. See, e.g., Jacobs et al. (2000) Nephrol Dial Transplant 15, 15-19.
  • hematocrit levels (percentage of the volume of a blood sample occupied by the cells) can be used as a measure of anemia.
  • Hematocrit levels for healthy individuals range from about 41-51% for adult males and from 35-45% for adult females.
  • a patient may be treated with a dosing regimen intended to restore the patient to a target level of red blood cells, hemoglobin, and/or hematocrit or allow the reduction or elimination of red blood cell transfusions while maintaining an acceptable level of red blood cells, hemoglobin and/or hematocrit.
  • the target hemoglobin and/or hematocrit level can be individualized for each patient.
  • Neutropenia denotes a condition of abnormally low levels of circulating granulocytes and is found in approximately 40% of MDS patients [Steensma et al. (2006) Mayo Clin Proc 81 : 104-130].
  • Common complaints of patients with neutropenia include fatigue and frequent bacterial infections, especially of the skin.
  • neutropenia can also result in serious complications in patients with MDS, and infection is the most common cause of MDS- associated death.
  • Treatment with granulocyte colony-stimulating factor (filgrastim) can help keep neutrophil counts above 1 x 10 9 /L for severely neutropenic patients [Akhtari (201 1) Oncology (Williston Park) 25 :480-486], but myeloid growth factors do not clearly modify disease history and may only increase production of functionally defective neutrophils lacking bactericidal capacity [Dayyani et al. (2010) Cancer 1 16:2174-2179; Steensma (201 1) Semin Oncol 38:635-647].
  • Prophylactic antibiotics have no proven role in patients with MDS and are not recommended for patients with neutropenia related to MDS.
  • one or more ActRII antagonist agents of the disclosure e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • an EPO receptor activator and/or one or more additional therapies such as a G-CSF or GM-CSF therapy, may be used to treat neutropenia in MDS patients.
  • One or more ActRII antagonist agents of the disclosure may be used to reduce the frequency of granulocyte transfusions in MDS patients.
  • one or more ActRII antagonist agents of the disclosure may be used to prevent or reverse complications of iron overload in patients with MDS or sideroblastic anemia.
  • one or more ActRII antagonist agents of the disclosure may be used to prevent or reverse a cardiac complication of iron overload including, e.g. , increased cardiac output, cardiomegaly, cardiomyopathy, left ventricular hypertrophy, acute myocardial infarction, arrhythmia, and congestive heart failure.
  • one or more ActRII antagonist agents of the disclosure may be used to reduce liver iron content and/or prevent or reverse a hepatic complication of iron overload including, e.g., liver enlargement (hepatomegaly), liver fibrosis (increase in scar tissue), and cirrhosis (extensive scarring).
  • one or more ActRII antagonist agents of the disclosure may be used to prevent or reverse an endocrine complication of iron overload including, e.g., diabetes mellitus.
  • ActRII antagonist agents of the disclosure may be administered to a subject in need thereof in combination with one or more additional agents [for example, ESAs; G-CSF analogs, including filgrastim; GM-CSF analogs, including sargramostim;
  • lenalidomide lenalidomide; thalidomide; pomalidomide, hypomethylating agents, including azacitidine and decitabine; iron-chelating agents, including deferoxamine and deferasirox; thrombopoietin mimetics, including romiplostim and eltrombopag; chemotherapeutic agents, including cytarabine (ara-C) alone or in combination with idarubicin, topotecan, or fludarabine;
  • chemotherapeutic agents including cytarabine (ara-C) alone or in combination with idarubicin, topotecan, or fludarabine;
  • immunosuppressants including antithymocyte globulin, alemtuzumab, and cyclosporine; histone deacetylase inhibitors (HDAC inhibitors), including vorinostat, valproic acid, phenylbutyrate, entinostat, MGCD0103, and other class I nuclear HDAC inhibitors, class II non-nuclear HDAC inhibitors, pan HDAC inhibitors, and isoform-specific HDAC inhibitors; farnesyltransferase inhibitors, including as tipifarnib and lonafarnib; tumor necrosis factor- alpha (TNF-a) inhibitors, including etanercept or infliximab; inhibitors of glutathione-S- transferase (GST) Pl-1, including ezatiostat; and inhitors of CD33, including gemtuzumab ozogamicin.] or supportive therapies [e.g., red blood cell transfusion, granulocyte transfusion, thromb
  • “in combination with” or “conjoint administration” refers to any form of administration such that additional therapies (e.g., second, third, fourth, etc.) are still effective in the body (e.g., multiple compounds are simultaneously effective in the patient, which may include synergistic effects of those compounds). Effectiveness may not correlate to measurable concentration of the agent in blood, serum, or plasma.
  • the different therapeutic compounds can be administered either in the same formulation or in separate formulations, either concomitantly or sequentially, and on different schedules. Thus, an individual who receives such treatment can benefit from a combined effect of different therapies.
  • GDF11 and/or activin B antagonist agents can be administered concurrently with, prior to, or subsequent to, one or more other additional agents or supportive therapies.
  • each therapeutic agent will be administered at a dose and/or on a time schedule determined for that particular agent.
  • the particular combination to employ in a regimen will take into account compatibility of the antagonist of the present disclosure with the therapy and/or the desired therapeutic effect to be achieved.
  • one or more ActRII antagonist agents of the disclosure may be used in combination with transfusion of either red blood cells or whole blood to treat anemia in patients with MDS or sideroblastic anemias.
  • a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, antibody etc. may be used in combination with transfusion of either red blood cells or whole blood to treat anemia in patients with MDS or sideroblastic anemias.
  • a GDF-ActRII antagonist e.g., an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, antibody etc.
  • the methods of the present disclosure relate to treating MDS or sideroblastic anemia in a subject in need thereof by administering a combination of an ActRII antagonist of the disclosure and one or more blood cell transfusions.
  • the methods of the present disclosure relate to treating or preventing one or more complications of MDS or sideroblastic anemia in a subject in need thereof by administering a combination of an ActRII antagonist of the disclosure and one or more red blood cell transfusions.
  • treatment with one or more ActRII antagonists of the disclosure is effective at decreasing the transfusion requirement in a patient with MDS or sideroblastic anemia, e.g., reduces the frequency and/or amount of blood transfusion required to effectively treat MDS or sideroblastic anemia or one or more their complications.
  • one or more ActRII antagonist agents of the disclosure ⁇ e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.), optionally combined with an EPO receptor activator and/or one or more additional therapies, may be used in combination with one or more iron-chelating molecules to promote iron excretion in the urine and/or stool and thereby prevent or reverse tissue iron overload in patients with MDS or sideroblastic anemias.
  • Effective iron-chelating agents should be able to selectively bind and neutralize ferric iron, the oxidized form of non-transferrin bound iron which likely accounts for most iron toxicity through catalytic production of hydroxyl radicals and oxidation products [see, e.g., Esposito et al. (2003) Blood 102:2670-2677]. These agents are structurally diverse, but all possess oxygen or nitrogen donor atoms able to form neutralizing octahedral coordination complexes with individual iron atoms in stoichiometries of 1 : 1 (hexadentate agents), 2: 1 (tridentate), or 3 : 1 (bidentate) [Kalinowski et al. (2005) Pharmacol Rev 57:547-583].
  • effective iron-chelating agents also are relatively low molecular weight ⁇ e.g., less than 700 daltons), with solubility in both water and lipids to enable access to affected tissues.
  • specific examples of iron-chelating molecules include deferoxamine, a hexadentate agent of bacterial origin requiring daily parenteral
  • ActRII antagonist agents of the disclosure e.g., one or more ActRII antagonist agents of the disclosure (e.g., one or more ActRII antagonist agents of the disclosure (e.g., one or more ActRII antagonist agents of the disclosure (e.g., one or more ActRII antagonist agents of the disclosure (e.g., one or more ActRII antagonist agents of the disclosure (e.g., one or more ActRII antagonist agents of the disclosure (e.g.
  • a GDF-ActRII antagonist an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • an EPO receptor activator and/or one or more additional therapies may be used to increase red blood cell levels, hemoglobin levels, and/or hematocrit levels in a patient with MDS or sideroblastic anemia.
  • a level of less than normal for the appropriate age and gender category may be indicative of anemia, although individual variations are taken into account.
  • a hemoglobin level from 10-12.5 g/dl, and typically about 11.0 g/dl is considered to be within the normal range in healthy adults, although, in terms of therapy, a lower target level may cause fewer cardiovascular side effects. See, e.g., Jacobs et al. (2000) Nephrol Dial
  • hematocrit levels (percentage of the volume of a blood sample occupied by the cells) can be used as a measure for anemia. Hematocrit levels for healthy individuals range from about 41-51% for adult males and from 35-45% for adult females.
  • a patient may be treated with a dosing regimen intended to restore the patient to a target level of red blood cells, hemoglobin, and/or hematocrit. As hemoglobin and hematocrit levels vary from person to person, optimally, the target hemoglobin and/or hematocrit level can be individualized for each patient.
  • One or more ActRII antagonist agents of the disclosure may be used in combination with EPO receptor activators and/or one or more additional therapies to treat anemia.
  • the suboptimal erythropoietin response in some patients with MDS is considered one biologic rationale for treating MDS-related anemia with ESAs [Greenberg et al. (2011) J Natl Compr Cane Netw 9:30-56; Santini (2012) Semin Hematol 49:295-303].
  • G-CSF granulocyte colony- stimulating factor
  • one or more ActRII antagonist agents of the disclosure may be used in combination with granulocyte colony-stimulating factor (e.g., filgrastim) or granulocyte macrophage colony-stimulating factor (e.g., sargramostim) to treat anemia.
  • granulocyte colony-stimulating factor e.g., filgrastim
  • granulocyte macrophage colony-stimulating factor e.g., sargramostim
  • the present disclosure provides methods of treating or preventing anemia in an individual in need thereof by administering to the individual a therapeutically effective amount of one or more ActRII antagonist agents of the disclosure (e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.) and a EPO receptor activator.
  • one or more ActRII antagonist agents of the disclosure e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • EPO receptor activators may be used in combination with EPO receptor activators to reduce the required dose of these activators in patients that are susceptible to adverse effects of ESAs. These methods may be used for therapeutic and prophylactic treatments of a patient.
  • One or more ActRII antagonist agents of the disclosure may be used in combination with EPO receptor activators to achieve an increase in red blood cells, particularly at lower dose ranges. This may be beneficial in reducing the known off-target effects and risks associated with high doses of EPO receptor activators.
  • the primary adverse effects of ESAs include, for example, an excessive increase in the hematocrit or hemoglobin levels and polycythemia. Elevated hematocrit levels can lead to hypertension (more particularly aggravation of hypertension) and vascular thrombosis.
  • an ActRII antagonist of the present disclosure may be beneficial for a patient in which administration of a normal to increased (> 300 IU/kg/week) dose of ESA does not result in the increase of hemoglobin level up to the target level.
  • Patients with an inadequate response to ESAs are found in all types of anemia, but higher numbers of non-responders have been observed particularly frequently in patients with cancers and patients with end-stage renal disease.
  • An inadequate response to ESAs can be either constitutive (observed upon the first treatment with ESA) or acquired (observed upon repeated treatment with ESA).
  • Lenalidomide is a thalidomide derivative approved for patients with lower-risk MDS with del5q and transfusion-dependent anemia.
  • Pomalidomide is another thalidomide derivative. Approval of lenalidomide in the U.S. was based on results of a phase 2 trial in which transfusion independence was achieved in about two thirds of patients studied, and the mean duration of transfusion independence was 2.2 years [List et al. (2006) N Engl J Med 355: 1456-1465]. Subsequently approved also in Europe [Giagounidis et al.
  • lenalidomide is considered the first-line treatment for patients with lower-risk MDS with del5q and anemia.
  • one or more ActRII antagonist agents of the disclosure e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • an EPO receptor activator and/or one or more additional therapies may be used in combination with lenalidomide for treating patients with MDS.
  • hypomethylating activity currently used to treat patients mainly with high-risk MDS is hypomethylating activity currently used to treat patients mainly with high-risk MDS
  • one or more ActRII antagonist agents of the disclosure e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • an EPO receptor activator and/or one or more additional therapies may be used in combination with azacitidine, decitabine, or another DNA methyltransferase inhibitor for treating patients with MDS.
  • Thrombocytopenia occurs in approximately 35% to 45% of MDS patients, who may complain of easy bruising or frequent minor mucocutaneous bleeding and may display purpura or petechiae [Steensma et al. (2006) Mayo Clin Proc 81 : 104-130]. In more extreme cases, increased risk of gastrointestinal bleeding or intracranial hemorrhage may occur.
  • platelet transfusions are typically indicated when platelet levels drop to less than 10,000 platelets ⁇ L [Slichter (2007) Hematology Am Soc Hematol Educ Program 2007: 172-178]. The supportive use of platelet transfusions is transient and not always effective due to the frequency of sensitization in chronically transfusion-dependent MDS patients.
  • one or more ActRII antagonist agents of the disclosure may be used in combination with thrombomimetic agents such as romiplostim or eltrombopag for treating patients with MDS or sideroblastic anemias.
  • one or more ActRII antagonist agents of the disclosure may be used in combination with hepcidin, a hepcidin analog, or a hepcidin receptor activator for treating patients with MDS or sideroblastic anemias, particularly for complications associated with iron overload.
  • hepcidin is considered a master regulator of iron metabolism by virtue of its ability to induce the degradation of ferroportin, an iron-export protein localized on absorptive enterocytes, hepatocytes, and macrophages.
  • hepcidin reduces availability of extracellular iron, so hepcidin, hepcidin analogs, or hepcidin receptor activators may be beneficial in the treatment of patients with MDS or sideroblastic anemias, particularly for complications associated with iron overload.
  • Investigational agents for MDS are in development. These include single-agent inhibitors of histone deacetylase, p38MAPK inhibitors, glutathione S-transferase ⁇ inhibitors, and alemtuzumab for patients who meet criteria for immunosuppressive -based therapy
  • Investigational therapies include, for example, histone deacetylase inhibitors (HDAC inhibitors), including vorinostat, valproic acid, phenylbutyrate, entinostat, MGCD0103, and other class I nuclear HDAC inhibitors, class II non-nuclear HDAC inhibitors, pan HDAC inhibitors, and isoform-specific HDAC inhibitors; famesyltransferase inhibitors, including as tipifarnib and lonafarnib; tumor necrosis factor-alpha (TNF-a) inhibitors, including
  • one or more ActRII antagonist agents of the disclosure e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • an EPO receptor activator and/or one or more additional therapies may be used in
  • one or more ActRII antagonist agents of the disclosure may be used to increase numbers of red blood cells in MDS patients additionally treated with a combination of two or more agents, including but not limited to growth factors, DNA methyltransferase inhibitors, histone deacetylase inhibitors, or immunosuppressant treatments.
  • the present disclosure provides methods for managing a patient that has been treated with, or is a candidate to be treated with, one or more one or more ActRII antagonist agents of the disclosure (e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.) by measuring one or more ActRII antagonist agents of the disclosure (e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.) by measuring one or more ActRII antagonist agents of the disclosure (e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.) by measuring one or more ActRII antagonist agents of the disclosure (e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • the hematologic parameters may be used to evaluate appropriate dosing for a patient who is a candidate to be treated with the antagonist of the present disclosure, to monitor the hematologic parameters during treatment, to evaluate whether to adjust the dosage during treatment with one or more antagonist of the disclosure, and/or to evaluate an appropriate maintenance dose of one or more antagonists of the disclosure. If one or more of the hematologic parameters are outside the normal level, dosing with one or more ActRII antagonist agents of the disclosure (e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.) may be reduced, delayed or terminated.
  • ActRII antagonist agents of the disclosure e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • Hematologic parameters that may be measured in accordance with the methods provided herein include, for example, red blood cell levels, blood pressure, iron stores, and other agents found in bodily fluids that correlate with increased red blood cell levels, using art recognized methods. Such parameters may be determined using a blood sample from a patient. Increases in red blood cell levels, hemoglobin levels, and/or hematocrit levels may cause increases in blood pressure.
  • one or more hematologic parameters are outside the normal range or on the high side of normal in a patient who is a candidate to be treated with one or more ActRII antagonist agents of the disclosure (e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.), then onset of administration of the one or more antagonists of the disclosure may be delayed until the hematologic parameters have returned to a normal or acceptable level either naturally or via therapeutic intervention. For example, if a candidate patient is hypertensive or pre -hypertensive, then the patient may be treated with a blood pressure lowering agent in order to reduce the patient's blood pressure.
  • ActRII antagonist agents of the disclosure e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • Any blood pressure lowering agent appropriate for the individual patient's condition may be used including, for example, diuretics, adrenergic inhibitors (including alpha blockers and beta blockers), vasodilators, calcium channel blockers, angiotensin-converting enzyme (ACE) inhibitors, or angiotensin II receptor blockers.
  • Blood pressure may alternatively be treated using a diet and exercise regimen.
  • the patient may be treated with an appropriate regimen of diet and/or iron supplements until the patient's iron stores have returned to a normal or acceptable level.
  • administering may be delayed until the levels have returned to a normal or acceptable level.
  • one or more hematologic parameters are outside the normal range or on the high side of normal in a patient who is a candidate to be treated with one or more ActRII antagonist agents of the disclosure (e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.)
  • ActRII antagonist agents of the disclosure e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • a therapeutic regimen may be developed for the patient that combines one or more ActRII antagonist agents of the disclosure (e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.) with a therapeutic agent that addresses the undesirable level of the hematologic parameter.
  • ActRII antagonist agents of the disclosure e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • a therapeutic regimen may be designed involving administration of one or more ActRII antagonist agents of the disclosure (e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.) and a blood pressure lowering agent.
  • ActRII antagonist agents of the disclosure e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • a therapeutic regimen may be developed involving one or more ActRII antagonist agents of the disclosure (e.g. , a GDF-ActRII antagonist, an
  • baseline parameter(s) for one or more hematologic parameters may be established for a patient who is a candidate to be treated with one or more ActRII antagonist agents of the disclosure (e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.) and an appropriate dosing regimen established for that patient based on the baseline value(s).
  • ActRII antagonist agents of the disclosure e.g., a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • established baseline parameters based on a patient's medical history could be used to inform an appropriate antagonist dosing regimen for a patient.
  • a patient's baseline values for one or more hematologic parameters prior to treatment with one or more ActRII antagonist agents of the disclosure may also be used as the relevant comparative values for monitoring any changes to the hematologic parameters during treatment with the one or more antagonists of the disclosure.
  • one or more hematologic parameters are measured in patients who are being treated with a one or more ActRII antagonist agents of the disclosure (e.g. , a GDF-ActRII antagonist, an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.).
  • the hematologic parameters may be used to monitor the patient during treatment and permit adjustment or termination of the dosing with the one or more antagonists of the disclosure or additional dosing with another therapeutic agent. For example, if administration of one or more ActRII antagonist agents of the disclosure (e.g.
  • a GDF-ActRII antagonist results in an increase in blood pressure, red blood cell level, or hemoglobin level, or a reduction in iron stores
  • the dose of the one or more antagonists of the disclosure may be reduced in amount or frequency in order to decrease the effects of the one or more antagonists of the disclosure on the one or more hematologic parameters. If administration of one or more ActRII antagonist agents of the disclosure (e.g.
  • a GDF-ActRII antagonist results in a change in one or more hematologic parameters that is adverse to the patient, then the dosing of the one or more antagonists of the disclosure may be terminated either temporarily, until the hematologic parameter(s) return to an acceptable level, or permanently. Similarly, if one or more hematologic parameters are not brought within an acceptable range after reducing the dose or frequency of administration of the one or more antagonists of the disclosure, then the dosing may be terminated.
  • the patient may be dosed with an additional therapeutic agent that addresses the undesirable level in the hematologic parameter(s), such as, for example, a blood pressure lowering agent or an iron supplement.
  • an additional therapeutic agent that addresses the undesirable level in the hematologic parameter(s)
  • a blood pressure lowering agent or an iron supplement such as, for example, a blood pressure lowering agent or an iron supplement.
  • a GDF-ActRII antagonist an ActRIIA polypeptide, an ActRIIB polypeptide, a GDF trap, etc.
  • dosing with the one or more antagonists of the disclosure may continue at the same level and a blood-pressure-lowering agent is added to the treatment regimen, dosing with the one or more antagonist of the disclosure may be reduced (e.g., in amount and/or frequency) and a blood-pressure-lowering agent is added to the treatment regimen, or dosing with the one or more antagonist of the disclosure may be terminated and the patient may be treated with a blood-pressure-lowering agent.
  • one or more ActRII antagonist agents of the disclosure can be administered alone or as a component of a pharmaceutical formulation (also referred to as a therapeutic composition or pharmaceutical composition).
  • a pharmaceutical formulation refers to a preparation which is in such form as to permit the biological activity of an active ingredient (e.g. , an agent of the present disclosure) contained therein to be effective and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • the subject compounds may be formulated for administration in any convenient way for use in human or veterinary medicine.
  • one or more agents of the present disclosure may be formulated with a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is generally nontoxic to a subject.
  • a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, and/or preservative.
  • pharmaceutical formulations for use in the present disclosure are in a pyrogen-free, physiologically-acceptable form when administered to a subject.
  • Therapeutically useful agents other than those described herein, which may optionally be included in the formulation as described above, may be
  • compositions suitable for parenteral administration may comprise one or more agents of the disclosure in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use.
  • Injectable solutions or dispersions may contain antioxidants, buffers, bacteriostats, suspending agents, thickening agents, or solutes which render the formulation isotonic with the blood of the intended recipient.
  • suitable aqueous and nonaqueous carriers which may be employed in the pharmaceutical formulations of the present disclosure include water, ethanol, polyols (e.g., glycerol, propylene glycol, polyethylene glycol, etc.), vegetable oils (e.g., olive oil), injectable organic esters (e.g., ethyl oleate), and suitable mixtures thereof.
  • Proper fluidity can be maintained, for example, by the use of coating materials (e.g., lecithin), by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • a therapeutic method of the present disclosure includes administering the pharmaceutical composition systemically, or locally, from an implant or device. Further, the pharmaceutical composition may be encapsulated or injected in a form for delivery to a target tissue site (e.g. , bone marrow or muscle).
  • compositions of the present disclosure may include a matrix capable of delivering one or more of the agents of the present disclosure to a target tissue site (e.g., bone marrow or muscle), providing a structure for the developing tissue and optimally capable of being resorbed into the body. For example, the matrix may provide slow release of one or more agents of the present disclosure.
  • Such matrices may be formed of materials presently in use for other implanted medical applications.
  • the choice of matrix material may be based on one or more of: biocompatibility, biodegradability, mechanical properties, cosmetic appearance, and interface properties.
  • Potential matrices for the compositions may be biodegradable and chemically defined calcium sulfate, tricalciumphosphate, hydroxyapatite, polylactic acid, and polyanhydrides.
  • Other potential materials are biodegradable and biologically well-defined, including, for example, bone or dermal collagen.
  • Further matrices are comprised of pure proteins or extracellular matrix components.
  • Other potential matrices are non-biodegradable and chemically defined, including, for example, sintered hydroxyapatite, bioglass, aluminates, or other ceramics.
  • Matrices may be comprised of combinations of any of the above mentioned types of material including, for example, polylactic acid and hydroxyapatite or collagen and tricalciumphosphate.
  • the bioceramics may be altered in composition (e.g., calcium- aluminate-phosphate) and processing to alter one or more of pore size, particle size, particle shape, and biodegradability.
  • compositions of the present disclosure can be administered orally, for example, in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis such as sucrose and acacia or tragacanth), powders, granules, a solution or a suspension in an aqueous or non-aqueous liquid, an oil-in- water or water-in-oil liquid emulsion, or an elixir or syrup, or pastille (using an inert base, such as gelatin and glycerin, or sucrose and acacia), and/or a mouth wash, each containing a predetermined amount of a compound of the present disclosure and optionally one or more other active ingredients.
  • a compound of the present disclosure and optionally one or more other active ingredients may also be administered as a bolus, electuary, or paste.
  • one or more compounds of the present disclosure may be mixed with one or more pharmaceutically acceptable carriers including, for example, sodium citrate, dicalcium phosphate, a filler or extender (e.g., a starch, lactose, sucrose, glucose, mannitol, and silicic acid), a binder (e.g.
  • carboxymethylcellulose an alginate, gelatin, polyvinyl pyrrolidone, sucrose, and acacia
  • a humectant e.g., glycerol
  • a disintegrating agent e.g., agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, a silicate, and sodium carbonate
  • a solution retarding agent e.g. paraffin
  • an absorption accelerator e.g. a quaternary ammonium compound
  • a wetting agent e.g., cetyl alcohol and glycerol monostearate
  • an absorbent e.g. , kaolin and bentonite clay
  • a lubricant e.g.
  • compositions may also comprise a buffering agent.
  • Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using one or more excipients including, e.g., lactose or a milk sugar as well as a high molecular-weight polyethylene glycol.
  • Liquid dosage forms for oral administration of the pharmaceutical composition may include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
  • the liquid dosage form may contain an inert diluent commonly used in the art including, for example, water or other solvent, a solubilizing agent and/or emulsifier [e.g., ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, or 1,3-butylene glycol, an oil (e.g., cottonseed, groundnut, corn, germ, olive, castor, and sesame oil), glycerol, tetrahydrofuryl alcohol, a polyethylene glycol, a fatty acid ester of sorbitan, and mixtures thereof].
  • a solubilizing agent and/or emulsifier e.g., ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene
  • the oral formulation can also include an adjuvant including, for example, a wetting agent, an emulsifying and suspending agent, a sweetening agent, a flavoring agent, a coloring agent, a perfuming agent, a preservative agent, and combinations thereof.
  • an adjuvant including, for example, a wetting agent, an emulsifying and suspending agent, a sweetening agent, a flavoring agent, a coloring agent, a perfuming agent, a preservative agent, and combinations thereof.
  • Suspensions in addition to the active compounds, may contain suspending agents including, for example, an ethoxylated isostearyl alcohol, polyoxyethylene sorbitol, a sorbitan ester, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar, tragacanth, and combinations thereof.
  • suspending agents including, for example, an ethoxylated isostearyl alcohol, polyoxyethylene sorbitol, a sorbitan ester, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar, tragacanth, and combinations thereof.
  • antibacterial and antifungal agents including, for example, paraben, chlorobutanol, and phenol sorbic acid.
  • an isotonic agent including, for example, a sugar or sodium chloride into the compositions.
  • prolonged absorption of an injectable pharmaceutical form may be brought about by the inclusion of an agent that delays absorption, including, for example, aluminum monostearate and gelatin.
  • the dosage regimen will be determined by the attending physician considering various factors which modify the action of the one or more of the agents of the present disclosure.
  • the various factors include, but are not limited to, the patient's red blood cell count, hemoglobin level, the desired target red blood cell count, the patient's age, the patient's sex, the patient's diet, the severity of any disease that may be contributing to a depressed red blood cell level, the time of administration, and other clinical factors.
  • the addition of other known active agents to the final composition may also affect the dosage. Progress can be monitored by periodic assessment of one or more of red blood cell levels, hemoglobin levels, reticulocyte levels, and other indicators of the hematopoietic process.
  • the present disclosure also provides gene therapy for the in vivo production of one or more of the agents of the present disclosure.
  • Such therapy would achieve its therapeutic effect by introduction of the agent sequences into cells or tissues having one or more of the disorders as listed above.
  • Delivery of the agent sequences can be achieved, for example, by using a recombinant expression vector such as a chimeric virus or a colloidal dispersion system.
  • Preferred therapeutic delivery of one or more of agent sequences of the disclosure is the use of targeted liposomes.
  • RNA virus ⁇ e.g., a retrovirus
  • the retroviral vector may be a derivative of a murine or avian retrovirus.
  • retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), and Rous sarcoma virus (RSV).
  • MoMuLV Moloney murine leukemia virus
  • HaMuSV Harvey murine sarcoma virus
  • MuMTV murine mammary tumor virus
  • RSV Rous sarcoma virus
  • a number of additional retroviral vectors can incorporate multiple genes. All of these vectors can transfer or incorporate a gene for a selectable marker so that transduced cells can be identified and generated.
  • Retroviral vectors can be made target-specific by attaching, for example, a sugar, a glycolipid, or a protein. Preferred targeting is accomplished by using an antibody. Those of skill in the art will recognize that specific polynucleotide sequences can be inserted into the retroviral genome or attached to a viral envelope to allow target specific delivery of the retroviral vector containing one or more of the agents of the present disclosure.
  • tissue culture cells can be directly transfected with plasmids encoding the retroviral structural genes (gag, pol, and env), by conventional calcium phosphate transfection. These cells are then transfected with the vector plasmid containing the genes of interest. The resulting cells release the retroviral vector into the culture medium.
  • a colloidal dispersion system includes, for example, macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • the preferred colloidal system of this disclosure is a liposome.
  • Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo. RNA, DNA, and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form [see, e.g., Fraley, et al. (1981) Trends Biochem. Sci., 6:77]. Methods for efficient gene transfer using a liposome vehicle are known in the art [see, e.g., Mannino, et al. (1988) Biotechniques, 6:682, 1988].
  • the composition of the liposome is usually a combination of phospholipids, which may include a steroid ⁇ e.g. cholesterol).
  • phospholipids which may include a steroid ⁇ e.g. cholesterol.
  • the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations.
  • Other phospholipids or other lipids may also be used, including, for example a phosphatidyl compound ⁇ e.g.,
  • phosphatidylglycerol phosphatidylcholine
  • phosphatidylserine phosphatidylethanolamine
  • sphingolipid cerebroside, or a ganglioside
  • egg phosphatidylcholine egg phosphatidylcholine
  • the targeting of liposomes is also possible based on, for example, organ specificity, cell specificity, and organelle specificity and is known in the art.
  • Applicants constructed a soluble ActRIIA fusion protein that has the extracellular domain of human ActRIIa fused to a human or mouse Fc domain with a minimal linker in between.
  • the constructs are referred to as ActRIIA-hFc and ActRIIA-mFc, respectively.
  • ActRIIA-hFc is shown below as purified from CHO cell lines (SEQ ID NO:22): ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEI VKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNP VTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNA TKPREEOYNSTYRVVSVLTVLHODWLNGKEY C VSN KALPVPIE TISKA GOPREPOVYTLPPSREEMTKNOVSLTCLV GFYPSDIAVEWES NGOPENNY TTPPVLDSDGSFFLYSKLTVD SRWOOGNVFSCSVMHEALHNHYTO SLSLSPG
  • Tissue plasminogen activator (ii): MDAMKRGLCCVLLLCGAVFVSP (SEQ ID NO:24)
  • the selected form employs the TPA leader and has the following unprocessed amino acid sequence:
  • This polypeptide is encoded by the following nucleic acid sequence:
  • the ActRIIA-hFc protein was purified to a purity of >98% as determined by size exclusion chromatography and >95% as determined by SDS PAGE.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Biotechnology (AREA)
  • Hematology (AREA)
  • Analytical Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Virology (AREA)
  • Biomedical Technology (AREA)
  • Developmental Biology & Embryology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pathology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Diabetes (AREA)
  • Oncology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2015/063835 2014-12-03 2015-12-03 Methods for treating myelodysplastic syndromes and sideroblastic anemias Ceased WO2016090188A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
AU2015358398A AU2015358398B2 (en) 2014-12-03 2015-12-03 Methods for treating myelodysplastic syndromes and sideroblastic anemias
KR1020177017082A KR102603899B1 (ko) 2014-12-03 2015-12-03 골수형성이상 증후군 및 철적혈모구 빈혈을 치료하기 위한 방법
EP15865103.4A EP3226887B1 (en) 2014-12-03 2015-12-03 Actriib polypeptides for use in the treatment sideroblastic anemia
HK18106801.6A HK1247115A1 (zh) 2014-12-03 2015-12-03 用於治疗骨髓增生异常综合征和铁粒幼红细胞性贫血的方法
CA2969413A CA2969413C (en) 2014-12-03 2015-12-03 METHODS OF TREATMENT FOR MYELODYSPLASTIC SYNDROMES AND SIDEROBLASTIC ANEMIAS
JP2017529349A JP6737786B2 (ja) 2014-12-03 2015-12-03 骨髄異形成症候群および鉄芽球性貧血を処置するための方法
CN201580075439.3A CN107405383A (zh) 2014-12-03 2015-12-03 用于治疗骨髓增生异常综合征和铁粒幼红细胞性贫血的方法
AU2021290319A AU2021290319A1 (en) 2014-12-03 2021-12-23 Methods for treating myelodysplastic syndromes and sideroblastic anemias

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201462086977P 2014-12-03 2014-12-03
US62/086,977 2014-12-03
US201462088087P 2014-12-05 2014-12-05
US62/088,087 2014-12-05
US201562155395P 2015-04-30 2015-04-30
US62/155,395 2015-04-30

Publications (1)

Publication Number Publication Date
WO2016090188A1 true WO2016090188A1 (en) 2016-06-09

Family

ID=56092498

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/063835 Ceased WO2016090188A1 (en) 2014-12-03 2015-12-03 Methods for treating myelodysplastic syndromes and sideroblastic anemias

Country Status (11)

Country Link
US (3) US10189882B2 (cg-RX-API-DMAC7.html)
EP (1) EP3226887B1 (cg-RX-API-DMAC7.html)
JP (2) JP6737786B2 (cg-RX-API-DMAC7.html)
KR (1) KR102603899B1 (cg-RX-API-DMAC7.html)
CN (1) CN107405383A (cg-RX-API-DMAC7.html)
AU (2) AU2015358398B2 (cg-RX-API-DMAC7.html)
CA (1) CA2969413C (cg-RX-API-DMAC7.html)
HK (1) HK1247115A1 (cg-RX-API-DMAC7.html)
MA (1) MA41119A (cg-RX-API-DMAC7.html)
TW (2) TWI758237B (cg-RX-API-DMAC7.html)
WO (1) WO2016090188A1 (cg-RX-API-DMAC7.html)

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10195249B2 (en) 2012-11-02 2019-02-05 Celgene Corporation Activin-ActRII antagonists and uses for treating bone and other disorders
US10548976B2 (en) 2015-05-20 2020-02-04 Celgene Corporation In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps
US11013785B2 (en) 2016-11-10 2021-05-25 Keros Therapeutics, Inc. Activin receptor type IIA variants and methods of use thereof
CN114761013A (zh) * 2019-09-27 2022-07-15 迪斯克医药公司 治疗骨髓纤维化和相关病症的方法
US11471510B2 (en) 2014-12-03 2022-10-18 Celgene Corporation Activin-ActRII antagonists and uses for treating anemia
US11484573B2 (en) 2017-11-09 2022-11-01 Keros Therapeutics, Inc. Activin receptor type IIa variants and methods of use thereof
WO2023176862A1 (ja) 2022-03-16 2023-09-21 第一三共株式会社 トランスフェリン受容体2の発現を抑制するsiRNA
US11813308B2 (en) 2014-10-09 2023-11-14 Celgene Corporation Treatment of cardiovascular disease using ActRII ligand traps
US11884715B2 (en) 2018-01-12 2024-01-30 Keros Therapeutics, Inc. Activin receptor type IIB variants and methods of use thereof
US12186370B1 (en) 2020-11-05 2025-01-07 Celgene Corporation ACTRIIB ligand trap compositions and uses thereof
US12194076B2 (en) 2016-07-27 2025-01-14 Acceleron Pharma Inc. Methods and compositions for treating myelofibrosis
US12365729B2 (en) 2020-05-13 2025-07-22 Disc Medicine, Inc. Anti-hemojuvelin (HJV) antibodies for treating myelofibrosis
US12364737B2 (en) 2018-05-09 2025-07-22 Keros Therapeutics, Inc. Activin receptor type IIA variants and methods of use thereof
US12440539B2 (en) 2020-03-20 2025-10-14 Keros Therapeutics, Inc. Methods of using activin receptor type IIB variants
US12522646B2 (en) 2020-03-20 2026-01-13 Keros Therapeutics, Inc. Activin receptor type II chimeras and methods of use thereof

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8216997B2 (en) 2008-08-14 2012-07-10 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators
CN114699529A (zh) * 2014-06-13 2022-07-05 阿塞勒隆制药公司 用于治疗溃疡的方法和组合物
MA41119A (fr) 2014-12-03 2017-10-10 Acceleron Pharma Inc Méthodes de traitement de syndromes myélodysplasiques et d'anémie sidéroblastique
WO2017079591A2 (en) 2015-11-04 2017-05-11 Acceleron Pharma Inc. Methods for increasing red blood cell levels and treating ineffective erythropoiesis
EP3380121B1 (en) 2015-11-23 2023-12-20 Acceleron Pharma Inc. Actrii antagonist for use in treating eye disorders
US20170240639A1 (en) * 2016-02-22 2017-08-24 Acceleron Pharma Inc. Actrii antagonists for use in increasing immune activity
CN108113965A (zh) * 2018-01-25 2018-06-05 苏州科技城医院 一种氟碳化合物脂质体及其制备方法
JP7663502B2 (ja) * 2018-10-31 2025-04-16 セルジーン コーポレイション 環状鉄芽球が見られる対象における非常に低リスク、低リスクまたは中程度のリスクの骨髄異形成症候群による貧血の、アクチビン-actriiリガンドトラップを用いた治療
WO2021189006A1 (en) * 2020-03-20 2021-09-23 Keros Therapeutics, Inc. Methods of using activin receptor type iia variants
US20230181690A1 (en) * 2020-04-13 2023-06-15 Celgene Corporation Methods for treating anemia using an actriib ligand trap and fedratinib
CN113604562B (zh) * 2020-05-05 2024-01-02 北京市神经外科研究所 Sf3b1基因突变在泌乳素型垂体腺瘤辅助诊断中的应用
CA3177632A1 (en) * 2020-05-15 2021-11-18 Melih ACAR Methods and compositions for treating anemia using actriib ligand traps and mtor inhibitors
MX2023008515A (es) * 2021-01-20 2023-07-27 Vifor Int Ag Inhibidores de ferroportina para su uso en el tratamiento de sindromes mielodisplasicos (smd).
WO2022271716A2 (en) * 2021-06-21 2022-12-29 Keros Therapeutics, Inc. Methods of using activin receptor type ii signaling inhibitors
WO2025015263A2 (en) * 2023-07-13 2025-01-16 Mayo Foundation For Medical Education And Research Treating myeloid disorders

Citations (69)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
US5096815A (en) 1989-01-06 1992-03-17 Protein Engineering Corporation Generation and selection of novel dna-binding proteins and polypeptides
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5198346A (en) 1989-01-06 1993-03-30 Protein Engineering Corp. Generation and selection of novel DNA-binding proteins and polypeptides
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
US5270163A (en) 1990-06-11 1993-12-14 University Research Corporation Methods for identifying nucleic acid ligands
US5278065A (en) 1989-02-03 1994-01-11 Genetics Institute, Inc. Recombinant DNA endoding an erythropoietin receptor
US5283317A (en) 1987-08-03 1994-02-01 Ddi Pharmaceuticals, Inc. Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols
US5475096A (en) 1990-06-11 1995-12-12 University Research Corporation Nucleic acid ligands
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5525490A (en) 1994-03-29 1996-06-11 Onyx Pharmaceuticals, Inc. Reverse two-hybrid method
WO1996026432A1 (en) 1995-02-23 1996-08-29 University Of Utah Research Foundation Composite waveguide for solid phase binding assays
US5567588A (en) 1990-06-11 1996-10-22 University Research Corporation Systematic evolution of ligands by exponential enrichment: Solution SELEX
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5580737A (en) 1990-06-11 1996-12-03 Nexstar Pharmaceuticals, Inc. High-affinity nucleic acid ligands that discriminate between theophylline and caffeine
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
US5677196A (en) 1993-05-18 1997-10-14 University Of Utah Research Foundation Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays
US5707796A (en) 1990-06-11 1998-01-13 Nexstar Pharmaceuticals, Inc. Method for selecting nucleic acids on the basis of structure
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5763177A (en) 1990-06-11 1998-06-09 Nexstar Pharmaceuticals, Inc. Systematic evolution of ligands by exponential enrichment: photoselection of nucleic acid ligands and solution selex
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5955280A (en) 1995-04-11 1999-09-21 The General Hospital Corporation Reverse two-hybrid system
US6011577A (en) 1997-06-30 2000-01-04 Polaroid Corporation Modular optical print head assembly
WO2000000823A1 (en) 1998-06-26 2000-01-06 Sunesis Pharmaceuticals, Inc. Methods for rapidly identifying small organic ligands
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO2000039585A1 (en) 1998-12-28 2000-07-06 Sunesis Pharmaceuticals, Inc. Identifying small organic molecule ligands for binding
WO2000043781A2 (en) 1999-01-21 2000-07-27 Metamorphix, Inc. Growth differentiation factor inhibitors and uses therefor
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US6319499B1 (en) 1994-07-26 2001-11-20 Amgen Inc. Methods for activating an erythropoietin receptor using antibodies
US6537966B1 (en) 1997-08-29 2003-03-25 Human Genome Sciences, Inc. Follistatin-3
US6699843B2 (en) 1995-06-07 2004-03-02 Gilead Sciences, Inc. Method for treatment of tumors using nucleic acid ligands to PDGF
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2005025601A1 (en) 2003-09-15 2005-03-24 Monash University Follistatin isoforms and uses thereof
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
WO2006012627A2 (en) 2004-07-23 2006-02-02 Acceleron Pharma Inc. Actrii receptor polypeptides, methods and compositions
US20060025576A1 (en) 2000-04-11 2006-02-02 Genentech, Inc. Multivalent antibodies and uses therefor
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US7041870B2 (en) 2000-11-30 2006-05-09 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
US20060148748A1 (en) 1999-07-29 2006-07-06 Gilead Sciences, Inc. Nucleic acid ligands which bind to hepatocyte growth factor/scatter factor (HGF/SF) or its receptor c-met
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US20070061900A1 (en) 2000-10-31 2007-03-15 Murphy Andrew J Methods of modifying eukaryotic cells
WO2007053775A1 (en) 2005-11-01 2007-05-10 Amgen Inc. Novel activin receptor and uses thereof
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
WO2008030367A2 (en) 2006-09-01 2008-03-13 The General Hospital Corporation Selective myostatin inhibitors
WO2008076437A2 (en) * 2006-12-18 2008-06-26 Acceleron Pharma Inc. Activin-actrii antagonists and uses for increasing red blood cell levels
WO2008097541A2 (en) 2007-02-02 2008-08-14 Acceleron Pharma Inc. Variants derived from actriib and uses therefor
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
US7612041B2 (en) 2005-11-23 2009-11-03 Acceleron Pharma Inc. Isolated activin-binding ActRIIa polypeptide comprising the SEQ ID NO: 7 and uses for promoting bone growth
US20100028331A1 (en) 2006-12-18 2010-02-04 Acceleron Pharma Inc. Antagonists of activin-actriia and uses for increasing red blood cell levels
WO2010019261A1 (en) 2008-08-14 2010-02-18 Acceleron Pharma Inc. Use of gdf traps to increase red blood cell levels
WO2011020045A1 (en) * 2009-08-13 2011-02-17 Acceleron Pharma Inc. Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels
WO2013059347A1 (en) 2011-10-17 2013-04-25 Acceleron Pharma, Inc. Methods and compositions for treating ineffective erythropoiesis
WO2014066487A2 (en) * 2012-10-24 2014-05-01 Celgene Corporation Methods for treating anemia
WO2015161220A1 (en) * 2014-04-18 2015-10-22 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating sickle-cell disease

Family Cites Families (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1713905A (zh) 2002-10-15 2005-12-28 细胞基因公司 用于治疗骨髓增生异常综合征的选择性细胞因子抑制药
US20040223966A1 (en) 2002-10-25 2004-11-11 Wolfman Neil M. ActRIIB fusion polypeptides and uses therefor
US7879569B2 (en) 2004-11-09 2011-02-01 The Trustees Of The University Of Pennsylvania Methods for diagnosis of myelodysplastic syndromes (MDS)
US20100028332A1 (en) 2006-12-18 2010-02-04 Acceleron Pharma Inc. Antagonists of actriib and uses for increasing red blood cell levels
MX2009008222A (es) * 2007-02-01 2009-10-12 Acceleron Pharma Inc Antagonistas de activina-actriia y usos para tratar o prevenir cancer de mama.
CN102131822A (zh) 2008-06-26 2011-07-20 阿塞勒隆制药公司 进行激活素-ActRIIa拮抗剂给药和监测受治疗患者的方法
US8216997B2 (en) 2008-08-14 2012-07-10 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators
EP2412798A1 (en) 2010-07-27 2012-02-01 Gambro Lundia AB Biomimetic membrane for cell expansion
JP2017509647A (ja) 2014-03-21 2017-04-06 アクセルロン ファーマ, インコーポレイテッド アクチビンbおよび/またはgdf11の阻害によって赤血球レベルを増大させ、無効赤血球生成を処置する方法
CN114699529A (zh) 2014-06-13 2022-07-05 阿塞勒隆制药公司 用于治疗溃疡的方法和组合物
JP2018501307A (ja) 2014-12-03 2018-01-18 セルジーン コーポレイション アクチビン−ActRIIアンタゴニスト及び貧血を治療するための使用
MA41119A (fr) 2014-12-03 2017-10-10 Acceleron Pharma Inc Méthodes de traitement de syndromes myélodysplasiques et d'anémie sidéroblastique
US20180125928A1 (en) 2015-05-13 2018-05-10 Celgene Corporation Treatment of beta-thalassemia using actrii ligand traps
CN108348578B (zh) 2015-08-04 2022-08-09 阿塞勒隆制药公司 用于治疗骨髓增生性病症的方法

Patent Citations (73)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5283317A (en) 1987-08-03 1994-02-01 Ddi Pharmaceuticals, Inc. Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US5096815A (en) 1989-01-06 1992-03-17 Protein Engineering Corporation Generation and selection of novel dna-binding proteins and polypeptides
US5198346A (en) 1989-01-06 1993-03-30 Protein Engineering Corp. Generation and selection of novel DNA-binding proteins and polypeptides
US5278065A (en) 1989-02-03 1994-01-11 Genetics Institute, Inc. Recombinant DNA endoding an erythropoietin receptor
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5580737A (en) 1990-06-11 1996-12-03 Nexstar Pharmaceuticals, Inc. High-affinity nucleic acid ligands that discriminate between theophylline and caffeine
US5475096A (en) 1990-06-11 1995-12-12 University Research Corporation Nucleic acid ligands
US5567588A (en) 1990-06-11 1996-10-22 University Research Corporation Systematic evolution of ligands by exponential enrichment: Solution SELEX
US5707796A (en) 1990-06-11 1998-01-13 Nexstar Pharmaceuticals, Inc. Method for selecting nucleic acids on the basis of structure
US5763177A (en) 1990-06-11 1998-06-09 Nexstar Pharmaceuticals, Inc. Systematic evolution of ligands by exponential enrichment: photoselection of nucleic acid ligands and solution selex
US5270163A (en) 1990-06-11 1993-12-14 University Research Corporation Methods for identifying nucleic acid ligands
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
US5677196A (en) 1993-05-18 1997-10-14 University Of Utah Research Foundation Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays
US5525490A (en) 1994-03-29 1996-06-11 Onyx Pharmaceuticals, Inc. Reverse two-hybrid method
US6319499B1 (en) 1994-07-26 2001-11-20 Amgen Inc. Methods for activating an erythropoietin receptor using antibodies
WO1996026432A1 (en) 1995-02-23 1996-08-29 University Of Utah Research Foundation Composite waveguide for solid phase binding assays
US5965368A (en) 1995-04-11 1999-10-12 The General Hospital Corporation Reverse two-hybrid systems
US5955280A (en) 1995-04-11 1999-09-21 The General Hospital Corporation Reverse two-hybrid system
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6699843B2 (en) 1995-06-07 2004-03-02 Gilead Sciences, Inc. Method for treatment of tumors using nucleic acid ligands to PDGF
US6011577A (en) 1997-06-30 2000-01-04 Polaroid Corporation Modular optical print head assembly
US6537966B1 (en) 1997-08-29 2003-03-25 Human Genome Sciences, Inc. Follistatin-3
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
WO2000000823A1 (en) 1998-06-26 2000-01-06 Sunesis Pharmaceuticals, Inc. Methods for rapidly identifying small organic ligands
WO2000039585A1 (en) 1998-12-28 2000-07-06 Sunesis Pharmaceuticals, Inc. Identifying small organic molecule ligands for binding
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US7332581B2 (en) 1999-01-15 2008-02-19 Genentech, Inc. Polypeptide variants with altered effector function
WO2000043781A2 (en) 1999-01-21 2000-07-27 Metamorphix, Inc. Growth differentiation factor inhibitors and uses therefor
US20060148748A1 (en) 1999-07-29 2006-07-06 Gilead Sciences, Inc. Nucleic acid ligands which bind to hepatocyte growth factor/scatter factor (HGF/SF) or its receptor c-met
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US20060025576A1 (en) 2000-04-11 2006-02-02 Genentech, Inc. Multivalent antibodies and uses therefor
US20070061900A1 (en) 2000-10-31 2007-03-15 Murphy Andrew J Methods of modifying eukaryotic cells
US7041870B2 (en) 2000-11-30 2006-05-09 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
WO2005025601A1 (en) 2003-09-15 2005-03-24 Monash University Follistatin isoforms and uses thereof
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
WO2006012627A2 (en) 2004-07-23 2006-02-02 Acceleron Pharma Inc. Actrii receptor polypeptides, methods and compositions
US7709605B2 (en) 2004-07-23 2010-05-04 Acceleron Pharma Inc. ActRII receptor polypeptides, methods and compositions
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
WO2007053775A1 (en) 2005-11-01 2007-05-10 Amgen Inc. Novel activin receptor and uses thereof
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US7612041B2 (en) 2005-11-23 2009-11-03 Acceleron Pharma Inc. Isolated activin-binding ActRIIa polypeptide comprising the SEQ ID NO: 7 and uses for promoting bone growth
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
WO2008030367A2 (en) 2006-09-01 2008-03-13 The General Hospital Corporation Selective myostatin inhibitors
US20100028331A1 (en) 2006-12-18 2010-02-04 Acceleron Pharma Inc. Antagonists of activin-actriia and uses for increasing red blood cell levels
WO2008076437A2 (en) * 2006-12-18 2008-06-26 Acceleron Pharma Inc. Activin-actrii antagonists and uses for increasing red blood cell levels
WO2008097541A2 (en) 2007-02-02 2008-08-14 Acceleron Pharma Inc. Variants derived from actriib and uses therefor
US7842663B2 (en) 2007-02-02 2010-11-30 Acceleron Pharma Inc. Variants derived from ActRIIB and uses therefor
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
WO2010019261A1 (en) 2008-08-14 2010-02-18 Acceleron Pharma Inc. Use of gdf traps to increase red blood cell levels
WO2011020045A1 (en) * 2009-08-13 2011-02-17 Acceleron Pharma Inc. Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels
WO2013059347A1 (en) 2011-10-17 2013-04-25 Acceleron Pharma, Inc. Methods and compositions for treating ineffective erythropoiesis
WO2014066487A2 (en) * 2012-10-24 2014-05-01 Celgene Corporation Methods for treating anemia
WO2015161220A1 (en) * 2014-04-18 2015-10-22 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating sickle-cell disease

Non-Patent Citations (209)

* Cited by examiner, † Cited by third party
Title
"Genbank", Database accession no. NM_001616.4
"The Cancer Genome Atlas Network", NATURE, vol. 490, 2012, pages 61 - 70
AKHTARI, ONCOLOGY (WILLISTON PARK, vol. 25, 2011, pages 480 - 486
ALLENDORPH ET AL., PNAS, vol. 103, no. 20, 2006, pages 7643 - 7648
ALMAGROFRANSSON, FRONT. BIOSCI, vol. 13, 2008, pages 1619 - 1633
ASHMORE ET AL., GROWTH, vol. 38, 1974, pages 501 - 507
ATTIE ET AL., AM J HEMATOL, vol. 89, 2014, pages 766 - 770
ATTISANO ET AL., CELL, vol. 68, no. 1, 1992, pages 97 - 108
BACA, J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684
BALINT ET AL., GENE, vol. 137, 1993, pages 109 - 118
BARTEL ET AL., BIOTECHNIQUES, vol. 14, 1993, pages 920 - 924
BARZI ET AL.: "77", CLEVE CLIN J MED, 2010, pages 37 - 44
BEJAR ET AL., BLOOD, vol. 124, 2014, pages 2793 - 2803
BENOISTCHAMBON, NATURE, vol. 29, 1981, pages 304 - 310
BIANKIN ET AL., NATURE, vol. 491, 2012, pages 399 - 405
BOERNER ET AL., J. IMMUNOL., vol. 147, 1991, pages 86
BOTTOMLEY ET AL., HEMATOL ONCOL CLIN N AM, vol. 28, 2014, pages 653 - 670
BOTTOMLEY ET AL., HEMATOL ONCOL CLINN AM, vol. 28, 2014, pages 653 - 670
BRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42
BROWN ET AL., GROWTH FACTORS, vol. 3, 1990, pages 35 - 43
BROWN ET AL., MOL. CELL BIOL, vol. 12, 1992, pages 2644 - 2652
BRUGGEMANN, M., MED., vol. 166, 1987, pages 1351 - 1361
BUNN, N ENGL J MED, vol. 346, no. 7, 2002, pages 522 - 523
CAO ET AL., PEDIATR REP, vol. 3, no. 2, 2011, pages e17
CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285
CAZZOLA ET AL., BLOOD, vol. 122, 2013, pages 4021 - 4034
CAZZOLA ET AL., BR J HAEMATOL, vol. 50, 1982, pages 189 - 199
CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881
CHESNAIS ET AL., ONCOTARGET, vol. 3, 2012, pages 1284 - 1293
CHESON ET AL., BLOOD, vol. 108, 2006, pages 1830 - 1834
CHESON ET AL.: "International Working Group", BLOOD, vol. 96, 2000, pages 3671 - 3674, XP086508085, DOI: 10.1182/blood.V96.12.3671
CHIBA ET AL., NATURE, vol. 362, 1993, pages 646
CHOWDHURY, METHODS MOL. BIOL, vol. 207, 2008, pages 179 - 196
CLYNES ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656
COONEY ET AL., SCIENCE, vol. 241, 1988, pages 456
CRAGG, M. S. ET AL., BLOOD, vol. 102, 2003, pages 2670 - 2677
CRAGG, M. SM. J. GLENNIE, BLOOD, vol. 104, 2004, pages 2738 - 2743
CUNNINGHAM ET AL., SCIENCE, vol. 244, 1989, pages 1081 - 1085
CWIRLA ET AL., PNAS USA, vol. 87, 1990, pages 6378 - 6382
D'ANDREA ET AL., CELL, vol. 57, 1989, pages 277
DAVIDOFF ET AL., LEUK RES, vol. 37, 2013, pages 675 - 680
DAYYANI ET AL., CANCER, vol. 116, 2010, pages 2174 - 2179
DEL RE, J BIOL CHEM., vol. 279, no. 51, 2004, pages 53126 - 53135
DELANTY ET AL., NEUROLOGY, vol. 49, 1997, pages 686 - 689
DEMETRI ET AL., J CLIN ONCOL, vol. 16, 1998, pages 3412 - 3425
DENNLER ET AL., EMBO, vol. 17, 1998, pages 3091 - 3100
DEPAOLO ET AL., PROC SOC EP BIOL MED, vol. 198, 1991, pages 500 - 512
DERVAN ET AL., SCIENCE, vol. 251, 1991, pages 1300
DEVLIN ET AL., SCIENCE, vol. 249, 1990, pages 404 - 406
DOLATSHAD ET AL., LEUKEMIA, 2014
DONZEET ET AL., NUCLEIC ACIDS RES, vol. 30, 2002, pages e46
DYSON ET AL., CURR BIOL, vol. 7, 1997, pages 81 - 84
ESCHBACH ET AL., N ENGL J MED, vol. 316, 1987, pages 73
ESTEY, CURR OPIN HEMATOL, vol. 10, 2003, pages 60 - 67
EUR. J. BIOCHEM, vol. 218, 1993, pages 597 - 601
FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472
FENAUX ET AL., LANCET ONCOL, vol. 10, 2009, pages 223 - 232
FLATMAN ET AL., J. CHROMATOGR. B, vol. 848, 2007, pages 79 - 87
FRALEY ET AL., TRENDS BIOCHEM. SCI, vol. 6, 1981, pages 77
FURNEY ET AL., CANCER DISCOV, vol. 3, 2013, pages 1122 - 1129
GALANELLO ET AL., ANN NY ACAD SCI, vol. 1202, 2010, pages 79 - 86
GAMER ET AL., DEV BIOL, vol. 208, 1999, pages 222 - 32
GAMER ET AL., DEV BIOL, vol. 229, 2001, pages 407 - 20
GAMER ET AL., DEV. BIOL, vol. 208, 1999, pages 222 - 232
GARCIA-MANERO ET AL., J CLIN ONCOL, vol. 29, 2011, pages 516 - 523
GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, no. 163, 1996
GIAGOUNIDIS ET AL., EUR J HAEMATOL, vol. 93, 2014, pages 429 - 438
GLASPY ET AL., J CLIN ONCOL, vol. 15, 1997, pages 1218 - 1234
GLASPY, ANNU REV MED, vol. 60, 2009, pages 181 - 192
GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS
GONZALEZ-CADAVID, PNAS, vol. 95, 1998, pages 14938 - 43
GREENBERG ET AL., BLOOD, vol. 114, 2009, pages 2393 - 2400
GREENBERG ET AL., J NATL COMPR CANC NETW, vol. 9, 2011, pages 30 - 56
GREENER, STRATEGIES IN MOL BIOL, vol. 7, 1994, pages 32 - 34
GREENWALD ET AL., NATURE STRUCTURAL BIOLOGY, vol. 6, no. 1, 1999, pages 18 - 22
GRIFFITHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734
GROBET ET AL., NAT GENET, vol. 17, no. 1, 1997, pages 71 - 4
GUSTIN ET AL., VIROLOGY, vol. 193, 1993, pages 653 - 660
HELLSTROM, I ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502
HELLSTROM-LINDBERG ET AL., BR J HAEMATOL, vol. 120, 2003, pages 1037 - 1046
HILDEN ET AL., BLOOD, vol. 83, no. 8, 1994, pages 2163 - 2170
HOCHULI ET AL., J. CHROMATOGRAPHY, vol. 411, 1987, pages 177
HOHJOH, FEBS LETT, vol. 521, 2002, pages 195 - 199
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HOOGENBOOM ET AL., IN METHODS IN MOLECULAR BIOLOGY, vol. 178, 2001, pages 1 - 37
HOOGENBOOMWINTER, J. MOL. BIOL, vol. 227, 1992, pages 381 - 388
HUDSON ET AL., NAT. MED, vol. 9, 2003, pages 129 - 134
IKE ET AL., NUCLEIC ACID RES., vol. 11, pages 477
ITAKURA ET AL., ANNU. REV. BIOCHEM., vol. 53, pages 323
ITAKURA ET AL., SCIENCE, vol. 198, 1984, pages 1056
ITAKURA ET AL.: "Macromolecules", 1981, ELSEVIER, article "Recombinant DNA, Proc. 3rd Cleveland Sympos", pages: 273 - 289
IWABUCHI ET AL., ONCOGENE, vol. 8, 1993, pages 1693 - 1696
JACOBS ET AL., NEPHROL DIAL TRANSPLANT, vol. 15, 2000, pages 51 - 56
JAKOBY WB ET AL., METHODS IN ENZYMOLOGY, vol. 46, 1974, pages 1
JANKNECHT ET AL., PNAS USA, vol. 88, 1991, pages 8972
JE ET AL., INT J CANCER, vol. 133, 2013, pages 260 - 266
JELKMANN ET AL., CRITREV ONCOL. HEMATOL, vol. 67, 2008, pages 39 - 61
JUNEJA ET AL., J CLIN PATHOL, vol. 36, 1983, pages 566 - 569
KALINOWSKI ET AL., PHARMACOL REV, vol. 57, 2005, pages 547 - 583
KAMBADUR ET AL., GENOME RES, vol. 7, 1997, pages 910 - 915
KANTARJIAN ET AL., BLOOD, vol. 116, 2010, pages 3163 - 3170
KANTARJIAN ET AL., CANCER, vol. 109, 2007, pages 1133 - 1137
KANTARJIAN ET AL., J CLIN ONCOL, vol. 28, 2010, pages 5166 - 5173
KASHMIRI ET AL., METHODS, vol. 36, 2005, pages 61 - 68
KLIMKA ET AL., BR. J. CANCER, vol. 83, 2000, pages 252 - 260
KLINGMULLER ET AL., CELL, vol. 80, 1995, pages 729 - 738
KOZBAR ET AL., IMMUNOLOGY TODAY, vol. 4, 1983, pages 72
KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001
KRAPF ET AL., CLIN J AM SOC NEPHROL, vol. 4, 2009, pages 470 - 480
LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132
LEEMCPHERRON, PROC. NATL. ACAD. SCI. USA, vol. 98, 2001, pages 9306 - 9311
LEITCH, BLOOD REV, vol. 25, 2011, pages 17 - 31
LEUNG ET AL., METHOD CELL MOL BIOL, vol. 1, 1989, pages 11 - 19
LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 3557 - 3562
LIN ET AL., BLOOD, vol. 106, 2005, pages 287 - 295
LIST ET AL., N ENGL J MED, vol. 355, 2006, pages 1456 - 1465
LONBERG, CURR. OPIN. IMMUNOL, vol. 20, 2008, pages 450 - 459
LONBERG, NAT. BIOTECHNOL., vol. 23, 2005, pages 1117 - 1125
LOWMAN ET AL., BIOCHEMISTRY, vol. 30, 1991, pages 10832 - 10838
LYONS ET AL., J CLIN ONCOL, vol. 27, 2009, pages 1850 - 1856
LYONS ET AL., LEUK RES, vol. 38, 2014, pages 149 - 154
MACDOUGALL ET AL., N ENGL J MED, vol. 361, 2009, pages 1848 - 1855
MACIAS-SILVA, J BIOL CHEM., vol. 273, 1998, pages 25628 - 36
MADURA ET AL., J BIOL CHEM, vol. 268, 1993, pages 12046 - 12054
MALCOVATI ET AL., BEST PRACT RES CLIN HAEMATOL, vol. 26, 2013, pages 431 - 444
MALCOVATI ET AL., BLOOD, vol. 118, no. 21, 2011, pages 6239 - 6246
MALCOVATI ET AL., HAEMATOLOGICA, vol. 96, 2011, pages 1433 - 1440
MALCOVATI ET AL., J CLIN ONCOL, vol. 23, 2005, pages 7594 - 7603
MANNINO ET AL., BIOTECHNIQUES, vol. 6, no. 682, 1988, pages 1988
MARKS ET AL., J. MOL. BIOL., vol. 222, 1992, pages 581 - 597
MASSAGUE, NAT. REV. MOL. CELL BIOL, vol. 1, 2000, pages 169 - 178
MATHEWSVALE, CELL, vol. 65, 1991, pages 973 - 982
MCKNIGHT ET AL., SCIENCE, vol. 232, 1982, pages 316
MCPHERRON ET AL., NAT. GENET, vol. 22, 1999, pages 260 - 264
MCPHERRON ET AL., NATURE, vol. 387, 1997, pages 83 - 90
MCPHERRONLEE, PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 12457 - 12461
MIYAZONO ET AL., J. BIOL. CHEM., vol. 263, 1988, pages 6407 - 6415
MOL. IMMUNOL, vol. 28, 1991, pages 489 - 498
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
MOYO ET AL., ANN HEMATOL, vol. 87, 2008, pages 527 - 536
MUFTI ET AL., HAEMATOLOGICA, vol. 93, 2008, pages 1712 - 1717
MURATA ET AL., PNAS, vol. 85, 1988, pages 2434
NAGASHIMA ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 2888 - 2892
NAKASHIMA ET AL., MECH. DEV, vol. 80, 1999, pages 185 - 189
NARANG, SA, TETRAHEDRON, vol. 39, 1983, pages 3
NEGRIN ET AL., BLOOD, vol. 87, 1996, pages 4076 - 4081
NI, XIANDAI MIANYIXUE, vol. 26, no. 4, 2006, pages 265 - 268
NOGUCHI ET AL., MOL CELL BIOL, vol. 8, 1988, pages 2604
O'CONNOR, J. NEUROCHEM, vol. 56, 1991, pages 560
OH ET AL., GENES DEV, vol. 16, 2002, pages 2749 - 54
OLIVA ET AL., AM J BLOOD RES, vol. 1, 2011, pages 160 - 166
ORNSTEIN ET AL., INT J HEMATOL, vol. 95, 2012, pages 26 - 33
OSCAN ET AL., EXPERT REV HEMATOL, vol. 6, 2013, pages 165 - 189
PADDISON ET AL., GENES & DEV, vol. 16, 2002, pages 948 - 958
PAPAEMMANUIL ET AL., NENGL J MED, vol. 365, 2011, pages 1384 - 1395
PATEL ET AL., J BIOL CHEM, vol. 267, 1992, pages 21300
PETKOVA, S. B ET AL., INT. IMMUNOL, vol. 18, no. 12, 2006, pages 1759 - 1769
PHARR ET AL.: "90", PROC NATL ACAD SCI USA, vol. 90, 1993, pages 11593 - 11355
PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599
PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623
QUEEN ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 83, 1986, pages 10029 - 10033
QURESHI, PROC NATL ACAD SCI USA, vol. 96, 1999, pages 12156 - 12161
RAVETCHKINET, ANNU. REV. IMMUNOL, vol. 348, 1991, pages 457 - 492
RAWN, CURR OPIN ANAESTHESIOL, vol. 21, 2008, pages 664 - 668
RIECHMANN ET AL., NATURE, vol. 256, 1975, pages 495 - 497
ROBERTS ET AL., PNAS USA, vol. 89, 1992, pages 2429 - 2433
ROSOK, J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618
RUF ET AL., BIOCHEMISTRY, vol. 33, 1994, pages 1565 - 1572
SAKUMA ET AL., GENES CELLS. 2002, vol. 7, 2002, pages 401 - 12
SANTINI ET AL., PLOS ONE, vol. 6, 2011, pages e23109
SANTINI, ONCOLOGIST, vol. 16, 2011, pages 35 - 42
SANTINI, SEMIN HEMATOL, vol. 49, 2012, pages 295 - 303
SCHUELKE ET AL., N ENGL J MED, vol. 350, 2004, pages 2682 - 8
SIAH ET AL., CLIN BIOCHEM REV, vol. 27, 2006, pages 5 - 16
SIDHU ET AL., J. MOL. BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093
SIMS: "151", J. IMMUNOL., 1993, pages 2296
SINGIBARTI, J. CLIN INVESTIG, vol. 372, 1994, pages S36 - S43
SLICHTER, HEMATOLOGY AM SOC HEMATOL EDUC PROGRAM 2007, 2007, pages 172 - 178
SOCOLOVSKY ET AL., BLOOD, vol. 178, 2001, pages 3261 - 3273
STEENSMA ET AL., MAYO CLIN PROC, vol. 81, 2006, pages 104 - 130
STEENSMA, SEMIN ONCOL, vol. 38, 2011, pages 635 - 647
SURAGANI ET AL., NAT MED, vol. 20, 2014, pages 408 - 414
SURAGANI R.N.V.S. ET AL.: "Transforming growth factor-beta superfamily ligand trap ACE-536 corrects anemia by promoting late-stage erythropoiesis", NATURE MEDICINE, vol. 20, no. 4, April 2014 (2014-04-01), pages 408 - 414, XP055410209 *
SWATLANDKIEFFER, J. ANIM. SCI, vol. 38, 1994, pages 752 - 757
TEMRAZ ET AL., CRIT REV ONCOL HEMATOL, vol. 91, 2014, pages 64 - 73
THOMPSON ET AL., THE EMBO JOURNAL, vol. 22, no. 7, pages 1555 - 1566
TOTHOVA ET AL., CLIN CANCER RES, vol. 19, 2013, pages 1637 - 1643
VAN DIJKVAN DE WINKEL, CURR. OPIN. PHARMACOL, vol. 5, 2001, pages 368 - 74
VIDALLEGRAIN, NUCLEIC ACIDS RES, vol. 27, 1999, pages 919 - 29
VIDALLEGRAIN, TRENDS BIOTECHNOL, vol. 17, 1999, pages 374 - 81
VOLLMERSBRANDLEIN, HISTOL. HISTOPATHOL, vol. 20, no. 3, 2005, pages 927 - 937
VOLLMERSBRANDLEIN, METHODS FIND EXP. CLIN. PHARMACOL, vol. 27, no. 3, 2005, pages 185 - 91
WAGNER ET AL., PROC. NATL. ACAD. SCI. U. S.A., vol. 78, 1981, pages 1441 - 1445
WAKEFIELD ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 3095 - 3099
WANG ET AL., N ENGL J MED, vol. 365, 2011, pages 2497 - 2506
WEATHERALLPROVAN, LANCET, vol. 355, 2000, pages 1169 - 1175
WEBB, DRUG DISCOV TODAY, vol. 18, 2013, pages 43 - 49
WINKELMAN ET AL., BLOOD, vol. 76, 1990, pages 24
WINTER ET AL., ANN. REV. IMMUNOL, vol. 113, 1994, pages 433 - 455
WOODRUFF, BIOCHEM PHARMACOL, vol. 55, 1998, pages 953 - 963
WU, NEURON, vol. 37, 2003, pages 197 - 207
YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797
YAMASHITA ET AL., J. CELL BIOL., vol. 130, 1995, pages 217 - 226
YANG ET AL., PROC NATL ACAD SCI USA, vol. 99, 2002, pages 6047 - 6052
YEOWHITMAN, MOL. CELL, vol. 7, 2001, pages 949 - 957
ZEIDAN ET AL., BLOOD REV, vol. 27, 2013, pages 243 - 259
ZEIDAN ET AL., CURR HEMATOL MALIG REP, vol. 8, 2013, pages 351 - 360
ZERVOS ET AL., CELL, vol. 72, 1993, pages 223 - 232
ZHOU ET AL., BLOOD, vol. 112, 2008, pages 3434 - 3443

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10195249B2 (en) 2012-11-02 2019-02-05 Celgene Corporation Activin-ActRII antagonists and uses for treating bone and other disorders
US11813308B2 (en) 2014-10-09 2023-11-14 Celgene Corporation Treatment of cardiovascular disease using ActRII ligand traps
US11471510B2 (en) 2014-12-03 2022-10-18 Celgene Corporation Activin-ActRII antagonists and uses for treating anemia
US10548976B2 (en) 2015-05-20 2020-02-04 Celgene Corporation In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps
US12194076B2 (en) 2016-07-27 2025-01-14 Acceleron Pharma Inc. Methods and compositions for treating myelofibrosis
US11013785B2 (en) 2016-11-10 2021-05-25 Keros Therapeutics, Inc. Activin receptor type IIA variants and methods of use thereof
US11090361B2 (en) 2016-11-10 2021-08-17 Keros Therapeutics, Inc. Activin receptor type IIa variants and methods of use thereof
US12582700B2 (en) 2016-11-10 2026-03-24 Keros Therapeutics, Inc. Activin receptor type IIA variants and methods of use thereof
US11717558B2 (en) 2016-11-10 2023-08-08 Keros Therapeutics, Inc. Nucleic acid molecules encoding activin receptor type IIA variants
US12350313B2 (en) 2016-11-10 2025-07-08 Keros Therapeutics, Inc. Activin receptor type IIa variants and methods of use thereof
US11484573B2 (en) 2017-11-09 2022-11-01 Keros Therapeutics, Inc. Activin receptor type IIa variants and methods of use thereof
US11884715B2 (en) 2018-01-12 2024-01-30 Keros Therapeutics, Inc. Activin receptor type IIB variants and methods of use thereof
US12269858B2 (en) 2018-01-12 2025-04-08 Keros Therapeutics, Inc. Activin receptor type IIB variants and methods of use thereof
US12364737B2 (en) 2018-05-09 2025-07-22 Keros Therapeutics, Inc. Activin receptor type IIA variants and methods of use thereof
CN114761013A (zh) * 2019-09-27 2022-07-15 迪斯克医药公司 治疗骨髓纤维化和相关病症的方法
US12440539B2 (en) 2020-03-20 2025-10-14 Keros Therapeutics, Inc. Methods of using activin receptor type IIB variants
US12522646B2 (en) 2020-03-20 2026-01-13 Keros Therapeutics, Inc. Activin receptor type II chimeras and methods of use thereof
US12365729B2 (en) 2020-05-13 2025-07-22 Disc Medicine, Inc. Anti-hemojuvelin (HJV) antibodies for treating myelofibrosis
US12497452B2 (en) 2020-05-13 2025-12-16 Disc Medicine, Inc. Anti-hemojuvelin (HJV) antibodies for treating myelofibrosis
US12186370B1 (en) 2020-11-05 2025-01-07 Celgene Corporation ACTRIIB ligand trap compositions and uses thereof
WO2023176862A1 (ja) 2022-03-16 2023-09-21 第一三共株式会社 トランスフェリン受容体2の発現を抑制するsiRNA

Also Published As

Publication number Publication date
JP2017537921A (ja) 2017-12-21
EP3226887A1 (en) 2017-10-11
EP3226887B1 (en) 2024-03-27
TWI758237B (zh) 2022-03-21
HK1247115A1 (zh) 2018-09-21
US20190233486A1 (en) 2019-08-01
CA2969413A1 (en) 2016-06-09
TW202220689A (zh) 2022-06-01
US20160289286A1 (en) 2016-10-06
AU2015358398B2 (en) 2021-10-07
AU2015358398A1 (en) 2017-06-15
KR102603899B1 (ko) 2023-11-17
MA41119A (fr) 2017-10-10
JP2020169217A (ja) 2020-10-15
JP6737786B2 (ja) 2020-08-12
TW201636043A (zh) 2016-10-16
US10829531B2 (en) 2020-11-10
US10189882B2 (en) 2019-01-29
EP3226887A4 (en) 2018-08-08
CN107405383A (zh) 2017-11-28
AU2021290319A1 (en) 2022-02-03
KR20170088927A (ko) 2017-08-02
CA2969413C (en) 2025-02-04
US20210230239A1 (en) 2021-07-29

Similar Documents

Publication Publication Date Title
US10829531B2 (en) Methods for treating myelodysplastic syndromes and sideroblastic anemias
AU2021202382B2 (en) Methods for increasing red blood cell levels and treating sickle-cell disease
US11260107B2 (en) Methods and compositions for treating ulcers
US20220233697A1 (en) Methods for increasing red blood cell levels and treating ineffective erythropoiesis
US20210155672A1 (en) Methods for increasing red blood cell levels and treating ineffective erythropoiesis
AU2017302282A1 (en) Methods and compositions for treating myelofibrosis

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15865103

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2969413

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2017529349

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2015358398

Country of ref document: AU

Date of ref document: 20151203

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20177017082

Country of ref document: KR

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015865103

Country of ref document: EP